A0A075B684_MOUSE Loading...

Immunoglobulin heavy variable 1-62-1

AlphaFold DB , UniProt , Accession A0A075B684, Species MOUSE (Mus musculus, Mouse), Gene Ighv1-62-1, Length 30 aa.

						>A0A075B684_MOUSE|A0A075B684|Ighv1-62-1
QVQLQQSGAELVRPGASVKLSCKASGYTFT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	Q	82.9	Confident	91.3	Very high	211 Å²	211	124.5 Å²	124.5	99%	0.986	69%	0.687	S	S	*	*				0	133.8	0	-177	173.4	11.9	0	0	107.5
2	V	88.9	Confident	91.6	Very high	81 Å²	81	118.7 Å²	118.7	49%	0.491	66%	0.657	S	S	.	*			trans	-78.3	137.3	178.4	-172	0	0	0	0	109.2	L4	V2-L4 HydrophobicContact CG1-CD2 4.29Å
3	Q	91.1	Very high	92	Very high	126 Å²	126	126.1 Å²	126.1	59%	0.589	67%	0.669	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-123.7	136.7	172.5	-68.3	-179.9	-29.9	0	0	109.1	A24 S25	Q3-A24 WeakPolarHBondContact O-CA 3.37Å; Q3-S25 PolarHBondContact N-O 2.9Å; Q3-S25 PolarHBondContact O-N 2.84Å; Q3-S25 WeakPolarHBondContact CB-OG 3.46Å
4	L	91.4	Very high	92.2	Very high	122 Å²	122	126.9 Å²	126.9	64%	0.639	69%	0.685	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-116.6	129.1	176.2	-59.9	-179.3	0	0	0	108.6	V2 K23 A24	V2-L4 HydrophobicContact CG1-CD2 4.29Å; L4-K23 CarbonylContact C-O 3.52Å; L4-K23 WeakPolarHBondContact CA-O 3.38Å; L4-A24 HydrophobicContact CD2-CB 3.58Å
5	Q	92.6	Very high	92.5	Very high	134 Å²	134	124.3 Å²	124.3	63%	0.626	70%	0.699	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-119.8	116	176.3	-172.4	-178.6	26.1	0	0	109.7	C22 K23	Q5-C22 CarbonylContact O-C 3.59Å; Q5-C22 WeakPolarHBondContact O-CA 3.43Å; Q5-K23 PolarHBondContact O-N 3.35Å; Q5-K23 PolarHBondContact N-O 2.85Å
6	Q	92.8	Very high	92.8	Very high	157 Å²	157	120 Å²	120	73%	0.734	69%	0.685	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-84.6	161.1	177.2	-61.9	179.5	2.2	0	0	111.3	S21	Q6-S21 CarbonylContact C-O 3.57Å; Q6-S21 WeakPolarHBondContact CA-O 3.42Å
7	S	91.1	Very high	92.9	Very high	41 Å²	41	120.1 Å²	120.1	29%	0.287	70%	0.695	S	S	.	*	P	Polyproline II helix	trans	-59.9	150.1	164.9	50.1	0	0	0	0	111	S21	S7-S21 PolarHBondContact N-O 2.88Å; S7-S21 PolarHBondContact OG-N 3.25Å
8	G	92.6	Very high	92.9	Very high	65 Å²	65	117.4 Å²	117.4	67%	0.67	68%	0.68	S	S	*	*	P	Polyproline II helix	trans	-63.6	166.9	177.9	0	0	0	0	0	113.2
9	A	93.4	Very high	92.9	Very high	116 Å²	116	121.4 Å²	121.4	96%	0.959	69%	0.688	S	S	*	*	P	Polyproline II helix	trans	-68.8	138.5	173	0	0	0	0	0	110.8
10	E	92.3	Very high	92.9	Very high	143 Å²	143	122.2 Å²	122.2	67%	0.668	69%	0.69	S	S	*	*			trans	-130.8	138.3	177.9	-171.6	178.9	169.9	0	0	109.7	V12	E10-V12 HydrophobicContact CG-CG1 3.94Å
11	L	95	Very high	92.9	Very high	173 Å²	173	119.7 Å²	119.7	91%	0.906	68%	0.68	S	S	*	*			trans	-95.8	117.2	172.3	-174.8	68.4	0	0	0	109
12	V	95.1	Very high	93.3	Very high	55 Å²	55	113.3 Å²	113.3	33%	0.333	66%	0.658	S	S	.	*			trans	-119.6	160.1	178.9	-60	0	0	0	0	111.7	E10 A16 V18	E10-V12 HydrophobicContact CG-CG1 3.94Å; V12-A16 HydrophobicContact CB-CB 4.2Å; V12-A16 HydrophobicContact CG2-CB 4.5Å; V12-V18 HydrophobicContact CG2-CG2 3.64Å; V12-V18 HydrophobicContact CG1-CG2 3.91Å; V12-V18 HydrophobicContact CB-CG2 4.4Å
13	R	96.2	Very high	93.4	Very high	215 Å²	215	116.3 Å²	116.3	81%	0.811	67%	0.665	S	S	*	*			trans	-72.9	149.9	174.9	-65.1	178.5	-178.4	173.9	0.1	110.5	G15 A16	R13-G15 PolarHBondContact O-N 3.31Å; R13-A16 WeakPolarHBondContact O-CB 3.42Å; R13-A16 PolarHBondContact O-N 2.82Å; R13-A16 VanDerWaalsContact O-N 3.14Å
14	P	95.9	Very high	93.4	Very high	138 Å²	138	111.8 Å²	111.8	90%	0.896	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.8	133.1	169.9	-25.3	34.6	0	0	0	111.4
15	G	96.4	Very high	93.4	Very high	87 Å²	87	108.7 Å²	108.7	90%	0.897	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	89.2	-7.2	-178.5	0	0	0	0	0	115.6	R13	R13-G15 PolarHBondContact O-N 3.31Å
16	A	96.7	Very high	93.1	Very high	56 Å²	56	105.2 Å²	105.2	46%	0.463	64%	0.637	S	S	.	*			trans	-80.9	151.3	171.9	0	0	0	0	0	111.8	V12 R13	V12-A16 HydrophobicContact CB-CB 4.2Å; V12-A16 HydrophobicContact CG2-CB 4.5Å; R13-A16 WeakPolarHBondContact O-CB 3.42Å; R13-A16 PolarHBondContact O-N 2.82Å; R13-A16 VanDerWaalsContact O-N 3.14Å
17	S	94.8	Very high	92.6	Very high	122 Å²	122	104 Å²	104	85%	0.853	63%	0.627	S	S	*	*			trans	-90.1	142.5	172.7	-59.9	0	0	0	0	111
18	V	93.3	Very high	92.2	Very high	72 Å²	72	107.4 Å²	107.4	44%	0.436	65%	0.647	S	S	.	*			trans	-109.4	136	172.6	-177.9	0	0	0	0	109.1	V12 L20	V12-V18 HydrophobicContact CG2-CG2 3.64Å; V12-V18 HydrophobicContact CG1-CG2 3.91Å; V12-V18 HydrophobicContact CB-CG2 4.4Å; V18-L20 HydrophobicContact CG1-CD2 3.83Å; V18-L20 HydrophobicContact CG1-CG 4.38Å
19	K	92.8	Very high	91.6	Very high	192 Å²	192	112 Å²	112	84%	0.835	65%	0.648	S	S	*	*			trans	-101.5	104.7	172.2	-175.1	176.3	-179.3	178.1	0	109.7
20	L	93.3	Very high	91	Very high	137 Å²	137	115.8 Å²	115.8	72%	0.717	66%	0.66	S	S	*	*			trans	-81.4	145.3	173	-58.2	179	0	0	0	110.3	V18	V18-L20 HydrophobicContact CG1-CD2 3.83Å; V18-L20 HydrophobicContact CG1-CG 4.38Å
21	S	92.5	Very high	91	Very high	70 Å²	70	114.4 Å²	114.4	49%	0.49	66%	0.659	S	S	.	*			trans	-131.8	151.2	169.2	61.8	0	0	0	0	110.5	Q6 S7	Q6-S21 CarbonylContact C-O 3.57Å; Q6-S21 WeakPolarHBondContact CA-O 3.42Å; S7-S21 PolarHBondContact N-O 2.88Å; S7-S21 PolarHBondContact OG-N 3.25Å
22	C	91.6	Very high	90.8	Very high	77 Å²	77	111.3 Å²	111.3	52%	0.52	65%	0.646	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-134	128.1	175.7	-176.3	0	0	0	0	108.2	Q5	Q5-C22 CarbonylContact O-C 3.59Å; Q5-C22 WeakPolarHBondContact O-CA 3.43Å
23	K	90.7	Very high	90.5	Very high	144 Å²	144	114.4 Å²	114.4	63%	0.626	66%	0.664	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-101.4	125.3	171.4	-65.4	179.5	-178.5	177.8	0	107.9	L4 Q5	L4-K23 CarbonylContact C-O 3.52Å; L4-K23 WeakPolarHBondContact CA-O 3.38Å; Q5-K23 PolarHBondContact O-N 3.35Å; Q5-K23 PolarHBondContact N-O 2.85Å
24	A	90.8	Very high	90.2	Very high	32 Å²	32	108.5 Å²	108.5	26%	0.264	66%	0.655	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-94.7	136.5	166.3	0	0	0	0	0	109.4	Q3 L4 F29	Q3-A24 WeakPolarHBondContact O-CA 3.37Å; L4-A24 HydrophobicContact CD2-CB 3.58Å; A24-F29 HydrophobicContact CB-CE2 3.62Å; A24-F29 HydrophobicContact CB-CZ 3.62Å
25	S	90.6	Very high	89.8	Confident	56 Å²	56	106.7 Å²	106.7	39%	0.392	64%	0.64	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-130.4	160	170.2	59.9	0	0	0	0	109.8	Q3 Y27	Q3-S25 PolarHBondContact N-O 2.9Å; Q3-S25 PolarHBondContact O-N 2.84Å; Q3-S25 WeakPolarHBondContact CB-OG 3.46Å; S25-Y27 PolarHBondContact O-N 3.36Å
26	G	86.6	Confident	89.4	Confident	61 Å²	61	108 Å²	108	63%	0.629	62%	0.623	S	S	*	*	S	Bend	trans	74	10.8	-175.2	0	0	0	0	0	114.5
27	Y	83.4	Confident	88.9	Confident	131 Å²	131	111.7 Å²	111.7	51%	0.514	63%	0.634	S	S	.	*			trans	-149.1	141.3	170.6	-173.6	-101.1	0	0	0	110	S25 F29	S25-Y27 PolarHBondContact O-N 3.36Å; Y27-F29 AromaticContact CD1-CD1 4Å; Y27-F29 HydrophobicContact CD1-CD1 4Å; Y27-F29 HydrophobicContact CD1-CE1 4.1Å; Y27-F29 HydrophobicContact CD1-CG 4.38Å; Y27-F29 AromaticContact CE1-CD1 3.86Å; Y27-F29 HydrophobicContact CE1-CD1 3.86Å; Y27-F29 HydrophobicContact CE1-CE1 4.25Å; Y27-F29 HydrophobicContact CE1-CG 4.4Å
28	T	83	Confident	88.4	Confident	114 Å²	114	110.9 Å²	110.9	70%	0.699	62%	0.617	S	S	*	*			trans	-104.8	121.4	172.5	-57.3	0	0	0	0	108.2	T30	T28-T30 PolarHBondContact O-N 3.14Å
29	F	79.5	Confident	88	Confident	161 Å²	161	114.2 Å²	114.2	71%	0.706	63%	0.632	S	S	*	*			trans	-72.4	114.8	169	-56.4	-78.5	0	0	0	108.1	A24 Y27	A24-F29 HydrophobicContact CB-CE2 3.62Å; A24-F29 HydrophobicContact CB-CZ 3.62Å; Y27-F29 AromaticContact CD1-CD1 4Å; Y27-F29 HydrophobicContact CD1-CD1 4Å; Y27-F29 HydrophobicContact CD1-CE1 4.1Å; Y27-F29 HydrophobicContact CD1-CG 4.38Å; Y27-F29 AromaticContact CE1-CD1 3.86Å; Y27-F29 HydrophobicContact CE1-CD1 3.86Å; Y27-F29 HydrophobicContact CE1-CE1 4.25Å; Y27-F29 HydrophobicContact CE1-CG 4.4Å
30	T	81.1	Confident	87.6	Confident	195 Å²	195	107.1 Å²	107.1	100%	1.196	61%	0.614	S	S	*	*			trans	-92.1	0	168.6	54.7	0	0	0	0	110.5	T28	T28-T30 PolarHBondContact O-N 3.14Å

Retrieved 30 of 30 residues in 27.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).