LV861_HUMAN Loading...

Immunoglobulin lambda variable 8-61

V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition¹. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens^2,3. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen^4,5.

AlphaFold DB , UniProt , Accession A0A075B6I0, Species HUMAN (Homo sapiens, Human), Gene IGLV8-61, Length 122 aa.

						>LV861_HUMAN|A0A075B6I0|IGLV8-61
MSVPTMAWMMLLLGLLAYGSGVDSQTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.6	Very low	67.1	Low	242 Å²	242	125.9 Å²	125.9	100%	1.192	68%	0.68	S	S	*	*				0	94.3	0	-53.4	157.3	172	0	0	106.1
2	S	61	Low	67.6	Low	117 Å²	117	123.8 Å²	123.8	82%	0.818	67%	0.668	S	S	*	*			trans	-128.9	87.5	-175.4	-44.2	0	0	0	0	106.5	P4	S2-P4 VanDerWaalsContact O-CD 3.25Å; S2-P4 WeakPolarHBondContact O-CD 3.38Å; S2-P4 VanDerWaalsContact O-N 3.17Å
3	V	60.1	Low	67.6	Low	112 Å²	112	123.2 Å²	123.2	68%	0.679	66%	0.663	S	S	*	*			trans	-65.3	113.2	173.4	-179.8	0	0	0	0	106	A7	V3-A7 HydrophobicContact CG1-CB 4.25Å
4	P	60.4	Low	67.6	Low	84 Å²	84	116.8 Å²	116.8	55%	0.545	64%	0.64	S	S	.	*			trans	-72.1	142	-167.3	26.8	-30.9	0	0	0	110.2	S2 M6 A7	S2-P4 VanDerWaalsContact O-CD 3.25Å; S2-P4 WeakPolarHBondContact O-CD 3.38Å; S2-P4 VanDerWaalsContact O-N 3.17Å; P4-M6 PolarHBondContact O-N 3.36Å; P4-A7 PolarHBondContact O-N 3.48Å
5	T	69	Low	67.4	Low	114 Å²	114	116.1 Å²	116.1	70%	0.699	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-41	-25.9	178.6	43.7	0	0	0	0	115.4	A7 W8 M9	T5-A7 PolarHBondContact O-N 3.22Å; T5-W8 PolarHBondContact O-N 3.31Å; T5-M9 PolarHBondContact O-N 2.61Å
6	M	68.9	Low	67.2	Low	128 Å²	128	117.6 Å²	117.6	63%	0.631	64%	0.641	S	S	*	*	H	α-helix	trans	-61.7	-36.2	176.5	-67	-176.6	74.6	0	0	113.9	P4 W8 M9 M10	P4-M6 PolarHBondContact O-N 3.36Å; M6-W8 VanDerWaalsContact C-N 3.26Å; M6-W8 PolarHBondContact O-N 2.72Å; M6-M9 PolarHBondContact O-N 3.18Å; M6-M10 WeakPolarHBondContact O-CG 3.35Å; M6-M10 PolarHBondContact O-N 2.99Å; M6-M10 VanDerWaalsContact O-N 3.09Å
7	A	72.1	Confident	67.1	Low	53 Å²	53	115.2 Å²	115.2	44%	0.438	64%	0.641	S	S	.	*	H	α-helix	trans	-64.8	-34.9	179.2	0	0	0	0	0	111.6	V3 P4 T5 L11	V3-A7 HydrophobicContact CG1-CB 4.25Å; P4-A7 PolarHBondContact O-N 3.48Å; T5-A7 PolarHBondContact O-N 3.22Å; A7-L11 WeakPolarHBondContact O-CB 3.17Å; A7-L11 PolarHBondContact O-N 3.14Å; A7-L11 VanDerWaalsContact O-N 3.08Å
8	W	74.3	Confident	66.8	Low	166 Å²	166	119.2 Å²	119.2	63%	0.629	65%	0.646	S	S	*	*	H	α-helix	trans	-73.9	-38.1	176.7	-74.9	73	0	0	0	112.2	T5 M6 M10 L11 L12	T5-W8 PolarHBondContact O-N 3.31Å; M6-W8 VanDerWaalsContact C-N 3.26Å; M6-W8 PolarHBondContact O-N 2.72Å; W8-M10 VanDerWaalsContact C-N 3.34Å; W8-M10 PolarHBondContact O-N 3.14Å; W8-L11 PolarHBondContact O-N 2.96Å; W8-L12 WeakPolarHBondContact O-CB 3.41Å; W8-L12 VanDerWaalsContact O-CG 3.3Å; W8-L12 WeakPolarHBondContact O-CG 3.21Å; W8-L12 PolarHBondContact O-N 2.65Å
9	M	74.9	Confident	66.5	Low	134 Å²	134	116.3 Å²	116.3	66%	0.66	65%	0.646	S	S	*	*	H	α-helix	trans	-60.1	-43.7	173.3	-84	179.2	167.5	0	0	111.8	T5 M6 L12 L13	T5-M9 PolarHBondContact O-N 2.61Å; M6-M9 PolarHBondContact O-N 3.18Å; M9-L12 PolarHBondContact O-N 2.98Å; M9-L13 VanDerWaalsContact O-CB 3.28Å; M9-L13 WeakPolarHBondContact O-CB 3.44Å; M9-L13 PolarHBondContact O-N 3.06Å
10	M	74.4	Confident	66.4	Low	125 Å²	125	115.9 Å²	115.9	62%	0.616	65%	0.652	S	S	*	*	H	α-helix	trans	-67.8	-38.7	177.9	-63.9	-62.6	164.8	0	0	112.1	M6 W8 L13 G14	M6-M10 WeakPolarHBondContact O-CG 3.35Å; M6-M10 PolarHBondContact O-N 2.99Å; M6-M10 VanDerWaalsContact O-N 3.09Å; W8-M10 VanDerWaalsContact C-N 3.34Å; W8-M10 PolarHBondContact O-N 3.14Å; M10-L13 PolarHBondContact O-N 3Å; M10-G14 PolarHBondContact O-N 3.3Å
11	L	75.3	Confident	66.4	Low	110 Å²	110	113.9 Å²	113.9	58%	0.576	66%	0.657	S	S	*	*	H	α-helix	trans	-64.4	-45	175.3	-166.3	85.8	0	0	0	111.4	A7 W8 G14 L15	A7-L11 WeakPolarHBondContact O-CB 3.17Å; A7-L11 PolarHBondContact O-N 3.14Å; A7-L11 VanDerWaalsContact O-N 3.08Å; W8-L11 PolarHBondContact O-N 2.96Å; L11-G14 PolarHBondContact O-N 2.82Å; L11-L15 WeakPolarHBondContact O-CB 3.31Å; L11-L15 PolarHBondContact O-N 2.93Å
12	L	72.7	Confident	67.6	Low	101 Å²	101	108.5 Å²	108.5	53%	0.529	64%	0.638	S	S	.	*	H	α-helix	trans	-65	-41.2	177.3	-74.6	165.3	0	0	0	111.7	W8 M9 L15 L16	W8-L12 WeakPolarHBondContact O-CB 3.41Å; W8-L12 VanDerWaalsContact O-CG 3.3Å; W8-L12 WeakPolarHBondContact O-CG 3.21Å; W8-L12 PolarHBondContact O-N 2.65Å; M9-L12 PolarHBondContact O-N 2.98Å; L12-L15 PolarHBondContact O-N 2.84Å; L12-L16 WeakPolarHBondContact O-CB 3.47Å; L12-L16 WeakPolarHBondContact O-CD1 3.22Å; L12-L16 WeakPolarHBondContact O-CG 3.3Å; L12-L16 PolarHBondContact O-N 2.88Å
13	L	68.3	Low	68	Low	115 Å²	115	109.8 Å²	109.8	60%	0.602	64%	0.635	S	S	*	*	H	α-helix	trans	-66.8	-39.1	176.8	-156.8	73	0	0	0	111.4	M9 M10 L15 L16 A17	M9-L13 VanDerWaalsContact O-CB 3.28Å; M9-L13 WeakPolarHBondContact O-CB 3.44Å; M9-L13 PolarHBondContact O-N 3.06Å; M10-L13 PolarHBondContact O-N 3Å; L13-L15 VanDerWaalsContact C-N 3.35Å; L13-L16 PolarHBondContact O-N 3.19Å; L13-A17 VanDerWaalsContact O-CB 3.3Å; L13-A17 WeakPolarHBondContact O-CB 3.33Å; L13-A17 PolarHBondContact O-N 3.32Å
14	G	67.8	Low	68.7	Low	34 Å²	34	109.3 Å²	109.3	35%	0.351	64%	0.637	S	S	.	*	H	α-helix	trans	-64.3	-37.3	170.6	0	0	0	0	0	112.7	M10 L11 A17 Y18	M10-G14 PolarHBondContact O-N 3.3Å; L11-G14 PolarHBondContact O-N 2.82Å; G14-A17 CarbonylContact O-C 3.6Å; G14-A17 PolarHBondContact O-N 2.84Å; G14-Y18 WeakPolarHBondContact O-CD2 3.3Å; G14-Y18 PolarHBondContact O-N 3.46Å
15	L	64.9	Low	69.8	Low	107 Å²	107	112.6 Å²	112.6	56%	0.56	65%	0.645	S	S	*	*	H	α-helix	trans	-68.4	-39.2	177.2	-125.1	107	0	0	0	112.6	L11 L12 L13 A17 Y18	L11-L15 WeakPolarHBondContact O-CB 3.31Å; L11-L15 PolarHBondContact O-N 2.93Å; L12-L15 PolarHBondContact O-N 2.84Å; L13-L15 VanDerWaalsContact C-N 3.35Å; L15-A17 VanDerWaalsContact C-N 3.25Å; L15-Y18 VanDerWaalsContact CA-CD2 3.49Å; L15-Y18 HydrophobicContact CB-CD2 4.44Å; L15-Y18 HydrophobicContact CB-CE2 4.48Å; L15-Y18 HydrophobicContact CD1-CE2 4.41Å; L15-Y18 HydrophobicContact CG-CD2 4.17Å; L15-Y18 HydrophobicContact CG-CE2 4.08Å; L15-Y18 VanDerWaalsContact O-CD2 3.31Å; L15-Y18 WeakPolarHBondContact O-CD2 3.33Å; L15-Y18 PolarHBondContact O-N 3.3Å
16	L	64.4	Low	70.7	Confident	140 Å²	140	109.2 Å²	109.2	73%	0.733	62%	0.624	S	S	*	*	H	α-helix	trans	-69.8	-25.6	173	-74.2	155.4	0	0	0	111.9	L12 L13 Y18	L12-L16 WeakPolarHBondContact O-CB 3.47Å; L12-L16 WeakPolarHBondContact O-CD1 3.22Å; L12-L16 WeakPolarHBondContact O-CG 3.3Å; L12-L16 PolarHBondContact O-N 2.88Å; L13-L16 PolarHBondContact O-N 3.19Å; L16-Y18 VanDerWaalsContact C-N 3.32Å
17	A	64.7	Low	71.9	Confident	77 Å²	77	106.4 Å²	106.4	64%	0.636	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.3	0.1	176.2	0	0	0	0	0	114.1	L13 G14 L15 G19	L13-A17 VanDerWaalsContact O-CB 3.3Å; L13-A17 WeakPolarHBondContact O-CB 3.33Å; L13-A17 PolarHBondContact O-N 3.32Å; G14-A17 CarbonylContact O-C 3.6Å; G14-A17 PolarHBondContact O-N 2.84Å; L15-A17 VanDerWaalsContact C-N 3.25Å; A17-G19 PolarHBondContact O-N 2.99Å
18	Y	62.2	Low	73	Confident	187 Å²	187	106.5 Å²	106.5	73%	0.733	61%	0.609	S	S	*	*	S	Bend	trans	-69.5	73.3	157.8	-63.3	-67.1	0	0	0	107.8	G14 L15 L16 S20	G14-Y18 WeakPolarHBondContact O-CD2 3.3Å; G14-Y18 PolarHBondContact O-N 3.46Å; L15-Y18 VanDerWaalsContact CA-CD2 3.49Å; L15-Y18 HydrophobicContact CB-CD2 4.44Å; L15-Y18 HydrophobicContact CB-CE2 4.48Å; L15-Y18 HydrophobicContact CD1-CE2 4.41Å; L15-Y18 HydrophobicContact CG-CD2 4.17Å; L15-Y18 HydrophobicContact CG-CE2 4.08Å; L15-Y18 VanDerWaalsContact O-CD2 3.31Å; L15-Y18 WeakPolarHBondContact O-CD2 3.33Å; L15-Y18 PolarHBondContact O-N 3.3Å; L16-Y18 VanDerWaalsContact C-N 3.32Å; Y18-S20 PolarHBondContact O-N 2.97Å; Y18-S20 VanDerWaalsContact O-N 3.12Å
19	G	61.1	Low	74	Confident	63 Å²	63	101.1 Å²	101.1	65%	0.649	60%	0.595	S	S	*	*			trans	-54.4	118.7	-176.7	0	0	0	0	0	109	A17 G21	A17-G19 PolarHBondContact O-N 2.99Å; G19-G21 VanDerWaalsContact C-N 3.28Å; G19-G21 PolarHBondContact O-N 2.81Å
20	S	64.9	Low	75.1	Confident	108 Å²	108	98 Å²	98	76%	0.755	58%	0.579	S	S	*	*			trans	-53.5	102.1	154.7	49	0	0	0	0	106.6	Y18 V22	Y18-S20 PolarHBondContact O-N 2.97Å; Y18-S20 VanDerWaalsContact O-N 3.12Å; S20-V22 PolarHBondContact O-N 3.32Å
21	G	64.7	Low	76	Confident	75 Å²	75	96.9 Å²	96.9	77%	0.773	57%	0.572	S	S	*	*			trans	-54.4	114.8	165.4	0	0	0	0	0	106.8	G19 D23	G19-G21 VanDerWaalsContact C-N 3.28Å; G19-G21 PolarHBondContact O-N 2.81Å; G21-D23 PolarHBondContact O-N 2.87Å; G21-D23 VanDerWaalsContact O-N 3.12Å
22	V	73.9	Confident	76.9	Confident	128 Å²	128	97.6 Å²	97.6	78%	0.776	58%	0.583	S	S	*	*			trans	-74.6	101	170.9	173	0	0	0	0	105.4	S20 S24	S20-V22 PolarHBondContact O-N 3.32Å; V22-S24 PolarHBondContact O-N 3.37Å
23	D	70.1	Confident	77.9	Confident	144 Å²	144	97.3 Å²	97.3	77%	0.77	59%	0.589	S	S	*	*			trans	-69.9	107.4	166.7	-167.4	-40.5	0	0	0	107.3	G21 Q25	G21-D23 PolarHBondContact O-N 2.87Å; G21-D23 VanDerWaalsContact O-N 3.12Å; D23-Q25 PolarHBondContact O-N 2.93Å; D23-Q25 VanDerWaalsContact O-N 3.13Å
24	S	73.3	Confident	79.2	Confident	102 Å²	102	96 Å²	96	71%	0.713	58%	0.579	S	S	*	*			trans	-82.3	86.5	176.3	59.4	0	0	0	0	109	V22 T26	V22-S24 PolarHBondContact O-N 3.37Å; S24-T26 PolarHBondContact O-N 3.38Å
25	Q	84.5	Confident	80.6	Confident	153 Å²	153	100.1 Å²	100.1	72%	0.715	60%	0.602	S	S	*	*			trans	-61.5	130.9	176.1	-170.1	174.8	0.2	0	0	110.9	D23 V27	D23-Q25 PolarHBondContact O-N 2.93Å; D23-Q25 VanDerWaalsContact O-N 3.13Å; Q25-V27 PolarHBondContact O-N 3.42Å
26	T	88.1	Confident	82.1	Confident	43 Å²	43	97.9 Å²	97.9	26%	0.264	59%	0.593	S	S	.	*			trans	-70	127	170.6	-66.6	0	0	0	0	109.4	S24 L48 S50 M118	S24-T26 PolarHBondContact O-N 3.38Å; T26-L48 HydrophobicContact CG2-CB 4.26Å; T26-L48 HydrophobicContact CG2-CD2 3.94Å; T26-S50 WeakPolarHBondContact CG2-OG 3.47Å; T26-S50 WeakPolarHBondContact OG1-CB 3.31Å; T26-S50 PolarHBondContact OG1-OG 3.26Å; T26-M118 HydrophobicContact CG2-CE 4.4Å; T26-M118 HydrophobicContact CG2-SD 4.04Å
27	V	92.8	Very high	83.7	Confident	70 Å²	70	95.6 Å²	95.6	42%	0.424	59%	0.589	S	S	.	*			trans	-126.8	151.6	-179.9	-63	0	0	0	0	111	Q25 T29 S49	Q25-V27 PolarHBondContact O-N 3.42Å; V27-T29 HydrophobicContact CG2-CG2 4.37Å; V27-S49 PolarHBondContact N-OG 2.84Å; V27-S49 PolarHBondContact O-N 3.24Å
28	V	95.2	Very high	85.3	Confident	54 Å²	54	97.9 Å²	97.9	33%	0.327	60%	0.597	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-74.7	133.1	170.7	-178.5	0	0	0	0	108.6	Q30 C46 G47 L48 L116 M118	V28-Q30 HydrophobicContact CG1-CG 4.5Å; V28-C46 WeakPolarHBondContact CG1-SG 3.49Å; V28-G47 CarbonylContact C-O 3.58Å; V28-G47 WeakPolarHBondContact CA-O 3.4Å; V28-L48 HydrophobicContact CG2-CD2 4.35Å; V28-L116 HydrophobicContact CG1-CD1 4.35Å; V28-L116 HydrophobicContact CG2-CB 4.38Å; V28-L116 HydrophobicContact CG2-CD1 4.18Å; V28-L116 HydrophobicContact CG2-CG 4.32Å; V28-M118 HydrophobicContact CG2-CE 3.68Å
29	T	96.3	Very high	87	Confident	53 Å²	53	91.6 Å²	91.6	33%	0.325	59%	0.589	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-118.5	137.9	179.8	57.7	0	0	0	0	110.2	V27 C46 G47	V27-T29 HydrophobicContact CG2-CG2 4.37Å; T29-C46 CarbonylContact O-C 3.57Å; T29-C46 VanDerWaalsContact O-CA 3.3Å; T29-C46 WeakPolarHBondContact O-CA 3.43Å; T29-G47 PolarHBondContact N-O 3.19Å; T29-G47 PolarHBondContact O-N 3.02Å; T29-G47 PolarHBondContact OG1-O 2.79Å
30	Q	96.7	Very high	88.8	Confident	69 Å²	69	89.7 Å²	89.7	32%	0.322	57%	0.57	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-140	155.2	177.6	-59.3	-176.2	-90.2	0	0	108.5	V28 C46 W61 C114	V28-Q30 HydrophobicContact CG1-CG 4.5Å; Q30-C46 HydrophobicContact CG-CB 4.06Å; Q30-W61 VanDerWaalsContact NE2-CZ3 3.35Å; Q30-C114 HydrophobicContact CG-CB 4.31Å; Q30-C114 VanDerWaalsContact NE2-N 3.19Å
31	E	94.3	Very high	90.4	Very high	101 Å²	101	88.6 Å²	88.6	47%	0.472	56%	0.559	S	S	.	*			trans	-69.4	141.4	169.2	-61.2	-57.4	141.2	0	0	109.8	S33 F34	E31-S33 PolarHBondContact O-N 2.72Å; E31-F34 HydrophobicContact CB-CD2 4.47Å; E31-F34 HydrophobicContact CB-CE1 4.29Å; E31-F34 HydrophobicContact CB-CE2 3.48Å; E31-F34 VanDerWaalsContact CB-CE2 3.48Å; E31-F34 HydrophobicContact CB-CZ 3.37Å; E31-F34 HydrophobicContact CG-CE1 4.37Å; E31-F34 HydrophobicContact CG-CE2 4.19Å; E31-F34 HydrophobicContact CG-CZ 3.57Å
32	P	93.4	Very high	92	Very high	125 Å²	125	86 Å²	86	81%	0.812	53%	0.528	S	S	*	.	S	Bend	trans	-71.2	-30.9	-168.6	26.8	-35.2	0	0	0	113.7
33	S	95.3	Very high	93.2	Very high	95 Å²	95	82.4 Å²	82.4	66%	0.664	51%	0.506	S	S	*	.			trans	-159.1	155.6	-179.3	61.4	0	0	0	0	111.3	E31	E31-S33 PolarHBondContact O-N 2.72Å
34	F	95.1	Very high	94.5	Very high	88 Å²	88	76.3 Å²	76.3	39%	0.386	47%	0.473	S	S	.	.			trans	-136.6	159	172.4	-68.1	-88.2	0	0	0	109.7	E31 V42 L44	E31-F34 HydrophobicContact CB-CD2 4.47Å; E31-F34 HydrophobicContact CB-CE1 4.29Å; E31-F34 HydrophobicContact CB-CE2 3.48Å; E31-F34 VanDerWaalsContact CB-CE2 3.48Å; E31-F34 HydrophobicContact CB-CZ 3.37Å; E31-F34 HydrophobicContact CG-CE1 4.37Å; E31-F34 HydrophobicContact CG-CE2 4.19Å; E31-F34 HydrophobicContact CG-CZ 3.57Å; F34-V42 HydrophobicContact CB-CG2 3.92Å; F34-V42 HydrophobicContact CD1-CG2 4.16Å; F34-V42 HydrophobicContact CG-CG2 4.16Å; F34-L44 HydrophobicContact CD2-CD2 4.42Å; F34-L44 HydrophobicContact CD2-CG 3.91Å; F34-L44 HydrophobicContact CE2-CB 4.18Å; F34-L44 HydrophobicContact CE2-CG 4.02Å
35	S	96.6	Very high	95.7	Very high	120 Å²	120	72.5 Å²	72.5	84%	0.839	45%	0.446	S	S	*	.			trans	-138.2	144.1	171.6	-56.4	0	0	0	0	109
36	V	97.3	Very high	96.3	Very high	61 Å²	61	65.2 Å²	65.2	37%	0.37	41%	0.412	S	S	.	.			trans	-147	141.6	-178.2	63.2	0	0	0	0	109	V42 A104	V36-V42 HydrophobicContact CB-CB 3.99Å; V36-V42 HydrophobicContact CB-CG1 4.36Å; V36-V42 HydrophobicContact CG1-CB 4.2Å; V36-V42 HydrophobicContact CG1-CG1 4.01Å; V36-V42 HydrophobicContact CG2-CB 4.18Å; V36-A104 HydrophobicContact CG1-CB 3.6Å; V36-A104 HydrophobicContact CG2-CB 4.3Å
37	S	97.6	Very high	96.7	Very high	91 Å²	91	63.3 Å²	63.3	64%	0.636	40%	0.401	S	S	*	.			trans	-68.9	149.5	174.2	-58.6	0	0	0	0	110.7	G39 G40	S37-G39 PolarHBondContact O-N 2.82Å; S37-G40 WeakPolarHBondContact O-CA 3.44Å; S37-G40 PolarHBondContact O-N 3.48Å
38	P	97.8	Very high	96.8	Very high	126 Å²	126	60.8 Å²	60.8	82%	0.818	39%	0.385	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.9	134.4	172.8	-27.5	35.2	0	0	0	112.1	G40	P38-G40 PolarHBondContact O-N 2.88Å
39	G	98.2	Very high	96.7	Very high	55 Å²	55	61.5 Å²	61.5	57%	0.567	39%	0.392	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.6	-6.8	-174.6	0	0	0	0	0	115	S37 A104	S37-G39 PolarHBondContact O-N 2.82Å; G39-A104 PolarHBondContact N-O 2.87Å
40	G	98.6	Very high	96.3	Very high	23 Å²	23	62.8 Å²	62.8	24%	0.237	40%	0.403	C	S	.	.			trans	-74.4	179.6	178	0	0	0	0	0	113.7	S37 P38 T102 G103 A104	S37-G40 WeakPolarHBondContact O-CA 3.44Å; S37-G40 PolarHBondContact O-N 3.48Å; P38-G40 PolarHBondContact O-N 2.88Å; G40-T102 CarbonylContact O-C 3.54Å; G40-G103 PolarHBondContact O-N 3.38Å; G40-A104 PolarHBondContact O-N 3.01Å
41	T	98.6	Very high	95.9	Very high	85 Å²	85	61.5 Å²	61.5	52%	0.521	41%	0.408	S	S	.	.			trans	-118.5	133.2	176	-62.3	0	0	0	0	109.8	T100 I101 T102	T41-T100 HydrophobicContact CG2-CG2 3.81Å; T41-I101 CarbonylContact C-O 3.57Å; T41-I101 VanDerWaalsContact CA-O 3.26Å; T41-I101 WeakPolarHBondContact CA-O 3.3Å; T41-T102 HydrophobicContact CG2-CG2 3.9Å
42	V	98.2	Very high	95.9	Very high	21 Å²	21	59.4 Å²	59.4	13%	0.127	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	145.3	173	63.5	0	0	0	0	110.1	F34 V36 L44 T100 I101	F34-V42 HydrophobicContact CB-CG2 3.92Å; F34-V42 HydrophobicContact CD1-CG2 4.16Å; F34-V42 HydrophobicContact CG-CG2 4.16Å; V36-V42 HydrophobicContact CB-CB 3.99Å; V36-V42 HydrophobicContact CB-CG1 4.36Å; V36-V42 HydrophobicContact CG1-CB 4.2Å; V36-V42 HydrophobicContact CG1-CG1 4.01Å; V36-V42 HydrophobicContact CG2-CB 4.18Å; V42-L44 HydrophobicContact CG1-CD1 4.09Å; V42-L44 HydrophobicContact CG2-CD1 4.31Å; V42-T100 WeakPolarHBondContact O-CA 3.36Å; V42-I101 HydrophobicContact CG1-CB 3.97Å; V42-I101 HydrophobicContact CG1-CD1 4.22Å; V42-I101 HydrophobicContact CG1-CG1 4.32Å; V42-I101 PolarHBondContact N-O 2.9Å; V42-I101 PolarHBondContact O-N 3.22Å
43	T	98.3	Very high	96	Very high	51 Å²	51	53.6 Å²	53.6	31%	0.313	37%	0.367	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	111.7	175	-63.3	0	0	0	0	109.2	T45 L93 A98 L99 T100	T43-T45 HydrophobicContact CG2-CG2 4.34Å; T43-L93 HydrophobicContact CG2-CD2 4.45Å; T43-A98 HydrophobicContact CG2-CB 3.9Å; T43-L99 CarbonylContact C-O 3.58Å; T43-L99 WeakPolarHBondContact CA-O 3.28Å; T43-T100 PolarHBondContact OG1-OG1 3.31Å
44	L	98.3	Very high	96.1	Very high	17 Å²	17	51.3 Å²	51.3	9%	0.089	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.4	145	172.8	-62.2	77.3	0	0	0	108.2	F34 V42 W61 A98 L99 I101 Y112	F34-L44 HydrophobicContact CD2-CD2 4.42Å; F34-L44 HydrophobicContact CD2-CG 3.91Å; F34-L44 HydrophobicContact CE2-CB 4.18Å; F34-L44 HydrophobicContact CE2-CG 4.02Å; V42-L44 HydrophobicContact CG1-CD1 4.09Å; V42-L44 HydrophobicContact CG2-CD1 4.31Å; L44-W61 HydrophobicContact CB-CH2 3.85Å; L44-W61 HydrophobicContact CB-CZ3 3.94Å; L44-W61 HydrophobicContact CD2-CZ3 4.43Å; L44-A98 CarbonylContact O-C 3.56Å; L44-A98 VanDerWaalsContact O-CA 3.24Å; L44-A98 WeakPolarHBondContact O-CA 3.27Å; L44-L99 HydrophobicContact CB-CB 4.42Å; L44-L99 PolarHBondContact N-O 2.75Å; L44-L99 PolarHBondContact O-N 3.12Å; L44-I101 HydrophobicContact CD1-CD1 3.89Å; L44-I101 HydrophobicContact CD1-CG1 4.31Å; L44-Y112 HydrophobicContact CD2-CD1 4.44Å; L44-Y112 HydrophobicContact CD2-CD2 3.97Å; L44-Y112 HydrophobicContact CD2-CG 3.75Å
45	T	98	Very high	96.1	Very high	22 Å²	22	51.2 Å²	51.2	14%	0.135	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	152.9	178.4	67.6	0	0	0	0	112.6	T43 L93 A97	T43-T45 HydrophobicContact CG2-CG2 4.34Å; T45-L93 HydrophobicContact CG2-CD2 4.37Å; T45-A97 CarbonylContact C-O 3.55Å; T45-A97 VanDerWaalsContact CA-O 3.27Å; T45-A97 WeakPolarHBondContact CA-O 3.33Å
46	C	97	Very high	96	Very high	0 Å²	0	49 Å²	49	0%	0	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142	127.2	-175.7	165.8	0	0	0	0	109.7	V28 T29 Q30 W61 K96 A97 C114	V28-C46 WeakPolarHBondContact CG1-SG 3.49Å; T29-C46 CarbonylContact O-C 3.57Å; T29-C46 VanDerWaalsContact O-CA 3.3Å; T29-C46 WeakPolarHBondContact O-CA 3.43Å; Q30-C46 HydrophobicContact CG-CB 4.06Å; C46-W61 HydrophobicContact CB-CH2 3.75Å; C46-W61 HydrophobicContact CB-CZ2 3.7Å; C46-K96 CarbonylContact O-C 3.59Å; C46-K96 WeakPolarHBondContact O-CA 3.25Å; C46-K96 WeakPolarHBondContact O-CB 3.48Å; C46-A97 HydrophobicContact CB-CB 4.19Å; C46-A97 PolarHBondContact N-O 3.12Å; C46-A97 PolarHBondContact O-N 3.21Å; C46-C114 HydrophobicContact CB-CB 3.29Å; C46-C114 WeakPolarHBondContact CB-SG 3.3Å; C46-C114 WeakPolarHBondContact SG-CB 3.47Å; C46-C114 CovalentContact SG-SG 2.02Å; C46-C114 PolarHBondContact SG-SG 3.18Å
47	G	96.7	Very high	95.9	Very high	3 Å²	3	49.4 Å²	49.4	3%	0.031	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	179.8	-176.6	0	0	0	0	0	112.8	V28 T29	V28-G47 CarbonylContact C-O 3.58Å; V28-G47 WeakPolarHBondContact CA-O 3.4Å; T29-G47 PolarHBondContact N-O 3.19Å; T29-G47 PolarHBondContact O-N 3.02Å; T29-G47 PolarHBondContact OG1-O 2.79Å
48	L	95.1	Very high	95.8	Very high	16 Å²	16	51.1 Å²	51.1	8%	0.084	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.1	144	169.1	-65.1	170.7	0	0	0	109.3	T26 V28 S50 V53 Y57 L116 M118	T26-L48 HydrophobicContact CG2-CB 4.26Å; T26-L48 HydrophobicContact CG2-CD2 3.94Å; V28-L48 HydrophobicContact CG2-CD2 4.35Å; L48-S50 PolarHBondContact O-N 2.84Å; L48-V53 HydrophobicContact CD1-CG2 4.21Å; L48-V53 HydrophobicContact CG-CG2 3.86Å; L48-Y57 HydrophobicContact CD1-CD1 4.35Å; L48-Y57 HydrophobicContact CD1-CE1 3.81Å; L48-L116 HydrophobicContact CD2-CD1 3.62Å; L48-L116 HydrophobicContact CG-CD1 3.83Å; L48-M118 HydrophobicContact CD2-CE 3.27Å; L48-M118 HydrophobicContact CD2-SD 3.94Å
49	S	92.5	Very high	95.8	Very high	69 Å²	69	45.1 Å²	45.1	48%	0.483	29%	0.293	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.3	-26.6	174.4	58.4	0	0	0	0	113.2	V27	V27-S49 PolarHBondContact N-OG 2.84Å; V27-S49 PolarHBondContact O-N 3.24Å
50	S	88.8	Confident	95.8	Very high	80 Å²	80	43.3 Å²	43.3	56%	0.559	27%	0.271	S	S	*	.	T	Hydrogen-bonded Turn	trans	-104.9	-4.4	-172.7	58.6	0	0	0	0	114.8	T26 L48	T26-S50 WeakPolarHBondContact CG2-OG 3.47Å; T26-S50 WeakPolarHBondContact OG1-CB 3.31Å; T26-S50 PolarHBondContact OG1-OG 3.26Å; L48-S50 PolarHBondContact O-N 2.84Å
51	G	88.9	Confident	95.8	Very high	42 Å²	42	42.2 Å²	42.2	43%	0.433	26%	0.26	S	S	.	.	B	Isolated β-bridge	trans	176	-162.4	-172.2	0	0	0	0	0	116.7
52	S	94.2	Very high	95.8	Very high	58 Å²	58	41.5 Å²	41.5	41%	0.406	25%	0.248	S	C	.	.			trans	-96.4	139.7	-172.4	-58.5	0	0	0	0	112.2	Y57 N95	S52-Y57 WeakPolarHBondContact O-CE2 3.15Å; S52-N95 PolarHBondContact OG-ND2 3.42Å
53	V	95.9	Very high	95.8	Very high	3 Å²	3	40.5 Å²	40.5	2%	0.018	24%	0.242	C	C	.	.			trans	-95	124	173.2	-177.1	0	0	0	0	109.4	L48 Y57 P59 I92 N95 A97 L116	L48-V53 HydrophobicContact CD1-CG2 4.21Å; L48-V53 HydrophobicContact CG-CG2 3.86Å; V53-Y57 HydrophobicContact CG1-CD2 4.44Å; V53-P59 HydrophobicContact CG1-CG 3.9Å; V53-I92 HydrophobicContact CG1-CD1 4.26Å; V53-N95 WeakPolarHBondContact CB-O 3.46Å; V53-N95 PolarHBondContact N-O 3.18Å; V53-A97 HydrophobicContact CG1-CB 4.07Å; V53-L116 HydrophobicContact CG1-CD1 4.19Å; V53-L116 HydrophobicContact CG1-CD2 3.69Å; V53-L116 HydrophobicContact CG2-CD1 3.54Å
54	S	95.7	Very high	95.8	Very high	47 Å²	47	41 Å²	41	33%	0.329	24%	0.241	S	C	.	.			trans	-117.7	178.3	170.4	68.8	0	0	0	0	110.5	S56 Y57	S54-S56 PolarHBondContact O-N 2.64Å; S54-S56 PolarHBondContact OG-N 2.79Å; S54-S56 PolarHBondContact OG-OG 3.26Å; S54-Y57 PolarHBondContact O-N 3.01Å
55	T	95.7	Very high	95.6	Very high	85 Å²	85	42.2 Å²	42.2	52%	0.521	25%	0.249	S	C	.	.	G	3₁₀ helix	trans	-63.2	-20	177.6	58.2	0	0	0	0	113.8	Y57 Y58 T77 I92	T55-Y57 PolarHBondContact O-N 3.15Å; T55-Y58 PolarHBondContact O-N 3.24Å; T55-T77 HydrophobicContact CG2-CG2 3.82Å; T55-I92 HydrophobicContact CG2-CG1 3.79Å
56	S	94.4	Very high	95.3	Very high	74 Å²	74	46 Å²	46	52%	0.517	27%	0.274	S	S	.	.	G	3₁₀ helix	trans	-69.3	-16	177.7	64.3	0	0	0	0	113.5	S54 Y58	S54-S56 PolarHBondContact O-N 2.64Å; S54-S56 PolarHBondContact OG-N 2.79Å; S54-S56 PolarHBondContact OG-OG 3.26Å; S56-Y58 WeakPolarHBondContact O-CD2 3.26Å; S56-Y58 VanDerWaalsContact O-CE2 3.26Å; S56-Y58 WeakPolarHBondContact O-CE2 3.43Å
57	Y	95.2	Very high	95.2	Very high	69 Å²	69	50.4 Å²	50.4	27%	0.271	32%	0.319	S	S	.	.	G	3₁₀ helix	trans	-83.5	4.2	171.5	-67	-87.3	0	0	0	112.6	L48 S52 V53 S54 T55 Y117 M118	L48-Y57 HydrophobicContact CD1-CD1 4.35Å; L48-Y57 HydrophobicContact CD1-CE1 3.81Å; S52-Y57 WeakPolarHBondContact O-CE2 3.15Å; V53-Y57 HydrophobicContact CG1-CD2 4.44Å; S54-Y57 PolarHBondContact O-N 3.01Å; T55-Y57 PolarHBondContact O-N 3.15Å; Y57-Y117 WeakPolarHBondContact CA-O 3.41Å; Y57-Y117 WeakPolarHBondContact CD1-O 3.25Å; Y57-Y117 WeakPolarHBondContact O-CA 3.34Å; Y57-Y117 WeakPolarHBondContact O-CB 3.28Å; Y57-Y117 PolarHBondContact O-N 3.48Å; Y57-M118 HydrophobicContact CD1-CG 4.37Å; Y57-M118 HydrophobicContact CE1-CG 4.45Å
58	Y	96.4	Very high	95.1	Very high	127 Å²	127	56 Å²	56	50%	0.498	35%	0.345	S	S	.	.			trans	41.4	54.5	-178.4	-57.2	-84.6	0	0	0	114.1	T55 S56 S60 Y117	T55-Y58 PolarHBondContact O-N 3.24Å; S56-Y58 WeakPolarHBondContact O-CD2 3.26Å; S56-Y58 VanDerWaalsContact O-CE2 3.26Å; S56-Y58 WeakPolarHBondContact O-CE2 3.43Å; Y58-S60 PolarHBondContact O-N 2.84Å; Y58-S60 PolarHBondContact O-OG 3.43Å; Y58-Y117 HydrophobicContact CD2-CD1 4.17Å
59	P	97.7	Very high	95.2	Very high	1 Å²	1	59.3 Å²	59.3	1%	0.006	37%	0.374	C	S	.	.			trans	-54.3	133.8	-175.2	-23.3	33.4	0	0	0	111.9	V53 T77 I92 A97 V115 L116	V53-P59 HydrophobicContact CG1-CG 3.9Å; P59-T77 WeakPolarHBondContact CD-OG1 3.4Å; P59-T77 WeakPolarHBondContact O-CA 3.42Å; P59-T77 PolarHBondContact O-N 3.42Å; P59-I92 HydrophobicContact CG-CD1 3.98Å; P59-A97 HydrophobicContact CB-CB 3.46Å; P59-A97 VanDerWaalsContact CB-CB 3.46Å; P59-A97 HydrophobicContact CG-CB 3.76Å; P59-V115 WeakPolarHBondContact CA-O 3.37Å; P59-L116 HydrophobicContact CB-CD2 3.67Å; P59-L116 HydrophobicContact CG-CD2 3.75Å
60	S	98.4	Very high	95.4	Very high	17 Å²	17	59.5 Å²	59.5	12%	0.119	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	142.8	-179.5	-58.9	0	0	0	0	109.9	Y58 I74 C114 V115	Y58-S60 PolarHBondContact O-N 2.84Å; Y58-S60 PolarHBondContact O-OG 3.43Å; S60-I74 CarbonylContact C-O 3.59Å; S60-I74 VanDerWaalsContact CA-O 3.24Å; S60-I74 WeakPolarHBondContact CA-O 3.42Å; S60-C114 CarbonylContact O-C 3.18Å; S60-C114 WeakPolarHBondContact O-CA 3.3Å; S60-V115 PolarHBondContact N-O 3.3Å; S60-V115 PolarHBondContact O-N 3.38Å
61	W	98.6	Very high	95.8	Very high	0 Å²	0	61 Å²	61	0%	0	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.3	132.9	-177.5	-71.1	93.8	0	0	0	110.5	Q30 L44 C46 L73 I74 A98 L99 Y113 C114	Q30-W61 VanDerWaalsContact NE2-CZ3 3.35Å; L44-W61 HydrophobicContact CB-CH2 3.85Å; L44-W61 HydrophobicContact CB-CZ3 3.94Å; L44-W61 HydrophobicContact CD2-CZ3 4.43Å; C46-W61 HydrophobicContact CB-CH2 3.75Å; C46-W61 HydrophobicContact CB-CZ2 3.7Å; W61-L73 PolarHBondContact O-N 2.91Å; W61-I74 HydrophobicContact CB-CB 4.24Å; W61-I74 PolarHBondContact N-O 3.48Å; W61-I74 PolarHBondContact O-N 2.82Å; W61-A98 PolarHBondContact NE1-O 2.8Å; W61-L99 HydrophobicContact CB-CD1 4.24Å; W61-L99 HydrophobicContact CB-CD2 4.19Å; W61-L99 HydrophobicContact CD2-CB 3.46Å; W61-L99 VanDerWaalsContact CD2-CB 3.46Å; W61-L99 HydrophobicContact CD2-CD2 4.09Å; W61-L99 HydrophobicContact CD2-CG 4.29Å; W61-L99 VanDerWaalsContact CE2-CB 3.5Å; W61-L99 HydrophobicContact CE3-CB 3.82Å; W61-L99 HydrophobicContact CE3-CD2 3.89Å; W61-L99 HydrophobicContact CE3-CG 4.49Å; W61-L99 HydrophobicContact CG-CB 3.8Å; W61-L99 HydrophobicContact CG-CD1 4.24Å; W61-L99 HydrophobicContact CG-CD2 4.23Å; W61-L99 HydrophobicContact CG-CG 4.32Å; W61-L99 HydrophobicContact CH2-CB 4.21Å; W61-L99 HydrophobicContact CZ2-CB 3.9Å; W61-L99 HydrophobicContact CZ3-CB 4.17Å; W61-Y113 CarbonylContact C-O 3.48Å; W61-Y113 WeakPolarHBondContact CA-O 3.38Å; W61-C114 HydrophobicContact CD2-CB 4.18Å; W61-C114 HydrophobicContact CE3-CB 3.98Å; W61-C114 HydrophobicContact CH2-CB 3.98Å; W61-C114 HydrophobicContact CZ2-CB 4.15Å; W61-C114 HydrophobicContact CZ3-CB 3.9Å
62	Y	98.4	Very high	96.3	Very high	69 Å²	69	61.2 Å²	61.2	27%	0.271	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	143.4	-179.9	-61	-97.9	0	0	0	109.3	R71 T72 Y112 Y113 V115	Y62-R71 CarbonylContact C-O 3.52Å; Y62-R71 VanDerWaalsContact CA-O 3.26Å; Y62-R71 WeakPolarHBondContact CA-O 3.28Å; Y62-T72 HydrophobicContact CE1-CG2 4.2Å; Y62-T72 WeakPolarHBondContact CE1-OG1 3.35Å; Y62-Y112 CarbonylContact O-C 3.51Å; Y62-Y112 VanDerWaalsContact O-CA 3.31Å; Y62-Y112 WeakPolarHBondContact O-CA 3.2Å; Y62-Y113 PolarHBondContact N-O 2.94Å; Y62-Y113 PolarHBondContact O-N 3.31Å; Y62-V115 HydrophobicContact CD2-CG2 3.94Å; Y62-V115 HydrophobicContact CE2-CB 4.09Å; Y62-V115 HydrophobicContact CE2-CG2 3.66Å
63	Q	98.1	Very high	96.5	Very high	1 Å²	1	58.5 Å²	58.5	1%	0.005	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	132.8	171.2	-178.6	-179.8	9.2	0	0	108.8	P70 R71 L73 S110 D111 Y112	Q63-P70 WeakPolarHBondContact O-CA 3.3Å; Q63-R71 HydrophobicContact CB-CG 4.01Å; Q63-R71 PolarHBondContact N-O 3.46Å; Q63-R71 PolarHBondContact O-N 3.28Å; Q63-L73 HydrophobicContact CB-CD1 3.72Å; Q63-L73 HydrophobicContact CB-CD2 4.23Å; Q63-L73 HydrophobicContact CB-CG 3.88Å; Q63-S110 WeakPolarHBondContact CG-OG 3.4Å; Q63-S110 VanDerWaalsContact NE2-CB 3.33Å; Q63-D111 CarbonylContact C-O 3.57Å; Q63-D111 WeakPolarHBondContact CA-O 3.32Å; Q63-Y112 HydrophobicContact CB-CD1 4.2Å; Q63-Y112 HydrophobicContact CB-CE1 4.03Å; Q63-Y112 HydrophobicContact CG-CD1 4.39Å; Q63-Y112 HydrophobicContact CG-CE1 3.94Å; Q63-Y112 PolarHBondContact NE2-OH 2.86Å
64	Q	97.4	Very high	96.6	Very high	62 Å²	62	58.3 Å²	58.3	29%	0.29	34%	0.34	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.1	110.5	176.6	-174.2	171.4	9.9	0	0	109.2	P70 S110 D111 Y113	Q64-P70 HydrophobicContact CB-CB 4.47Å; Q64-P70 HydrophobicContact CB-CG 4.39Å; Q64-P70 HydrophobicContact CG-CG 4.18Å; Q64-S110 PolarHBondContact O-OG 2.98Å; Q64-D111 HydrophobicContact CB-CB 4.41Å; Q64-D111 PolarHBondContact N-O 3.44Å; Q64-D111 PolarHBondContact O-N 2.86Å; Q64-Y113 HydrophobicContact CB-CD2 4.23Å; Q64-Y113 HydrophobicContact CB-CE2 3.86Å
65	T	94.5	Very high	96.7	Very high	41 Å²	41	61 Å²	61	25%	0.252	34%	0.343	S	S	.	.			trans	-84.6	139.2	172.1	-54.8	0	0	0	0	108.3	G67 Q68 S110	T65-G67 PolarHBondContact O-N 2.74Å; T65-Q68 WeakPolarHBondContact O-CB 3.34Å; T65-Q68 PolarHBondContact O-N 2.83Å; T65-S110 WeakPolarHBondContact CA-OG 3.24Å; T65-S110 PolarHBondContact N-OG 2.9Å; T65-S110 PolarHBondContact OG1-OG 3.29Å
66	P	92.2	Very high	96.8	Very high	103 Å²	103	59.2 Å²	59.2	67%	0.669	34%	0.335	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.1	129.3	179.1	-30.1	36.1	0	0	0	112.5	Q68	P66-Q68 VanDerWaalsContact C-N 3.27Å; P66-Q68 PolarHBondContact O-N 3.03Å
67	G	94.7	Very high	97	Very high	92 Å²	92	56.3 Å²	56.3	95%	0.948	31%	0.314	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.5	0.3	-178.6	0	0	0	0	0	115.6	T65	T65-G67 PolarHBondContact O-N 2.74Å
68	Q	95.2	Very high	97.1	Very high	121 Å²	121	58.2 Å²	58.2	57%	0.565	33%	0.329	S	S	*	.	S	Bend	trans	-111.9	158.6	175.5	-60.7	-170.7	-9.4	0	0	111.8	T65 P66	T65-Q68 WeakPolarHBondContact O-CB 3.34Å; T65-Q68 PolarHBondContact O-N 2.83Å; P66-Q68 VanDerWaalsContact C-N 3.27Å; P66-Q68 PolarHBondContact O-N 3.03Å
69	A	95.9	Very high	97.2	Very high	84 Å²	84	54.6 Å²	54.6	69%	0.694	32%	0.32	S	S	*	.			trans	-70	147.4	170.8	0	0	0	0	0	110.5	R71	A69-R71 PolarHBondContact O-N 2.81Å
70	P	97.2	Very high	97.2	Very high	74 Å²	74	59.5 Å²	59.5	48%	0.481	34%	0.338	S	S	.	.			trans	-57.5	134.2	174	-23.5	32.9	0	0	0	112	Q63 Q64	Q63-P70 WeakPolarHBondContact O-CA 3.3Å; Q64-P70 HydrophobicContact CB-CB 4.47Å; Q64-P70 HydrophobicContact CB-CG 4.39Å; Q64-P70 HydrophobicContact CG-CG 4.18Å
71	R	97.7	Very high	97.2	Very high	112 Å²	112	60.6 Å²	60.6	42%	0.423	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.5	138.2	172.2	71	178.8	-174.8	-173.4	0.2	110.7	Y62 Q63 A69 L73	Y62-R71 CarbonylContact C-O 3.52Å; Y62-R71 VanDerWaalsContact CA-O 3.26Å; Y62-R71 WeakPolarHBondContact CA-O 3.28Å; Q63-R71 HydrophobicContact CB-CG 4.01Å; Q63-R71 PolarHBondContact N-O 3.46Å; Q63-R71 PolarHBondContact O-N 3.28Å; A69-R71 PolarHBondContact O-N 2.81Å; R71-L73 HydrophobicContact CG-CD2 4.44Å; R71-L73 PolarHBondContact O-N 2.95Å
72	T	98.4	Very high	97.2	Very high	45 Å²	45	66.5 Å²	66.5	28%	0.276	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.1	126.3	173	-50.3	0	0	0	0	110.1	Y62 Y75 S81	Y62-T72 HydrophobicContact CE1-CG2 4.2Å; Y62-T72 WeakPolarHBondContact CE1-OG1 3.35Å; T72-Y75 HydrophobicContact CG2-CD1 4.49Å; T72-S81 WeakPolarHBondContact O-CB 3.45Å
73	L	98.5	Very high	97.2	Very high	1 Å²	1	66.9 Å²	66.9	1%	0.005	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	-58.4	171.6	-66.8	-176.5	0	0	0	111.1	W61 Q63 R71 R80 S81 V84 F88 L99 Y112	W61-L73 PolarHBondContact O-N 2.91Å; Q63-L73 HydrophobicContact CB-CD1 3.72Å; Q63-L73 HydrophobicContact CB-CD2 4.23Å; Q63-L73 HydrophobicContact CB-CG 3.88Å; R71-L73 HydrophobicContact CG-CD2 4.44Å; R71-L73 PolarHBondContact O-N 2.95Å; L73-R80 WeakPolarHBondContact O-CA 3.38Å; L73-S81 PolarHBondContact O-N 2.82Å; L73-V84 HydrophobicContact CB-CG1 4.49Å; L73-V84 HydrophobicContact CD2-CG1 4Å; L73-V84 HydrophobicContact CD2-CG2 4.06Å; L73-F88 HydrophobicContact CD1-CD1 3.76Å; L73-F88 HydrophobicContact CD1-CE1 3.8Å; L73-L99 HydrophobicContact CD1-CD2 4.16Å; L73-Y112 HydrophobicContact CD1-CD1 3.92Å; L73-Y112 HydrophobicContact CD1-CE1 3.55Å
74	I	98.8	Very high	97.2	Very high	0 Å²	0	67.6 Å²	67.6	0%	0	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.1	138.2	-178.7	-50.8	-64.4	0	0	0	108.8	S60 W61 T77 T79 R80 L99	S60-I74 CarbonylContact C-O 3.59Å; S60-I74 VanDerWaalsContact CA-O 3.24Å; S60-I74 WeakPolarHBondContact CA-O 3.42Å; W61-I74 HydrophobicContact CB-CB 4.24Å; W61-I74 PolarHBondContact N-O 3.48Å; W61-I74 PolarHBondContact O-N 2.82Å; I74-T77 WeakPolarHBondContact CG2-O 3.26Å; I74-T79 CarbonylContact C-O 3.52Å; I74-T79 VanDerWaalsContact CA-O 3.3Å; I74-T79 WeakPolarHBondContact CA-O 3.34Å; I74-R80 HydrophobicContact CD1-CB 4.37Å; I74-R80 HydrophobicContact CD1-CG 3.36Å; I74-L99 HydrophobicContact CG1-CD1 3.7Å
75	Y	98.1	Very high	97.2	Very high	102 Å²	102	66.9 Å²	66.9	40%	0.4	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.2	163.4	169	66.4	-86	0	0	0	110.1	T72 T77 N78 T79	T72-Y75 HydrophobicContact CG2-CD1 4.49Å; Y75-T77 VanDerWaalsContact C-N 3.28Å; Y75-T77 PolarHBondContact O-N 3.13Å; Y75-N78 PolarHBondContact O-N 2.02Å; Y75-T79 HydrophobicContact CD1-CG2 4.42Å; Y75-T79 VanDerWaalsContact CD1-O 3.31Å; Y75-T79 WeakPolarHBondContact CD1-O 3.26Å; Y75-T79 HydrophobicContact CD2-CG2 4.44Å; Y75-T79 HydrophobicContact CE1-CG2 3.65Å; Y75-T79 HydrophobicContact CE2-CG2 3.68Å; Y75-T79 PolarHBondContact N-O 3.2Å; Y75-T79 WeakPolarHBondContact O-CA 3.31Å; Y75-T79 WeakPolarHBondContact O-CB 3.18Å; Y75-T79 PolarHBondContact O-N 3.21Å; Y75-T79 WeakPolarHBondContact OH-CG2 3.4Å
76	S	97	Very high	97.4	Very high	49 Å²	49	71.1 Å²	71.1	34%	0.343	44%	0.439	S	S	.	.	T	Hydrogen-bonded Turn	trans	50.1	47.3	179.4	-62.8	0	0	0	0	113.1	N78	S76-N78 VanDerWaalsContact C-N 3.26Å; S76-N78 PolarHBondContact O-N 3.44Å; S76-N78 PolarHBondContact O-OD1 2.82Å
77	T	97.7	Very high	97.6	Very high	12 Å²	12	68.1 Å²	68.1	7%	0.074	41%	0.414	C	S	.	.	T	Hydrogen-bonded Turn	trans	74.9	-54.2	-177.7	-41.5	0	0	0	0	115.3	T55 P59 I74 Y75 G90 I92	T55-T77 HydrophobicContact CG2-CG2 3.82Å; P59-T77 WeakPolarHBondContact CD-OG1 3.4Å; P59-T77 WeakPolarHBondContact O-CA 3.42Å; P59-T77 PolarHBondContact O-N 3.42Å; I74-T77 WeakPolarHBondContact CG2-O 3.26Å; Y75-T77 VanDerWaalsContact C-N 3.28Å; Y75-T77 PolarHBondContact O-N 3.13Å; T77-G90 CarbonylContact O-C 3.56Å; T77-G90 VanDerWaalsContact O-CA 3.3Å; T77-G90 WeakPolarHBondContact O-CA 2.92Å; T77-I92 HydrophobicContact CG2-CD1 4.06Å; T77-I92 HydrophobicContact CG2-CG1 3.94Å
78	N	98.2	Very high	97.8	Very high	109 Å²	109	63.8 Å²	63.8	58%	0.583	37%	0.369	S	S	*	.	T	Hydrogen-bonded Turn	trans	-140.8	3.7	-165.9	68.2	-16.1	0	0	0	114.3	Y75 S76 G90	Y75-N78 PolarHBondContact O-N 2.02Å; S76-N78 VanDerWaalsContact C-N 3.26Å; S76-N78 PolarHBondContact O-N 3.44Å; S76-N78 PolarHBondContact O-OD1 2.82Å; N78-G90 VanDerWaalsContact CB-O 3.26Å; N78-G90 WeakPolarHBondContact CB-O 3.35Å
79	T	98.5	Very high	98	Very high	52 Å²	52	60.5 Å²	60.5	32%	0.319	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.6	122.6	-179.3	-50.8	0	0	0	0	109.9	I74 Y75	I74-T79 CarbonylContact C-O 3.52Å; I74-T79 VanDerWaalsContact CA-O 3.3Å; I74-T79 WeakPolarHBondContact CA-O 3.34Å; Y75-T79 HydrophobicContact CD1-CG2 4.42Å; Y75-T79 VanDerWaalsContact CD1-O 3.31Å; Y75-T79 WeakPolarHBondContact CD1-O 3.26Å; Y75-T79 HydrophobicContact CD2-CG2 4.44Å; Y75-T79 HydrophobicContact CE1-CG2 3.65Å; Y75-T79 HydrophobicContact CE2-CG2 3.68Å; Y75-T79 PolarHBondContact N-O 3.2Å; Y75-T79 WeakPolarHBondContact O-CA 3.31Å; Y75-T79 WeakPolarHBondContact O-CB 3.18Å; Y75-T79 PolarHBondContact O-N 3.21Å; Y75-T79 WeakPolarHBondContact OH-CG2 3.4Å
80	R	98.4	Very high	98.1	Very high	103 Å²	103	56.9 Å²	56.9	39%	0.389	33%	0.33	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.1	137.3	176.9	-81.3	179.9	-70.7	139.2	-12.7	111.4	L73 I74 V84 D86 F88	L73-R80 WeakPolarHBondContact O-CA 3.38Å; I74-R80 HydrophobicContact CD1-CB 4.37Å; I74-R80 HydrophobicContact CD1-CG 3.36Å; R80-V84 HydrophobicContact CB-CB 4.42Å; R80-V84 HydrophobicContact CG-CG1 4.29Å; R80-V84 PolarHBondContact NH1-O 2.71Å; R80-D86 IonicContact CZ-OD1 2.98Å; R80-D86 IonicContact NH1-OD1 3.06Å; R80-D86 PolarHBondContact NH1-OD1 3.37Å; R80-D86 IonicContact NH2-OD1 2.72Å; R80-D86 PolarHBondContact NH2-OD1 2.79Å; R80-F88 VanDerWaalsContact CD-O 3.31Å; R80-F88 WeakPolarHBondContact CD-O 3.47Å
81	S	98.3	Very high	98.2	Very high	40 Å²	40	55.6 Å²	55.6	28%	0.28	32%	0.323	S	S	.	.	P	Polyproline II helix	trans	-65.9	157.9	168.5	-165.4	0	0	0	0	111	T72 L73 G83 V84	T72-S81 WeakPolarHBondContact O-CB 3.45Å; L73-S81 PolarHBondContact O-N 2.82Å; S81-G83 PolarHBondContact O-N 3.1Å; S81-V84 WeakPolarHBondContact O-CB 3.47Å; S81-V84 WeakPolarHBondContact O-CG2 3.37Å; S81-V84 PolarHBondContact O-N 2.85Å
82	S	98	Very high	98.2	Very high	124 Å²	124	52.7 Å²	52.7	87%	0.867	32%	0.315	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.8	137.1	178	-173.6	0	0	0	0	111.3	V84	S82-V84 PolarHBondContact O-N 3.13Å
83	G	97.6	Very high	98.1	Very high	78 Å²	78	55.5 Å²	55.5	80%	0.804	33%	0.328	S	S	*	.	T	Hydrogen-bonded Turn	trans	78	-2.2	-178.8	0	0	0	0	0	115.3	S81 P85	S81-G83 PolarHBondContact O-N 3.1Å; G83-P85 WeakPolarHBondContact O-CD 3.26Å
84	V	98	Very high	98	Very high	15 Å²	15	58.4 Å²	58.4	9%	0.091	36%	0.359	C	S	.	.			trans	-77.8	122.4	175.9	177.8	0	0	0	0	110	L73 R80 S81 S82 F88	L73-V84 HydrophobicContact CB-CG1 4.49Å; L73-V84 HydrophobicContact CD2-CG1 4Å; L73-V84 HydrophobicContact CD2-CG2 4.06Å; R80-V84 HydrophobicContact CB-CB 4.42Å; R80-V84 HydrophobicContact CG-CG1 4.29Å; R80-V84 PolarHBondContact NH1-O 2.71Å; S81-V84 WeakPolarHBondContact O-CB 3.47Å; S81-V84 WeakPolarHBondContact O-CG2 3.37Å; S81-V84 PolarHBondContact O-N 2.85Å; S82-V84 PolarHBondContact O-N 3.13Å; V84-F88 HydrophobicContact CG1-CB 3.89Å; V84-F88 HydrophobicContact CG1-CD2 3.95Å; V84-F88 HydrophobicContact CG1-CG 4.13Å
85	P	98.1	Very high	97.9	Very high	48 Å²	48	63.3 Å²	63.3	31%	0.312	39%	0.385	S	S	.	.			trans	-58.6	150.7	-178.5	-25.8	35.4	0	0	0	113.4	G83 R87 F88	G83-P85 WeakPolarHBondContact O-CD 3.26Å; P85-R87 HydrophobicContact CB-CG 4.21Å; P85-R87 PolarHBondContact O-N 2.82Å; P85-F88 HydrophobicContact CB-CD2 4.27Å; P85-F88 HydrophobicContact CB-CE2 4.48Å; P85-F88 HydrophobicContact CG-CD2 4.43Å; P85-F88 HydrophobicContact CG-CE2 4.29Å; P85-F88 PolarHBondContact O-N 2.94Å
86	D	98	Very high	97.9	Very high	129 Å²	129	62 Å²	62	69%	0.69	38%	0.381	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59	-17.5	178.9	-65.6	-38.1	0	0	0	113.7	R80 F88	R80-D86 IonicContact CZ-OD1 2.98Å; R80-D86 IonicContact NH1-OD1 3.06Å; R80-D86 PolarHBondContact NH1-OD1 3.37Å; R80-D86 IonicContact NH2-OD1 2.72Å; R80-D86 PolarHBondContact NH2-OD1 2.79Å; D86-F88 PolarHBondContact O-N 2.84Å
87	R	98.2	Very high	97.9	Very high	41 Å²	41	59.6 Å²	59.6	16%	0.155	37%	0.365	C	S	.	.	T	Hydrogen-bonded Turn	trans	-65.1	-24.3	179.5	88.1	177.4	163.3	-98	0.9	113.5	P85 I101 T102 D108	P85-R87 HydrophobicContact CB-CG 4.21Å; P85-R87 PolarHBondContact O-N 2.82Å; R87-I101 HydrophobicContact CG-CG2 4.36Å; R87-I101 WeakPolarHBondContact O-CA 3.24Å; R87-T102 WeakPolarHBondContact CA-OG1 3.18Å; R87-T102 VanDerWaalsContact CB-O 3.25Å; R87-T102 WeakPolarHBondContact CB-O 3.4Å; R87-T102 WeakPolarHBondContact CD-O 3.33Å; R87-T102 PolarHBondContact O-N 3.49Å; R87-T102 PolarHBondContact O-OG1 2.86Å; R87-D108 IonicContact CZ-OD1 2.61Å; R87-D108 VanDerWaalsContact CZ-OD1 3.25Å; R87-D108 IonicContact CZ-OD2 3.03Å; R87-D108 IonicContact NE-OD1 2.65Å; R87-D108 PolarHBondContact NE-OD1 3.19Å; R87-D108 IonicContact NE-OD2 3.81Å; R87-D108 PolarHBondContact NE-OD2 3.45Å; R87-D108 IonicContact NH2-OD1 3.25Å; R87-D108 PolarHBondContact NH2-OD1 3.04Å; R87-D108 IonicContact NH2-OD2 3.74Å
88	F	98.7	Very high	98	Very high	0 Å²	0	59.1 Å²	59.1	0%	0	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.6	136.3	175.6	-64.1	-89.6	0	0	0	110.4	L73 R80 V84 P85 D86 L99 T100 I101 D108 Y112	L73-F88 HydrophobicContact CD1-CD1 3.76Å; L73-F88 HydrophobicContact CD1-CE1 3.8Å; R80-F88 VanDerWaalsContact CD-O 3.31Å; R80-F88 WeakPolarHBondContact CD-O 3.47Å; V84-F88 HydrophobicContact CG1-CB 3.89Å; V84-F88 HydrophobicContact CG1-CD2 3.95Å; V84-F88 HydrophobicContact CG1-CG 4.13Å; P85-F88 HydrophobicContact CB-CD2 4.27Å; P85-F88 HydrophobicContact CB-CE2 4.48Å; P85-F88 HydrophobicContact CG-CD2 4.43Å; P85-F88 HydrophobicContact CG-CE2 4.29Å; P85-F88 PolarHBondContact O-N 2.94Å; D86-F88 PolarHBondContact O-N 2.84Å; F88-L99 HydrophobicContact CD1-CD1 4.46Å; F88-T100 CarbonylContact C-O 3.56Å; F88-T100 WeakPolarHBondContact CA-O 3.43Å; F88-I101 HydrophobicContact CD1-CB 4.42Å; F88-I101 HydrophobicContact CD1-CD1 4.16Å; F88-I101 HydrophobicContact CD1-CG1 3.73Å; F88-I101 HydrophobicContact CD1-CG2 4.13Å; F88-I101 HydrophobicContact CE1-CB 4.43Å; F88-I101 HydrophobicContact CE1-CD1 3.76Å; F88-I101 HydrophobicContact CE1-CG1 3.8Å; F88-I101 HydrophobicContact CE1-CG2 3.85Å; F88-I101 HydrophobicContact CZ-CG2 4.25Å; F88-D108 WeakPolarHBondContact CZ-OD1 3.45Å; F88-Y112 HydrophobicContact CE1-CE1 4.14Å
89	S	98.6	Very high	98	Very high	52 Å²	52	53.9 Å²	53.9	36%	0.364	33%	0.334	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.1	142.7	175.3	55.7	0	0	0	0	110.7	L99 T100	S89-L99 CarbonylContact O-C 3.49Å; S89-L99 WeakPolarHBondContact O-CA 2.88Å; S89-T100 PolarHBondContact N-O 2.76Å; S89-T100 PolarHBondContact O-N 2.82Å; S89-T100 PolarHBondContact OG-O 3.22Å
90	G	98.6	Very high	98	Very high	8 Å²	8	52.6 Å²	52.6	8%	0.082	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	146.1	173.9	0	0	0	0	0	111.8	T77 N78 A98	T77-G90 CarbonylContact O-C 3.56Å; T77-G90 VanDerWaalsContact O-CA 3.3Å; T77-G90 WeakPolarHBondContact O-CA 2.92Å; N78-G90 VanDerWaalsContact CB-O 3.26Å; N78-G90 WeakPolarHBondContact CB-O 3.35Å; G90-A98 CarbonylContact C-O 3.56Å; G90-A98 VanDerWaalsContact CA-O 3.28Å; G90-A98 WeakPolarHBondContact CA-O 3.4Å
91	S	98.4	Very high	98	Very high	47 Å²	47	48 Å²	48	33%	0.329	31%	0.309	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-156	177.3	180	62.3	0	0	0	0	111.7	A98	S91-A98 PolarHBondContact N-O 2.89Å; S91-A98 PolarHBondContact O-N 3.03Å
92	I	98.2	Very high	98	Very high	51 Å²	51	48.9 Å²	48.9	26%	0.262	31%	0.313	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.9	122.7	164.7	-59.9	-60.6	0	0	0	107.5	V53 T55 P59 T77 G94 K96 A97	V53-I92 HydrophobicContact CG1-CD1 4.26Å; T55-I92 HydrophobicContact CG2-CG1 3.79Å; P59-I92 HydrophobicContact CG-CD1 3.98Å; T77-I92 HydrophobicContact CG2-CD1 4.06Å; T77-I92 HydrophobicContact CG2-CG1 3.94Å; I92-G94 VanDerWaalsContact CG2-O 3.28Å; I92-G94 WeakPolarHBondContact CG2-O 3.36Å; I92-K96 CarbonylContact C-O 3.53Å; I92-K96 WeakPolarHBondContact CA-O 3.49Å; I92-A97 HydrophobicContact CD1-CB 4.47Å
93	L	97.2	Very high	98	Very high	104 Å²	104	44.5 Å²	44.5	55%	0.545	29%	0.287	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110	102.6	174.5	-174.3	67.6	0	0	0	109.1	T43 T45 N95 K96 A98	T43-L93 HydrophobicContact CG2-CD2 4.45Å; T45-L93 HydrophobicContact CG2-CD2 4.37Å; L93-N95 PolarHBondContact O-N 3.32Å; L93-N95 VanDerWaalsContact O-N 3.1Å; L93-K96 PolarHBondContact N-O 3.39Å; L93-K96 PolarHBondContact O-N 3.13Å; L93-K96 VanDerWaalsContact O-N 3.13Å; L93-A98 HydrophobicContact CB-CB 3.89Å
94	G	95.9	Very high	98.1	Very high	63 Å²	63	41.2 Å²	41.2	65%	0.649	25%	0.252	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.3	-112.6	-171.8	0	0	0	0	0	110.6	I92	I92-G94 VanDerWaalsContact CG2-O 3.28Å; I92-G94 WeakPolarHBondContact CG2-O 3.36Å
95	N	96.2	Very high	98.1	Very high	102 Å²	102	45.2 Å²	45.2	55%	0.545	27%	0.27	S	S	.	.	T	Hydrogen-bonded Turn	trans	-107.9	17.7	-178.9	-67.4	-18.3	0	0	0	113	S52 V53 L93	S52-N95 PolarHBondContact OG-ND2 3.42Å; V53-N95 WeakPolarHBondContact CB-O 3.46Å; V53-N95 PolarHBondContact N-O 3.18Å; L93-N95 PolarHBondContact O-N 3.32Å; L93-N95 VanDerWaalsContact O-N 3.1Å
96	K	98	Very high	98	Very high	74 Å²	74	47 Å²	47	32%	0.322	29%	0.289	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.9	146.2	-178.1	-65.4	-166.8	177.2	-162.9	0	110.7	C46 I92 L93	C46-K96 CarbonylContact O-C 3.59Å; C46-K96 WeakPolarHBondContact O-CA 3.25Å; C46-K96 WeakPolarHBondContact O-CB 3.48Å; I92-K96 CarbonylContact C-O 3.53Å; I92-K96 WeakPolarHBondContact CA-O 3.49Å; L93-K96 PolarHBondContact N-O 3.39Å; L93-K96 PolarHBondContact O-N 3.13Å; L93-K96 VanDerWaalsContact O-N 3.13Å
97	A	98.2	Very high	97.8	Very high	0 Å²	0	47 Å²	47	0%	0	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.7	143.2	162.2	0	0	0	0	0	109.6	T45 C46 V53 P59 I92 L116	T45-A97 CarbonylContact C-O 3.55Å; T45-A97 VanDerWaalsContact CA-O 3.27Å; T45-A97 WeakPolarHBondContact CA-O 3.33Å; C46-A97 HydrophobicContact CB-CB 4.19Å; C46-A97 PolarHBondContact N-O 3.12Å; C46-A97 PolarHBondContact O-N 3.21Å; V53-A97 HydrophobicContact CG1-CB 4.07Å; P59-A97 HydrophobicContact CB-CB 3.46Å; P59-A97 VanDerWaalsContact CB-CB 3.46Å; P59-A97 HydrophobicContact CG-CB 3.76Å; I92-A97 HydrophobicContact CD1-CB 4.47Å; A97-L116 HydrophobicContact CB-CD2 4.21Å
98	A	98.5	Very high	97.7	Very high	1 Å²	1	45.5 Å²	45.5	1%	0.008	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	140.8	-178.3	0	0	0	0	0	111	T43 L44 W61 G90 S91 L93	T43-A98 HydrophobicContact CG2-CB 3.9Å; L44-A98 CarbonylContact O-C 3.56Å; L44-A98 VanDerWaalsContact O-CA 3.24Å; L44-A98 WeakPolarHBondContact O-CA 3.27Å; W61-A98 PolarHBondContact NE1-O 2.8Å; G90-A98 CarbonylContact C-O 3.56Å; G90-A98 VanDerWaalsContact CA-O 3.28Å; G90-A98 WeakPolarHBondContact CA-O 3.4Å; S91-A98 PolarHBondContact N-O 2.89Å; S91-A98 PolarHBondContact O-N 3.03Å; L93-A98 HydrophobicContact CB-CB 3.89Å
99	L	98.7	Very high	97.6	Very high	0 Å²	0	53.7 Å²	53.7	0%	0	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	116.4	166.1	173.9	71.9	0	0	0	107.8	T43 L44 W61 L73 I74 F88 S89 I101 Y112	T43-L99 CarbonylContact C-O 3.58Å; T43-L99 WeakPolarHBondContact CA-O 3.28Å; L44-L99 HydrophobicContact CB-CB 4.42Å; L44-L99 PolarHBondContact N-O 2.75Å; L44-L99 PolarHBondContact O-N 3.12Å; W61-L99 HydrophobicContact CB-CD1 4.24Å; W61-L99 HydrophobicContact CB-CD2 4.19Å; W61-L99 HydrophobicContact CD2-CB 3.46Å; W61-L99 VanDerWaalsContact CD2-CB 3.46Å; W61-L99 HydrophobicContact CD2-CD2 4.09Å; W61-L99 HydrophobicContact CD2-CG 4.29Å; W61-L99 VanDerWaalsContact CE2-CB 3.5Å; W61-L99 HydrophobicContact CE3-CB 3.82Å; W61-L99 HydrophobicContact CE3-CD2 3.89Å; W61-L99 HydrophobicContact CE3-CG 4.49Å; W61-L99 HydrophobicContact CG-CB 3.8Å; W61-L99 HydrophobicContact CG-CD1 4.24Å; W61-L99 HydrophobicContact CG-CD2 4.23Å; W61-L99 HydrophobicContact CG-CG 4.32Å; W61-L99 HydrophobicContact CH2-CB 4.21Å; W61-L99 HydrophobicContact CZ2-CB 3.9Å; W61-L99 HydrophobicContact CZ3-CB 4.17Å; L73-L99 HydrophobicContact CD1-CD2 4.16Å; I74-L99 HydrophobicContact CG1-CD1 3.7Å; F88-L99 HydrophobicContact CD1-CD1 4.46Å; S89-L99 CarbonylContact O-C 3.49Å; S89-L99 WeakPolarHBondContact O-CA 2.88Å; L99-I101 HydrophobicContact CD2-CD1 4.42Å; L99-I101 HydrophobicContact CD2-CG1 4.47Å; L99-I101 HydrophobicContact CG-CG1 4.3Å; L99-Y112 HydrophobicContact CD2-CD1 3.56Å; L99-Y112 HydrophobicContact CD2-CE1 3.95Å; L99-Y112 HydrophobicContact CD2-CG 4.44Å
100	T	98.6	Very high	97.5	Very high	25 Å²	25	52.4 Å²	52.4	15%	0.153	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	128.7	175.7	-61.5	0	0	0	0	109.7	T41 V42 T43 F88 S89 T102	T41-T100 HydrophobicContact CG2-CG2 3.81Å; V42-T100 WeakPolarHBondContact O-CA 3.36Å; T43-T100 PolarHBondContact OG1-OG1 3.31Å; F88-T100 CarbonylContact C-O 3.56Å; F88-T100 WeakPolarHBondContact CA-O 3.43Å; S89-T100 PolarHBondContact N-O 2.76Å; S89-T100 PolarHBondContact O-N 2.82Å; S89-T100 PolarHBondContact OG-O 3.22Å; T100-T102 HydrophobicContact CG2-CG2 4.12Å
101	I	98.6	Very high	97.4	Very high	5 Å²	5	56 Å²	56	3%	0.026	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.6	113	176.2	-46.8	175.5	0	0	0	106.2	T41 V42 L44 R87 F88 L99 Y112	T41-I101 CarbonylContact C-O 3.57Å; T41-I101 VanDerWaalsContact CA-O 3.26Å; T41-I101 WeakPolarHBondContact CA-O 3.3Å; V42-I101 HydrophobicContact CG1-CB 3.97Å; V42-I101 HydrophobicContact CG1-CD1 4.22Å; V42-I101 HydrophobicContact CG1-CG1 4.32Å; V42-I101 PolarHBondContact N-O 2.9Å; V42-I101 PolarHBondContact O-N 3.22Å; L44-I101 HydrophobicContact CD1-CD1 3.89Å; L44-I101 HydrophobicContact CD1-CG1 4.31Å; R87-I101 HydrophobicContact CG-CG2 4.36Å; R87-I101 WeakPolarHBondContact O-CA 3.24Å; F88-I101 HydrophobicContact CD1-CB 4.42Å; F88-I101 HydrophobicContact CD1-CD1 4.16Å; F88-I101 HydrophobicContact CD1-CG1 3.73Å; F88-I101 HydrophobicContact CD1-CG2 4.13Å; F88-I101 HydrophobicContact CE1-CB 4.43Å; F88-I101 HydrophobicContact CE1-CD1 3.76Å; F88-I101 HydrophobicContact CE1-CG1 3.8Å; F88-I101 HydrophobicContact CE1-CG2 3.85Å; F88-I101 HydrophobicContact CZ-CG2 4.25Å; L99-I101 HydrophobicContact CD2-CD1 4.42Å; L99-I101 HydrophobicContact CD2-CG1 4.47Å; L99-I101 HydrophobicContact CG-CG1 4.3Å; I101-Y112 HydrophobicContact CD1-CE1 3.85Å; I101-Y112 HydrophobicContact CD1-CE2 4.38Å
102	T	98.5	Very high	97.4	Very high	59 Å²	59	55.3 Å²	55.3	36%	0.362	32%	0.321	S	S	.	.			trans	-97.3	156.9	174.6	59.3	0	0	0	0	110	G40 T41 R87 T100 A104	G40-T102 CarbonylContact O-C 3.54Å; T41-T102 HydrophobicContact CG2-CG2 3.9Å; R87-T102 WeakPolarHBondContact CA-OG1 3.18Å; R87-T102 VanDerWaalsContact CB-O 3.25Å; R87-T102 WeakPolarHBondContact CB-O 3.4Å; R87-T102 WeakPolarHBondContact CD-O 3.33Å; R87-T102 PolarHBondContact O-N 3.49Å; R87-T102 PolarHBondContact O-OG1 2.86Å; T100-T102 HydrophobicContact CG2-CG2 4.12Å; T102-A104 VanDerWaalsContact C-N 3.34Å; T102-A104 PolarHBondContact O-N 3.38Å
103	G	98.3	Very high	97.4	Very high	32 Å²	32	58 Å²	58	33%	0.33	33%	0.328	S	S	.	.	S	Bend	trans	57.2	45.3	175.8	0	0	0	0	0	113.4	G40 Q105	G40-G103 PolarHBondContact O-N 3.38Å; G103-Q105 WeakPolarHBondContact O-CG 3.08Å; G103-Q105 PolarHBondContact O-N 3.48Å
104	A	98.4	Very high	97.4	Very high	9 Å²	9	53.5 Å²	53.5	7%	0.074	31%	0.306	C	S	.	.			trans	-50.9	133.2	-171.4	0	0	0	0	0	113.1	V36 G39 G40 T102	V36-A104 HydrophobicContact CG1-CB 3.6Å; V36-A104 HydrophobicContact CG2-CB 4.3Å; G39-A104 PolarHBondContact N-O 2.87Å; G40-A104 PolarHBondContact O-N 3.01Å; T102-A104 VanDerWaalsContact C-N 3.34Å; T102-A104 PolarHBondContact O-N 3.38Å
105	Q	97.8	Very high	97.5	Very high	100 Å²	100	54 Å²	54	47%	0.467	30%	0.296	S	S	.	.			trans	-116.3	162.5	-178	-55.4	-176.8	-11	0	0	110.6	G103 D107 D108	G103-Q105 WeakPolarHBondContact O-CG 3.08Å; G103-Q105 PolarHBondContact O-N 3.48Å; Q105-D107 PolarHBondContact O-N 3.46Å; Q105-D108 PolarHBondContact N-OD2 3.48Å; Q105-D108 VanDerWaalsContact O-CB 3.3Å; Q105-D108 WeakPolarHBondContact O-CB 3.33Å; Q105-D108 PolarHBondContact O-N 2.88Å
106	A	95.8	Very high	97.5	Very high	86 Å²	86	49.7 Å²	49.7	71%	0.711	27%	0.273	S	S	*	.	G	3₁₀ helix	trans	-58.2	-37.3	176.4	0	0	0	0	0	112.1	D108 E109	A106-D108 PolarHBondContact O-N 3.08Å; A106-D108 VanDerWaalsContact O-N 3.14Å; A106-E109 WeakPolarHBondContact O-CB 3.49Å; A106-E109 PolarHBondContact O-N 2.9Å; A106-E109 VanDerWaalsContact O-N 3.14Å
107	D	94.4	Very high	97.2	Very high	127 Å²	127	53.2 Å²	53.2	68%	0.679	29%	0.286	S	S	*	.	G	3₁₀ helix	trans	-69.7	-5.9	177.5	-62.4	-13.1	0	0	0	113.9	Q105 E109	Q105-D107 PolarHBondContact O-N 3.46Å; D107-E109 VanDerWaalsContact C-N 3.35Å
108	D	96.7	Very high	96.5	Very high	11 Å²	11	57.1 Å²	57.1	6%	0.059	31%	0.305	C	S	.	.	G	3₁₀ helix	trans	-86	-9.5	174.3	-60.3	-30.8	0	0	0	112.1	R87 F88 Q105 A106 S110 Y112	R87-D108 IonicContact CZ-OD1 2.61Å; R87-D108 VanDerWaalsContact CZ-OD1 3.25Å; R87-D108 IonicContact CZ-OD2 3.03Å; R87-D108 IonicContact NE-OD1 2.65Å; R87-D108 PolarHBondContact NE-OD1 3.19Å; R87-D108 IonicContact NE-OD2 3.81Å; R87-D108 PolarHBondContact NE-OD2 3.45Å; R87-D108 IonicContact NH2-OD1 3.25Å; R87-D108 PolarHBondContact NH2-OD1 3.04Å; R87-D108 IonicContact NH2-OD2 3.74Å; F88-D108 WeakPolarHBondContact CZ-OD1 3.45Å; Q105-D108 PolarHBondContact N-OD2 3.48Å; Q105-D108 VanDerWaalsContact O-CB 3.3Å; Q105-D108 WeakPolarHBondContact O-CB 3.33Å; Q105-D108 PolarHBondContact O-N 2.88Å; A106-D108 PolarHBondContact O-N 3.08Å; A106-D108 VanDerWaalsContact O-N 3.14Å; D108-S110 PolarHBondContact O-N 3.09Å; D108-Y112 VanDerWaalsContact O-CE2 3.32Å; D108-Y112 WeakPolarHBondContact O-CE2 3.31Å; D108-Y112 PolarHBondContact O-OH 3.35Å
109	E	96	Very high	95	Very high	172 Å²	172	58.9 Å²	58.9	80%	0.804	32%	0.323	S	S	*	.			trans	-70.9	108.3	176.1	-170.6	170.8	173	0	0	110.5	A106 D107	A106-E109 WeakPolarHBondContact O-CB 3.49Å; A106-E109 PolarHBondContact O-N 2.9Å; A106-E109 VanDerWaalsContact O-N 3.14Å; D107-E109 VanDerWaalsContact C-N 3.35Å
110	S	96.7	Very high	93.2	Very high	25 Å²	25	65 Å²	65	18%	0.175	37%	0.366	C	S	.	.	S	Bend	trans	-168.7	167.1	-168.3	-152.7	0	0	0	0	111.1	Q63 Q64 T65 D108 Y112	Q63-S110 WeakPolarHBondContact CG-OG 3.4Å; Q63-S110 VanDerWaalsContact NE2-CB 3.33Å; Q64-S110 PolarHBondContact O-OG 2.98Å; T65-S110 WeakPolarHBondContact CA-OG 3.24Å; T65-S110 PolarHBondContact N-OG 2.9Å; T65-S110 PolarHBondContact OG1-OG 3.29Å; D108-S110 PolarHBondContact O-N 3.09Å; S110-Y112 WeakPolarHBondContact O-CD2 3.49Å; S110-Y112 WeakPolarHBondContact O-CE2 3.41Å
111	D	97.2	Very high	90.7	Very high	83 Å²	83	67.3 Å²	67.3	44%	0.444	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.2	137.3	166.3	-61.4	-54.6	0	0	0	110.7	Q63 Q64 Y113	Q63-D111 CarbonylContact C-O 3.57Å; Q63-D111 WeakPolarHBondContact CA-O 3.32Å; Q64-D111 HydrophobicContact CB-CB 4.41Å; Q64-D111 PolarHBondContact N-O 3.44Å; Q64-D111 PolarHBondContact O-N 2.86Å; D111-Y113 HydrophobicContact CB-CE2 3.77Å
112	Y	98.1	Very high	88.2	Confident	32 Å²	32	78.2 Å²	78.2	13%	0.125	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	122.5	-179.3	-69.6	-95.2	0	0	0	111.3	L44 Y62 Q63 L73 F88 L99 I101 D108 S110	L44-Y112 HydrophobicContact CD2-CD1 4.44Å; L44-Y112 HydrophobicContact CD2-CD2 3.97Å; L44-Y112 HydrophobicContact CD2-CG 3.75Å; Y62-Y112 CarbonylContact O-C 3.51Å; Y62-Y112 VanDerWaalsContact O-CA 3.31Å; Y62-Y112 WeakPolarHBondContact O-CA 3.2Å; Q63-Y112 HydrophobicContact CB-CD1 4.2Å; Q63-Y112 HydrophobicContact CB-CE1 4.03Å; Q63-Y112 HydrophobicContact CG-CD1 4.39Å; Q63-Y112 HydrophobicContact CG-CE1 3.94Å; Q63-Y112 PolarHBondContact NE2-OH 2.86Å; L73-Y112 HydrophobicContact CD1-CD1 3.92Å; L73-Y112 HydrophobicContact CD1-CE1 3.55Å; F88-Y112 HydrophobicContact CE1-CE1 4.14Å; L99-Y112 HydrophobicContact CD2-CD1 3.56Å; L99-Y112 HydrophobicContact CD2-CE1 3.95Å; L99-Y112 HydrophobicContact CD2-CG 4.44Å; I101-Y112 HydrophobicContact CD1-CE1 3.85Å; I101-Y112 HydrophobicContact CD1-CE2 4.38Å; D108-Y112 VanDerWaalsContact O-CE2 3.32Å; D108-Y112 WeakPolarHBondContact O-CE2 3.31Å; D108-Y112 PolarHBondContact O-OH 3.35Å; S110-Y112 WeakPolarHBondContact O-CD2 3.49Å; S110-Y112 WeakPolarHBondContact O-CE2 3.41Å
113	Y	97.7	Very high	87.7	Confident	107 Å²	107	79.2 Å²	79.2	42%	0.42	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	132.6	-177.5	-61.7	-77.2	0	0	0	111.3	W61 Y62 Q64 D111	W61-Y113 CarbonylContact C-O 3.48Å; W61-Y113 WeakPolarHBondContact CA-O 3.38Å; Y62-Y113 PolarHBondContact N-O 2.94Å; Y62-Y113 PolarHBondContact O-N 3.31Å; Q64-Y113 HydrophobicContact CB-CD2 4.23Å; Q64-Y113 HydrophobicContact CB-CE2 3.86Å; D111-Y113 HydrophobicContact CB-CE2 3.77Å
114	C	98	Very high	87.1	Confident	11 Å²	11	81.6 Å²	81.6	7%	0.074	46%	0.461	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	137.6	172	172.3	0	0	0	0	110.3	Q30 C46 S60 W61	Q30-C114 HydrophobicContact CG-CB 4.31Å; Q30-C114 VanDerWaalsContact NE2-N 3.19Å; C46-C114 HydrophobicContact CB-CB 3.29Å; C46-C114 WeakPolarHBondContact CB-SG 3.3Å; C46-C114 WeakPolarHBondContact SG-CB 3.47Å; C46-C114 CovalentContact SG-SG 2.02Å; C46-C114 PolarHBondContact SG-SG 3.18Å; S60-C114 CarbonylContact O-C 3.18Å; S60-C114 WeakPolarHBondContact O-CA 3.3Å; W61-C114 HydrophobicContact CD2-CB 4.18Å; W61-C114 HydrophobicContact CE3-CB 3.98Å; W61-C114 HydrophobicContact CH2-CB 3.98Å; W61-C114 HydrophobicContact CZ2-CB 4.15Å; W61-C114 HydrophobicContact CZ3-CB 3.9Å
115	V	96.8	Very high	86.5	Confident	72 Å²	72	85.7 Å²	85.7	44%	0.436	48%	0.483	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	132.9	173.2	-178.5	0	0	0	0	108.8	P59 S60 Y62	P59-V115 WeakPolarHBondContact CA-O 3.37Å; S60-V115 PolarHBondContact N-O 3.3Å; S60-V115 PolarHBondContact O-N 3.38Å; Y62-V115 HydrophobicContact CD2-CG2 3.94Å; Y62-V115 HydrophobicContact CE2-CB 4.09Å; Y62-V115 HydrophobicContact CE2-CG2 3.66Å
116	L	96.2	Very high	85.8	Confident	13 Å²	13	84.8 Å²	84.8	7%	0.068	48%	0.484	C	S	.	.			trans	-116.5	125.8	176	-58.8	178.9	0	0	0	108.6	V28 L48 V53 P59 A97 M118	V28-L116 HydrophobicContact CG1-CD1 4.35Å; V28-L116 HydrophobicContact CG2-CB 4.38Å; V28-L116 HydrophobicContact CG2-CD1 4.18Å; V28-L116 HydrophobicContact CG2-CG 4.32Å; L48-L116 HydrophobicContact CD2-CD1 3.62Å; L48-L116 HydrophobicContact CG-CD1 3.83Å; V53-L116 HydrophobicContact CG1-CD1 4.19Å; V53-L116 HydrophobicContact CG1-CD2 3.69Å; V53-L116 HydrophobicContact CG2-CD1 3.54Å; P59-L116 HydrophobicContact CB-CD2 3.67Å; P59-L116 HydrophobicContact CG-CD2 3.75Å; A97-L116 HydrophobicContact CB-CD2 4.21Å; L116-M118 PolarHBondContact O-N 3.44Å; L116-M118 VanDerWaalsContact O-N 3.13Å
117	Y	92.6	Very high	85.2	Confident	148 Å²	148	84.8 Å²	84.8	58%	0.58	47%	0.47	S	S	*	.			trans	-77.7	95.1	173.2	-172.2	-102.4	0	0	0	109.6	Y57 Y58 G119	Y57-Y117 WeakPolarHBondContact CA-O 3.41Å; Y57-Y117 WeakPolarHBondContact CD1-O 3.25Å; Y57-Y117 WeakPolarHBondContact O-CA 3.34Å; Y57-Y117 WeakPolarHBondContact O-CB 3.28Å; Y57-Y117 PolarHBondContact O-N 3.48Å; Y58-Y117 HydrophobicContact CD2-CD1 4.17Å; Y117-G119 PolarHBondContact O-N 2.99Å
118	M	82.4	Confident	84.6	Confident	81 Å²	81	81.9 Å²	81.9	40%	0.399	46%	0.456	S	S	.	.			trans	-83.1	104	166.7	-50.1	-175.3	-146.6	0	0	105.6	T26 V28 L48 Y57 L116	T26-M118 HydrophobicContact CG2-CE 4.4Å; T26-M118 HydrophobicContact CG2-SD 4.04Å; V28-M118 HydrophobicContact CG2-CE 3.68Å; L48-M118 HydrophobicContact CD2-CE 3.27Å; L48-M118 HydrophobicContact CD2-SD 3.94Å; Y57-M118 HydrophobicContact CD1-CG 4.37Å; Y57-M118 HydrophobicContact CE1-CG 4.45Å; L116-M118 PolarHBondContact O-N 3.44Å; L116-M118 VanDerWaalsContact O-N 3.13Å
119	G	67.5	Low	83.7	Confident	39 Å²	39	87 Å²	87	40%	0.402	48%	0.484	S	S	.	.			trans	-52.6	159.2	173.6	0	0	0	0	0	110.7	Y117 G121	Y117-G119 PolarHBondContact O-N 2.99Å; G119-G121 PolarHBondContact O-N 2.84Å
120	S	60.2	Low	82.7	Confident	129 Å²	129	80.5 Å²	80.5	90%	0.902	46%	0.46	S	S	*	.	S	Bend	trans	-68.5	68.5	175.5	53.8	0	0	0	0	111.4
121	G	47.4	Very low	81.6	Confident	73 Å²	73	85.1 Å²	85.1	75%	0.753	48%	0.483	S	S	*	.			trans	-136.8	33.1	180	0	0	0	0	0	112.2	G119	G119-G121 PolarHBondContact O-N 2.84Å
122	I	44.9	Very low	80.2	Confident	233 Å²	233	85.3 Å²	85.3	100%	1.195	49%	0.487	S	S	*	.			trans	-98.4	0	153.7	40.1	172.3	0	0	0	108.5

Retrieved 122 of 122 residues in 71.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).