LVX54_HUMAN Loading...

Immunoglobulin lambda variable 10-54

V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition¹. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens^2,3. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen^4,5.

AlphaFold DB , UniProt , Accession A0A075B6I4, Species HUMAN (Homo sapiens, Human), Gene IGLV10-54, Length 117 aa.

						>LVX54_HUMAN|A0A075B6I4|IGLV10-54
MPWALLLLTLLTHSAVSVVQAGLTQPPSVSKGLRQTATLTCTGNSNIVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSALDSSLSA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59	Low	62	Low	199 Å²	199	128.5 Å²	128.5	98%	0.98	68%	0.68	S	S	*	*				0	98.9	0	-74.6	161.2	83.8	0	0	108.7	W3	M1-W3 PolarHBondContact O-N 3.28Å; M1-W3 VanDerWaalsContact O-N 3.16Å
2	P	61	Low	61.7	Low	94 Å²	94	126.9 Å²	126.9	61%	0.61	68%	0.679	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.5	-5.9	-177.2	28.4	-33.8	0	0	0	113.6	A4 L5	P2-A4 VanDerWaalsContact C-N 3.26Å; P2-A4 PolarHBondContact O-N 3.27Å; P2-L5 PolarHBondContact O-N 2.86Å
3	W	62.5	Low	61.4	Low	185 Å²	185	129.5 Å²	129.5	70%	0.701	68%	0.684	S	S	*	*	H	α-helix	trans	-65.4	-23	179.9	-60.4	-17	0	0	0	114.3	M1 L5 L6 L7	M1-W3 PolarHBondContact O-N 3.28Å; M1-W3 VanDerWaalsContact O-N 3.16Å; W3-L5 VanDerWaalsContact C-N 3.26Å; W3-L5 PolarHBondContact O-N 3.5Å; W3-L6 PolarHBondContact O-N 3.48Å; W3-L7 PolarHBondContact O-N 3.44Å
4	A	65.1	Low	61.4	Low	69 Å²	69	127.5 Å²	127.5	57%	0.57	69%	0.686	S	S	*	*	H	α-helix	trans	-63.8	-32.7	174.4	0	0	0	0	0	112.4	P2 L8	P2-A4 VanDerWaalsContact C-N 3.26Å; P2-A4 PolarHBondContact O-N 3.27Å; A4-L8 PolarHBondContact O-N 3.13Å
5	L	65.9	Low	61.8	Low	127 Å²	127	125.2 Å²	125.2	67%	0.665	69%	0.691	S	S	*	*	H	α-helix	trans	-75.1	-32	178.1	-65.7	170.4	0	0	0	112	P2 W3 L7 L8 T9	P2-L5 PolarHBondContact O-N 2.86Å; W3-L5 VanDerWaalsContact C-N 3.26Å; W3-L5 PolarHBondContact O-N 3.5Å; L5-L7 VanDerWaalsContact C-N 3.34Å; L5-L8 PolarHBondContact O-N 3.16Å; L5-T9 PolarHBondContact O-N 3.49Å
6	L	62.7	Low	61.6	Low	113 Å²	113	125.3 Å²	125.3	59%	0.592	70%	0.696	S	S	*	*	H	α-helix	trans	-68.4	-30.8	176.2	-87.3	153.6	0	0	0	113	W3 T9	W3-L6 PolarHBondContact O-N 3.48Å; L6-T9 PolarHBondContact O-OG1 2.98Å; L6-T9 VanDerWaalsContact O-OG1 3.1Å
7	L	63.9	Low	61.5	Low	125 Å²	125	123.8 Å²	123.8	65%	0.654	70%	0.696	S	S	*	*	H	α-helix	trans	-73.5	-30.5	173.6	-73.3	167.8	0	0	0	112.1	W3 L5 L10	W3-L7 PolarHBondContact O-N 3.44Å; L5-L7 VanDerWaalsContact C-N 3.34Å; L7-L10 PolarHBondContact O-N 2.7Å
8	L	61.2	Low	61.1	Low	133 Å²	133	123.9 Å²	123.9	70%	0.696	70%	0.7	S	S	*	*	H	α-helix	trans	-70.8	-32.3	-179.1	-134.6	82.6	0	0	0	112.7	A4 L5 L10	A4-L8 PolarHBondContact O-N 3.13Å; L5-L8 PolarHBondContact O-N 3.16Å; L8-L10 VanDerWaalsContact C-N 3.33Å
9	T	61.8	Low	60.9	Low	88 Å²	88	124.2 Å²	124.2	54%	0.54	70%	0.704	S	S	.	*	H	α-helix	trans	-75	-20	178.5	53	0	0	0	0	113.4	L5 L6 L11	L5-T9 PolarHBondContact O-N 3.49Å; L6-T9 PolarHBondContact O-OG1 2.98Å; L6-T9 VanDerWaalsContact O-OG1 3.1Å; T9-L11 VanDerWaalsContact C-N 3.35Å; T9-L11 PolarHBondContact O-N 2.81Å
10	L	59.4	Low	60.6	Low	129 Å²	129	126.6 Å²	126.6	68%	0.675	71%	0.709	S	S	*	*	H	α-helix	trans	-75.9	-21.3	-177.7	-129.1	75.5	0	0	0	113.4	L7 L8	L7-L10 PolarHBondContact O-N 2.7Å; L8-L10 VanDerWaalsContact C-N 3.33Å
11	L	59.4	Low	60.6	Low	152 Å²	152	124.5 Å²	124.5	80%	0.796	71%	0.708	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.5	-5.2	-173.3	-100.8	78.7	0	0	0	115.5	T9	T9-L11 VanDerWaalsContact C-N 3.35Å; T9-L11 PolarHBondContact O-N 2.81Å
12	T	59	Low	61.6	Low	109 Å²	109	116.7 Å²	116.7	67%	0.669	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.1	18.6	-174	54.7	0	0	0	0	115.1	S14	T12-S14 PolarHBondContact O-N 2.77Å; T12-S14 VanDerWaalsContact O-N 3.15Å
13	H	57.9	Low	63	Low	160 Å²	160	114.7 Å²	114.7	74%	0.741	66%	0.662	S	S	*	*			trans	-86.3	74.8	162.4	-59	88.9	0	0	0	108.1	A15	H13-A15 VanDerWaalsContact C-N 3.27Å; H13-A15 PolarHBondContact O-N 3.19Å
14	S	60.7	Low	64.6	Low	102 Å²	102	110.9 Å²	110.9	71%	0.713	66%	0.66	S	S	*	*			trans	-58.2	104.3	155.3	42.4	0	0	0	0	106	T12 V16	T12-S14 PolarHBondContact O-N 2.77Å; T12-S14 VanDerWaalsContact O-N 3.15Å; S14-V16 PolarHBondContact O-N 2.94Å
15	A	67.9	Low	66	Low	93 Å²	93	111.3 Å²	111.3	77%	0.769	65%	0.65	S	S	*	*			trans	-54.6	109	170.3	0	0	0	0	0	106.6	H13 S17	H13-A15 VanDerWaalsContact C-N 3.27Å; H13-A15 PolarHBondContact O-N 3.19Å; A15-S17 PolarHBondContact O-N 3.22Å
16	V	58.5	Low	67.5	Low	127 Å²	127	107.9 Å²	107.9	77%	0.77	64%	0.635	S	S	*	*			trans	-65.2	106.8	172.3	-178.8	0	0	0	0	105.1	S14 V18	S14-V16 PolarHBondContact O-N 2.94Å; V16-V18 PolarHBondContact O-N 3.25Å
17	S	60.3	Low	69.1	Low	100 Å²	100	109.1 Å²	109.1	70%	0.699	65%	0.65	S	S	*	*			trans	-68	102.5	171.7	32.5	0	0	0	0	106.9	A15 V19	A15-S17 PolarHBondContact O-N 3.22Å; S17-V19 VanDerWaalsContact C-N 3.35Å; S17-V19 PolarHBondContact O-N 3.29Å
18	V	54.6	Low	70.6	Confident	125 Å²	125	107.9 Å²	107.9	76%	0.758	65%	0.652	S	S	*	*			trans	-69.2	98.6	169	-178.1	0	0	0	0	106.3	V16 Q20	V16-V18 PolarHBondContact O-N 3.25Å; V18-Q20 PolarHBondContact O-N 3.2Å; V18-Q20 VanDerWaalsContact O-N 3.12Å
19	V	56.9	Low	72.4	Confident	129 Å²	129	104.8 Å²	104.8	78%	0.782	64%	0.638	S	S	*	*			trans	-76.3	98.8	171.7	-170.7	0	0	0	0	106.8	S17 A21	S17-V19 VanDerWaalsContact C-N 3.35Å; S17-V19 PolarHBondContact O-N 3.29Å; V19-A21 PolarHBondContact O-N 3.28Å
20	Q	54.3	Low	74.1	Confident	173 Å²	173	106 Å²	106	81%	0.808	65%	0.65	S	S	*	*			trans	-70	120.4	174.4	-164.4	157.7	-42.6	0	0	108.7	V18 G22	V18-Q20 PolarHBondContact O-N 3.2Å; V18-Q20 VanDerWaalsContact O-N 3.12Å; Q20-G22 PolarHBondContact O-N 2.9Å
21	A	61.4	Low	75.9	Confident	83 Å²	83	105.5 Å²	105.5	69%	0.686	64%	0.643	S	S	*	*			trans	-72.3	75.2	175.3	0	0	0	0	0	109.7	V19	V19-A21 PolarHBondContact O-N 3.28Å
22	G	78.5	Confident	77.7	Confident	34 Å²	34	99.8 Å²	99.8	35%	0.351	62%	0.621	S	S	.	*	S	Bend	trans	-97.9	-81.6	177	0	0	0	0	0	110.2	Q20	Q20-G22 PolarHBondContact O-N 2.9Å
23	L	92.1	Very high	79.6	Confident	53 Å²	53	100 Å²	100	28%	0.277	62%	0.617	S	S	.	*			trans	-156.7	147.1	-174.9	-66.6	170.6	0	0	0	108.5	I47 V48 C108 A110	L23-I47 HydrophobicContact CD2-CG2 3.84Å; L23-V48 HydrophobicContact CD2-CG2 3.44Å; L23-V48 VanDerWaalsContact CD2-CG2 3.44Å; L23-C108 HydrophobicContact CD1-CB 4.29Å; L23-C108 WeakPolarHBondContact CD1-O 3.25Å; L23-A110 HydrophobicContact CD1-CB 4.3Å; L23-A110 HydrophobicContact CD2-CB 4.27Å
24	T	94.8	Very high	81.5	Confident	105 Å²	105	101.5 Å²	101.5	64%	0.644	62%	0.616	S	S	*	*	B	Isolated β-bridge	trans	-115.2	123.1	174.9	-55.2	0	0	0	0	109.6	C41 T42	T24-C41 WeakPolarHBondContact O-CA 3.46Å; T24-T42 PolarHBondContact N-O 2.83Å; T24-T42 PolarHBondContact O-N 3.43Å
25	Q	95.9	Very high	83.3	Confident	78 Å²	78	101.4 Å²	101.4	36%	0.364	61%	0.605	S	S	.	*			trans	-126.3	148.3	174.5	61.3	-179.7	48.8	0	0	110.3	Y106	Q25-Y106 PolarHBondContact NE2-O 2.98Å
26	P	96.6	Very high	84.8	Confident	55 Å²	55	100.4 Å²	100.4	36%	0.357	59%	0.589	S	S	.	*			trans	-57.4	146.3	168.2	-21.9	33.2	0	0	0	111	S28 T40	P26-S28 VanDerWaalsContact C-N 3.28Å; P26-S28 PolarHBondContact O-N 2.97Å; P26-T40 VanDerWaalsContact CD-O 3.22Å; P26-T40 WeakPolarHBondContact CD-O 3.42Å
27	P	95.2	Very high	86.7	Confident	138 Å²	138	94.7 Å²	94.7	90%	0.896	56%	0.555	S	S	*	*	S	Bend	trans	-68	-28.9	-177.8	27.3	-35.1	0	0	0	112.9
28	S	97	Very high	88.5	Confident	100 Å²	100	93 Å²	93	70%	0.699	54%	0.541	S	S	*	.			trans	-157.2	156	177	62.1	0	0	0	0	111.3	P26	P26-S28 VanDerWaalsContact C-N 3.28Å; P26-S28 PolarHBondContact O-N 2.97Å
29	V	97.8	Very high	90.6	Very high	67 Å²	67	88.2 Å²	88.2	41%	0.406	51%	0.511	S	S	.	.			trans	-133.5	128.9	170.2	176.9	0	0	0	0	107.1	K31 A37	V29-K31 HydrophobicContact CG1-CG 4.46Å; V29-A37 HydrophobicContact CG1-CB 4.37Å
30	S	97.8	Very high	92.5	Very high	114 Å²	114	84.5 Å²	84.5	80%	0.797	49%	0.488	S	S	*	.			trans	-123.3	131.8	178	-174.7	0	0	0	0	110.5
31	K	97.9	Very high	94.5	Very high	118 Å²	118	76.2 Å²	76.2	51%	0.513	45%	0.45	S	S	.	.			trans	-148.5	155.4	-180	-69	-62.5	-178.8	-176.4	0	109.4	V29 A37 L98	V29-K31 HydrophobicContact CG1-CG 4.46Å; K31-A37 HydrophobicContact CB-CB 4.32Å; K31-A37 HydrophobicContact CG-CB 3.87Å; K31-L98 HydrophobicContact CB-CD1 3.42Å; K31-L98 VanDerWaalsContact CB-CD1 3.42Å; K31-L98 HydrophobicContact CG-CD1 4.39Å
32	G	97.8	Very high	96.1	Very high	33 Å²	33	75.1 Å²	75.1	34%	0.34	44%	0.435	S	S	.	.			trans	-76.7	161.4	178.1	0	0	0	0	0	113	Q35	G32-Q35 VanDerWaalsContact O-CB 3.22Å; G32-Q35 WeakPolarHBondContact O-CB 3.46Å; G32-Q35 WeakPolarHBondContact O-CG 3.41Å; G32-Q35 PolarHBondContact O-N 3.18Å
33	L	98	Very high	96.8	Very high	113 Å²	113	74.3 Å²	74.3	59%	0.592	43%	0.426	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.1	148	171.9	-63.6	178.9	0	0	0	111.3	Q35 P100	L33-Q35 PolarHBondContact O-N 3Å; L33-P100 HydrophobicContact CD1-CG 4.46Å; L33-P100 HydrophobicContact CD2-CG 4.07Å
34	R	98.2	Very high	96.7	Very high	191 Å²	191	74.4 Å²	74.4	72%	0.721	43%	0.427	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.3	-4	-176.1	-52.1	-59.8	-178.2	173.8	-1.2	115.6	L98	R34-L98 PolarHBondContact N-O 2.63Å
35	Q	98.6	Very high	96.3	Very high	100 Å²	100	72.4 Å²	72.4	47%	0.467	42%	0.417	S	S	.	.	S	Bend	trans	-80	174.9	172.9	-57.8	-174.4	-11.3	0	0	111.4	G32 L33 G97 L98	G32-Q35 VanDerWaalsContact O-CB 3.22Å; G32-Q35 WeakPolarHBondContact O-CB 3.46Å; G32-Q35 WeakPolarHBondContact O-CG 3.41Å; G32-Q35 PolarHBondContact O-N 3.18Å; L33-Q35 PolarHBondContact O-N 3Å; Q35-G97 PolarHBondContact O-N 3.23Å; Q35-L98 WeakPolarHBondContact O-CG 2.93Å; Q35-L98 PolarHBondContact O-N 3.25Å
36	T	98.7	Very high	95.8	Very high	72 Å²	72	72.1 Å²	72.1	44%	0.442	42%	0.418	S	S	.	.			trans	-102.6	124.9	172.9	-60.3	0	0	0	0	109.8	T94 I95 T96	T36-T94 HydrophobicContact CG2-CG2 3.46Å; T36-T94 VanDerWaalsContact CG2-CG2 3.46Å; T36-I95 CarbonylContact C-O 3.57Å; T36-I95 VanDerWaalsContact CA-O 3.26Å; T36-I95 WeakPolarHBondContact CA-O 2.91Å; T36-T96 HydrophobicContact CG2-CG2 4.07Å
37	A	98.4	Very high	95.2	Very high	7 Å²	7	69.8 Å²	69.8	6%	0.058	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.1	146.2	167	0	0	0	0	0	110.3	V29 K31 T94 I95 L98	V29-A37 HydrophobicContact CG1-CB 4.37Å; K31-A37 HydrophobicContact CB-CB 4.32Å; K31-A37 HydrophobicContact CG-CB 3.87Å; A37-T94 CarbonylContact O-C 3.54Å; A37-T94 WeakPolarHBondContact O-CA 3.05Å; A37-I95 PolarHBondContact N-O 3.47Å; A37-I95 PolarHBondContact O-N 2.88Å; A37-L98 HydrophobicContact CB-CD1 3.87Å; A37-L98 HydrophobicContact CB-CD2 4.38Å; A37-L98 HydrophobicContact CB-CG 4.41Å
38	T	98.5	Very high	94.8	Very high	66 Å²	66	63.2 Å²	63.2	41%	0.405	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.2	117.8	170.7	-61.8	0	0	0	0	108.1	T40 L93 T94	T38-T40 HydrophobicContact CG2-CG2 4.39Å; T38-L93 CarbonylContact C-O 3.59Å; T38-L93 WeakPolarHBondContact CA-O 3.22Å; T38-T94 PolarHBondContact OG1-OG1 3.1Å
39	L	98.3	Very high	94.2	Very high	23 Å²	23	59.5 Å²	59.5	12%	0.12	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.9	145.2	169.7	-57.6	94.9	0	0	0	108.5	W55 S92 L93 I95 Y106	L39-W55 HydrophobicContact CB-CH2 3.94Å; L39-W55 HydrophobicContact CB-CZ3 3.92Å; L39-S92 CarbonylContact O-C 3.57Å; L39-S92 WeakPolarHBondContact O-CA 3.35Å; L39-L93 HydrophobicContact CB-CB 4.44Å; L39-L93 HydrophobicContact CD1-CB 4.41Å; L39-L93 HydrophobicContact CD1-CD2 4.21Å; L39-L93 HydrophobicContact CD1-CG 4.42Å; L39-L93 PolarHBondContact N-O 2.85Å; L39-L93 PolarHBondContact O-N 2.74Å; L39-I95 HydrophobicContact CD1-CD1 3.72Å; L39-I95 HydrophobicContact CD1-CG1 4.19Å; L39-Y106 VanDerWaalsContact CD2-CB 3.49Å; L39-Y106 HydrophobicContact CD2-CD1 4.35Å; L39-Y106 HydrophobicContact CD2-CD2 3.95Å; L39-Y106 HydrophobicContact CD2-CG 3.68Å
40	T	97.8	Very high	93.5	Very high	51 Å²	51	60.9 Å²	60.9	31%	0.313	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126	147.9	179.5	56.8	0	0	0	0	110.8	P26 T38 A91	P26-T40 VanDerWaalsContact CD-O 3.22Å; P26-T40 WeakPolarHBondContact CD-O 3.42Å; T38-T40 HydrophobicContact CG2-CG2 4.39Å; T40-A91 CarbonylContact C-O 3.53Å; T40-A91 WeakPolarHBondContact CA-O 3.3Å
41	C	95.6	Very high	92.7	Very high	0 Å²	0	59 Å²	59	0%	0	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.9	118.1	179.6	172	0	0	0	0	108.7	T24 W55 T90 A91 C108	T24-C41 WeakPolarHBondContact O-CA 3.46Å; C41-W55 HydrophobicContact CB-CH2 3.59Å; C41-W55 HydrophobicContact CB-CZ2 3.78Å; C41-W55 HydrophobicContact CB-CZ3 4.47Å; C41-T90 CarbonylContact O-C 3.42Å; C41-T90 WeakPolarHBondContact O-CA 3.48Å; C41-A91 PolarHBondContact N-O 2.94Å; C41-A91 PolarHBondContact O-N 3.17Å; C41-C108 HydrophobicContact CB-CB 3.42Å; C41-C108 VanDerWaalsContact CB-CB 3.42Å; C41-C108 WeakPolarHBondContact CB-SG 3.49Å; C41-C108 WeakPolarHBondContact SG-CB 3.46Å; C41-C108 CovalentContact SG-SG 2.02Å; C41-C108 PolarHBondContact SG-SG 3.15Å
42	T	95.4	Very high	92.3	Very high	60 Å²	60	53.5 Å²	53.5	37%	0.368	30%	0.298	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	129.8	-179.1	-60.2	0	0	0	0	109.8	T24 N89 T90	T24-T42 PolarHBondContact N-O 2.83Å; T24-T42 PolarHBondContact O-N 3.43Å; T42-N89 WeakPolarHBondContact CA-O 3.19Å; T42-T90 PolarHBondContact OG1-OG1 2.99Å; T42-T90 VanDerWaalsContact OG1-OG1 3.08Å
43	G	92.2	Very high	92.1	Very high	16 Å²	16	52 Å²	52	17%	0.165	28%	0.283	C	S	.	.			trans	-124.8	-165.1	171.7	0	0	0	0	0	111.5	N89	G43-N89 PolarHBondContact N-O 2.81Å; G43-N89 VanDerWaalsContact O-CB 3.25Å; G43-N89 WeakPolarHBondContact O-CB 3.34Å
44	N	89.9	Confident	92	Very high	55 Å²	55	47.6 Å²	47.6	29%	0.294	26%	0.263	S	S	.	.			trans	-88.7	178.8	168.3	70.3	33.2	0	0	0	111.2	N46 I47 V48 G49	N44-N46 VanDerWaalsContact C-N 3.34Å; N44-N46 PolarHBondContact O-N 3.19Å; N44-N46 WeakPolarHBondContact OD1-CA 3.39Å; N44-N46 PolarHBondContact OD1-N 3.28Å; N44-I47 WeakPolarHBondContact ND2-CD1 3.3Å; N44-I47 PolarHBondContact O-N 2.82Å; N44-I47 WeakPolarHBondContact OD1-CB 3.3Å; N44-I47 VanDerWaalsContact OD1-CG1 3.28Å; N44-I47 WeakPolarHBondContact OD1-CG1 3.21Å; N44-I47 PolarHBondContact OD1-N 3.42Å; N44-V48 PolarHBondContact O-N 2.74Å; N44-V48 VanDerWaalsContact O-N 3.1Å; N44-G49 PolarHBondContact O-N 3.28Å
45	S	87.3	Confident	92	Very high	64 Å²	64	38.6 Å²	38.6	45%	0.448	23%	0.229	S	C	.	.	I	π-helix	trans	-65	-33.1	179.2	54.1	0	0	0	0	113.8	I47 G49 N50 N89	S45-I47 VanDerWaalsContact C-N 3.33Å; S45-G49 CarbonylContact O-C 3.54Å; S45-G49 WeakPolarHBondContact O-CA 3.45Å; S45-G49 PolarHBondContact O-N 3.02Å; S45-N50 WeakPolarHBondContact O-CB 3.35Å; S45-N50 PolarHBondContact O-N 2.89Å; S45-N89 WeakPolarHBondContact CA-OD1 3.34Å
46	N	84.5	Confident	92	Very high	71 Å²	71	36 Å²	36	38%	0.38	22%	0.218	S	C	.	.	I	π-helix	trans	-77.7	-22.8	-176.7	-60.3	-21.7	0	0	0	112.5	N44 S113	N44-N46 VanDerWaalsContact C-N 3.34Å; N44-N46 PolarHBondContact O-N 3.19Å; N44-N46 WeakPolarHBondContact OD1-CA 3.39Å; N44-N46 PolarHBondContact OD1-N 3.28Å; N46-S113 PolarHBondContact O-N 3.44Å; N46-S113 PolarHBondContact O-OG 3.41Å
47	I	85.4	Confident	92	Very high	7 Å²	7	33.1 Å²	33.1	4%	0.036	20%	0.199	C	C	.	.	I	π-helix	trans	-95.9	-83.4	179.6	-61.5	170.2	0	0	0	109.4	L23 N44 S45 Q51 A110 L111 D112	L23-I47 HydrophobicContact CD2-CG2 3.84Å; N44-I47 WeakPolarHBondContact ND2-CD1 3.3Å; N44-I47 PolarHBondContact O-N 2.82Å; N44-I47 WeakPolarHBondContact OD1-CB 3.3Å; N44-I47 VanDerWaalsContact OD1-CG1 3.28Å; N44-I47 WeakPolarHBondContact OD1-CG1 3.21Å; N44-I47 PolarHBondContact OD1-N 3.42Å; S45-I47 VanDerWaalsContact C-N 3.33Å; I47-Q51 WeakPolarHBondContact O-CB 3.47Å; I47-Q51 PolarHBondContact O-N 3.38Å; I47-A110 HydrophobicContact CG2-CB 3.23Å; I47-L111 WeakPolarHBondContact CA-O 3.47Å; I47-D112 HydrophobicContact CD1-CB 4.29Å; I47-D112 HydrophobicContact CG1-CB 3.72Å
48	V	86	Confident	92	Very high	0 Å²	0	35.3 Å²	35.3	0%	0	21%	0.208	C	C	.	.	I	π-helix	trans	-76.5	-42.5	-173.9	176.7	0	0	0	0	111	L23 N44 N50 G52 R86 N89 A91 A110	L23-V48 HydrophobicContact CD2-CG2 3.44Å; L23-V48 VanDerWaalsContact CD2-CG2 3.44Å; N44-V48 PolarHBondContact O-N 2.74Å; N44-V48 VanDerWaalsContact O-N 3.1Å; V48-N50 VanDerWaalsContact C-N 3.31Å; V48-N50 PolarHBondContact O-N 3.43Å; V48-G52 WeakPolarHBondContact O-CA 3.26Å; V48-G52 PolarHBondContact O-N 2.69Å; V48-R86 HydrophobicContact CG1-CG 4.32Å; V48-R86 WeakPolarHBondContact O-CD 3.45Å; V48-R86 PolarHBondContact O-NH1 3.31Å; V48-N89 WeakPolarHBondContact CB-O 3.32Å; V48-N89 WeakPolarHBondContact CG1-O 3.37Å; V48-A91 HydrophobicContact CG1-CB 3.94Å; V48-A110 HydrophobicContact CG2-CB 4.27Å
49	G	84.7	Confident	92	Very high	22 Å²	22	35 Å²	35	23%	0.227	20%	0.202	C	C	.	.	I	π-helix	trans	-59.6	-39.1	-174.5	0	0	0	0	0	113.6	N44 S45 R86	N44-G49 PolarHBondContact O-N 3.28Å; S45-G49 CarbonylContact O-C 3.54Å; S45-G49 WeakPolarHBondContact O-CA 3.45Å; S45-G49 PolarHBondContact O-N 3.02Å; G49-R86 PolarHBondContact O-NH1 2.02Å
50	N	83.5	Confident	91.8	Very high	96 Å²	96	43 Å²	43	51%	0.513	24%	0.239	S	C	.	.	H	α-helix	trans	-89.4	-57.1	179.9	-166.6	14.5	0	0	0	112	S45 V48 R86 S113	S45-N50 WeakPolarHBondContact O-CB 3.35Å; S45-N50 PolarHBondContact O-N 2.89Å; V48-N50 VanDerWaalsContact C-N 3.31Å; V48-N50 PolarHBondContact O-N 3.43Å; N50-R86 PolarHBondContact O-NH1 2.97Å; N50-S113 PolarHBondContact ND2-OG 3.48Å
51	Q	81.2	Confident	91.7	Very high	74 Å²	74	44.5 Å²	44.5	35%	0.346	27%	0.265	S	S	.	.	H	α-helix	trans	-89.1	-22.7	-170.1	-59.9	-58.5	-41.4	0	0	114.4	I47	I47-Q51 WeakPolarHBondContact O-CB 3.47Å; I47-Q51 PolarHBondContact O-N 3.38Å
52	G	88.6	Confident	91.8	Very high	3 Å²	3	50.2 Å²	50.2	3%	0.031	29%	0.291	C	S	.	.			trans	79.5	-175.7	-169.2	0	0	0	0	0	111.2	V48 A110	V48-G52 WeakPolarHBondContact O-CA 3.26Å; V48-G52 PolarHBondContact O-N 2.69Å; G52-A110 WeakPolarHBondContact O-CB 3.28Å
53	A	93.9	Very high	91.9	Very high	1 Å²	1	52.3 Å²	52.3	1%	0.008	31%	0.306	C	S	.	.			trans	-109.1	153.9	175.9	0	0	0	0	0	111.3	N71 A91 C108 S109	A53-N71 PolarHBondContact O-N 3.01Å; A53-N71 VanDerWaalsContact O-N 3.14Å; A53-A91 HydrophobicContact CB-CB 3.47Å; A53-A91 VanDerWaalsContact CB-CB 3.47Å; A53-C108 VanDerWaalsContact CB-SG 3.53Å; A53-S109 CarbonylContact C-O 3.57Å; A53-S109 VanDerWaalsContact CA-O 3.3Å; A53-S109 WeakPolarHBondContact CA-O 3.33Å
54	A	96.3	Very high	92.2	Very high	21 Å²	21	55 Å²	55	17%	0.174	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.4	144.7	155.7	0	0	0	0	0	109.1	L66 S68 S109	A54-L66 HydrophobicContact CB-CD1 4.11Å; A54-S68 CarbonylContact C-O 3.57Å; A54-S68 WeakPolarHBondContact CA-O 3.49Å; A54-S68 WeakPolarHBondContact CB-O 3.5Å; A54-S109 PolarHBondContact N-O 3.1Å; A54-S109 PolarHBondContact O-N 3.49Å
55	W	98	Very high	92.6	Very high	2 Å²	2	57.5 Å²	57.5	1%	0.008	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.5	128.9	176.7	-70.5	97.5	0	0	0	109.9	L39 C41 L67 S68 A91 L93 C108	L39-W55 HydrophobicContact CB-CH2 3.94Å; L39-W55 HydrophobicContact CB-CZ3 3.92Å; C41-W55 HydrophobicContact CB-CH2 3.59Å; C41-W55 HydrophobicContact CB-CZ2 3.78Å; C41-W55 HydrophobicContact CB-CZ3 4.47Å; W55-L67 HydrophobicContact CB-CB 4.39Å; W55-L67 WeakPolarHBondContact O-CB 3.3Å; W55-L67 PolarHBondContact O-N 3.26Å; W55-S68 VanDerWaalsContact CD1-OG 3.31Å; W55-S68 PolarHBondContact N-O 2.93Å; W55-S68 PolarHBondContact O-N 2.92Å; W55-A91 HydrophobicContact CZ2-CB 4.35Å; W55-L93 HydrophobicContact CB-CD1 4.38Å; W55-L93 HydrophobicContact CB-CD2 4.05Å; W55-L93 HydrophobicContact CD2-CB 3.52Å; W55-L93 HydrophobicContact CD2-CD2 4.16Å; W55-L93 HydrophobicContact CD2-CG 4.36Å; W55-L93 HydrophobicContact CE3-CB 3.92Å; W55-L93 HydrophobicContact CE3-CD2 4.13Å; W55-L93 HydrophobicContact CG-CB 3.83Å; W55-L93 HydrophobicContact CG-CD1 4.28Å; W55-L93 HydrophobicContact CG-CD2 4.15Å; W55-L93 HydrophobicContact CG-CG 4.32Å; W55-L93 HydrophobicContact CH2-CB 4.32Å; W55-L93 HydrophobicContact CZ2-CB 3.98Å; W55-L93 HydrophobicContact CZ3-CB 4.3Å; W55-C108 HydrophobicContact CE3-CB 4.24Å; W55-C108 HydrophobicContact CH2-CB 4.2Å; W55-C108 HydrophobicContact CZ3-CB 3.98Å
56	L	97.9	Very high	93.1	Very high	46 Å²	46	57.6 Å²	57.6	24%	0.241	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	141.1	178.8	-61.5	131.8	0	0	0	109.2	P64 K65 L66 Y106 Y107	L56-P64 HydrophobicContact CB-CB 4.43Å; L56-P64 HydrophobicContact CD2-CB 4.09Å; L56-K65 CarbonylContact C-O 3.57Å; L56-K65 VanDerWaalsContact CA-O 3.32Å; L56-K65 WeakPolarHBondContact CA-O 3.45Å; L56-L66 HydrophobicContact CD2-CD1 4.24Å; L56-L66 HydrophobicContact CG-CD1 4.4Å; L56-Y106 WeakPolarHBondContact O-CA 3.41Å; L56-Y107 PolarHBondContact N-O 3.14Å; L56-Y107 PolarHBondContact O-N 2.79Å
57	Q	98.4	Very high	93.7	Very high	11 Å²	11	54.3 Å²	54.3	5%	0.051	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.3	135	171.3	-177.6	-173.2	40.8	0	0	108.8	P64 K65 L67 A104 D105 Y106	Q57-P64 CarbonylContact O-C 3.5Å; Q57-P64 WeakPolarHBondContact O-CA 3.32Å; Q57-K65 PolarHBondContact N-O 2.78Å; Q57-K65 PolarHBondContact O-N 2.86Å; Q57-L67 HydrophobicContact CB-CD1 3.8Å; Q57-L67 HydrophobicContact CB-CD2 4.08Å; Q57-L67 HydrophobicContact CB-CG 3.91Å; Q57-A104 HydrophobicContact CG-CB 3.58Å; Q57-D105 CarbonylContact C-O 3.6Å; Q57-Y106 HydrophobicContact CB-CD1 4.25Å; Q57-Y106 HydrophobicContact CB-CE1 4Å; Q57-Y106 HydrophobicContact CG-CD1 4.41Å; Q57-Y106 HydrophobicContact CG-CE1 3.86Å; Q57-Y106 PolarHBondContact NE2-OH 2.9Å
58	Q	98.4	Very high	94.3	Very high	52 Å²	52	54.2 Å²	54.2	24%	0.243	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134	117	176.9	-172.2	174.4	8	0	0	110.7	H62 P64 A104 D105 Y107	Q58-H62 WeakPolarHBondContact CG-O 3.32Å; Q58-H62 PolarHBondContact NE2-O 2.87Å; Q58-P64 HydrophobicContact CB-CB 4.49Å; Q58-P64 HydrophobicContact CB-CG 4.46Å; Q58-P64 HydrophobicContact CG-CG 4.3Å; Q58-A104 WeakPolarHBondContact O-CB 3.22Å; Q58-D105 HydrophobicContact CB-CB 4.44Å; Q58-D105 PolarHBondContact N-O 2.88Å; Q58-D105 PolarHBondContact O-N 2.82Å; Q58-Y107 HydrophobicContact CB-CD2 4.42Å; Q58-Y107 HydrophobicContact CB-CE2 3.87Å; Q58-Y107 VanDerWaalsContact OE1-CE2 3.29Å
59	H	97.9	Very high	94.7	Very high	61 Å²	61	58.7 Å²	58.7	28%	0.282	32%	0.323	S	S	.	.			trans	-80.4	149.7	166.8	-60.3	88.7	0	0	0	110.1	G61 H62 E101 E103	H59-G61 PolarHBondContact O-N 3.37Å; H59-H62 HydrophobicContact CB-CB 4.15Å; H59-H62 WeakPolarHBondContact O-CB 3.23Å; H59-H62 PolarHBondContact O-N 2.95Å; H59-E101 PolarHBondContact NE2-O 3Å; H59-E103 PolarHBondContact CD2-O 3.3Å
60	Q	95	Very high	95	Very high	190 Å²	190	66 Å²	66	89%	0.888	34%	0.344	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.3	125.7	178.6	-171.9	-178.6	16.3	0	0	111.1	H62	Q60-H62 PolarHBondContact O-CD2 2.77Å; Q60-H62 VanDerWaalsContact O-CD2 3.28Å; Q60-H62 PolarHBondContact O-N 3.22Å
61	G	96.5	Very high	95.3	Very high	83 Å²	83	63 Å²	63	86%	0.856	33%	0.328	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.7	1.3	-179.4	0	0	0	0	0	115.4	H59	H59-G61 PolarHBondContact O-N 3.37Å
62	H	97.4	Very high	95.9	Very high	119 Å²	119	64 Å²	64	55%	0.551	34%	0.336	S	S	*	.	S	Bend	trans	-108.1	154.2	176	-65.6	-87.7	0	0	0	111.4	Q58 H59 Q60	Q58-H62 WeakPolarHBondContact CG-O 3.32Å; Q58-H62 PolarHBondContact NE2-O 2.87Å; H59-H62 HydrophobicContact CB-CB 4.15Å; H59-H62 WeakPolarHBondContact O-CB 3.23Å; H59-H62 PolarHBondContact O-N 2.95Å; Q60-H62 PolarHBondContact O-CD2 2.77Å; Q60-H62 VanDerWaalsContact O-CD2 3.28Å; Q60-H62 PolarHBondContact O-N 3.22Å
63	P	97.6	Very high	96.3	Very high	104 Å²	104	66.7 Å²	66.7	68%	0.675	35%	0.35	S	S	*	.			trans	-68.4	151.9	171.6	28.7	-34.5	0	0	0	111.3
64	P	97.4	Very high	96.4	Very high	72 Å²	72	71.5 Å²	71.5	47%	0.468	37%	0.367	S	S	.	.			trans	-59.9	138.4	174.6	-22.9	32.7	0	0	0	112.8	L56 Q57 Q58	L56-P64 HydrophobicContact CB-CB 4.43Å; L56-P64 HydrophobicContact CD2-CB 4.09Å; Q57-P64 CarbonylContact O-C 3.5Å; Q57-P64 WeakPolarHBondContact O-CA 3.32Å; Q58-P64 HydrophobicContact CB-CB 4.49Å; Q58-P64 HydrophobicContact CB-CG 4.46Å; Q58-P64 HydrophobicContact CG-CG 4.3Å
65	K	97.8	Very high	96.5	Very high	108 Å²	108	72.1 Å²	72.1	47%	0.47	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	130.6	175.6	-177.3	177.2	177.9	-176	0	110.2	L56 Q57 L67 I78	L56-K65 CarbonylContact C-O 3.57Å; L56-K65 VanDerWaalsContact CA-O 3.32Å; L56-K65 WeakPolarHBondContact CA-O 3.45Å; Q57-K65 PolarHBondContact N-O 2.78Å; Q57-K65 PolarHBondContact O-N 2.86Å; K65-L67 PolarHBondContact O-N 3.14Å; K65-I78 HydrophobicContact CD-CD1 4.33Å; K65-I78 HydrophobicContact CG-CD1 4.39Å
66	L	98	Very high	96.4	Very high	66 Å²	66	78.1 Å²	78.1	35%	0.346	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.2	119.6	177.5	-173.7	67.3	0	0	0	110.8	A54 L56 S68 Y69 P75 I78	A54-L66 HydrophobicContact CB-CD1 4.11Å; L56-L66 HydrophobicContact CD2-CD1 4.24Å; L56-L66 HydrophobicContact CG-CD1 4.4Å; L66-S68 VanDerWaalsContact CD1-O 3.25Å; L66-S68 WeakPolarHBondContact CD1-O 3.14Å; L66-Y69 HydrophobicContact CD2-CD1 4.08Å; L66-Y69 HydrophobicContact CD2-CG 4.41Å; L66-P75 HydrophobicContact CB-CG 4.47Å; L66-P75 HydrophobicContact CD2-CG 3.91Å; L66-P75 HydrophobicContact CG-CG 4.05Å; L66-I78 WeakPolarHBondContact O-CD1 3.32Å
67	L	98.4	Very high	96.4	Very high	2 Å²	2	79.4 Å²	79.4	1%	0.01	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	-39.6	176	-62.5	-177.6	0	0	0	112.3	W55 Q57 K65 P75 I78 F82 L93 Y106	W55-L67 HydrophobicContact CB-CB 4.39Å; W55-L67 WeakPolarHBondContact O-CB 3.3Å; W55-L67 PolarHBondContact O-N 3.26Å; Q57-L67 HydrophobicContact CB-CD1 3.8Å; Q57-L67 HydrophobicContact CB-CD2 4.08Å; Q57-L67 HydrophobicContact CB-CG 3.91Å; K65-L67 PolarHBondContact O-N 3.14Å; L67-P75 WeakPolarHBondContact O-CD 3.49Å; L67-I78 HydrophobicContact CD2-CD1 4.33Å; L67-I78 HydrophobicContact CD2-CG2 4.14Å; L67-F82 HydrophobicContact CD1-CD1 3.65Å; L67-F82 HydrophobicContact CD1-CE1 3.8Å; L67-F82 HydrophobicContact CD1-CG 4.41Å; L67-F82 HydrophobicContact CD2-CD1 4.32Å; L67-F82 HydrophobicContact CD2-CE1 4.36Å; L67-F82 HydrophobicContact CD2-CG 4.43Å; L67-F82 HydrophobicContact CD2-CZ 4.5Å; L67-L93 HydrophobicContact CD1-CD2 3.66Å; L67-Y106 HydrophobicContact CD1-CD1 4.08Å; L67-Y106 HydrophobicContact CD1-CE1 3.76Å
68	S	97.6	Very high	96.4	Very high	5 Å²	5	79.8 Å²	79.8	4%	0.035	44%	0.439	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.2	159	176.5	61.6	0	0	0	0	111.5	A54 W55 L66 N73 A84	A54-S68 CarbonylContact C-O 3.57Å; A54-S68 WeakPolarHBondContact CA-O 3.49Å; A54-S68 WeakPolarHBondContact CB-O 3.5Å; W55-S68 VanDerWaalsContact CD1-OG 3.31Å; W55-S68 PolarHBondContact N-O 2.93Å; W55-S68 PolarHBondContact O-N 2.92Å; L66-S68 VanDerWaalsContact CD1-O 3.25Å; L66-S68 WeakPolarHBondContact CD1-O 3.14Å; S68-N73 CarbonylContact C-O 3.48Å; S68-N73 WeakPolarHBondContact CA-O 3.47Å; S68-N73 WeakPolarHBondContact CB-O 3.33Å; S68-A84 WeakPolarHBondContact OG-CB 3.31Å
69	Y	95	Very high	96.3	Very high	94 Å²	94	79.7 Å²	79.7	37%	0.369	44%	0.444	S	S	.	.	B	Isolated β-bridge	trans	-144.7	163	177.9	65.9	-76.1	0	0	0	110.9	L66 N71 N73 P75	L66-Y69 HydrophobicContact CD2-CD1 4.08Å; L66-Y69 HydrophobicContact CD2-CG 4.41Å; Y69-N71 VanDerWaalsContact C-N 3.28Å; Y69-N71 PolarHBondContact O-N 2.9Å; Y69-N73 HydrophobicContact CD1-CB 3.83Å; Y69-N73 VanDerWaalsContact CD1-O 3.23Å; Y69-N73 WeakPolarHBondContact CD1-O 3.32Å; Y69-N73 HydrophobicContact CD2-CB 4.11Å; Y69-N73 HydrophobicContact CE1-CB 3.49Å; Y69-N73 VanDerWaalsContact CE1-CB 3.49Å; Y69-N73 HydrophobicContact CE2-CB 3.81Å; Y69-N73 HydrophobicContact CG-CB 4.12Å; Y69-N73 VanDerWaalsContact CZ-CB 3.48Å; Y69-N73 PolarHBondContact N-O 2.84Å; Y69-N73 VanDerWaalsContact O-CB 3.3Å; Y69-N73 WeakPolarHBondContact O-CB 3.36Å; Y69-N73 PolarHBondContact O-N 2.9Å; Y69-P75 HydrophobicContact CD1-CG 4.09Å; Y69-P75 HydrophobicContact CE1-CG 4.12Å
70	R	90.3	Very high	96.3	Very high	177 Å²	177	84.1 Å²	84.1	67%	0.668	47%	0.465	S	S	*	.	T	Hydrogen-bonded Turn	trans	45.4	53.6	-178.7	-67.1	-180	72.1	-170.6	1.6	111.8	N72	R70-N72 PolarHBondContact O-N 3.07Å; R70-N72 VanDerWaalsContact O-N 3.11Å
71	N	90.3	Very high	96.5	Very high	31 Å²	31	76.8 Å²	76.8	17%	0.166	43%	0.429	C	S	.	.	T	Hydrogen-bonded Turn	trans	76.2	-66.4	-176.1	179.4	38.8	0	0	0	115.4	A53 Y69 A84 R86	A53-N71 PolarHBondContact O-N 3.01Å; A53-N71 VanDerWaalsContact O-N 3.14Å; Y69-N71 VanDerWaalsContact C-N 3.28Å; Y69-N71 PolarHBondContact O-N 2.9Å; N71-A84 WeakPolarHBondContact O-CB 3.22Å; N71-R86 WeakPolarHBondContact OD1-CB 3.07Å; N71-R86 PolarHBondContact OD1-N 3.11Å; N71-R86 VanDerWaalsContact OD1-N 3.07Å
72	N	93.9	Very high	96.5	Very high	96 Å²	96	73.5 Å²	73.5	51%	0.513	39%	0.391	S	S	.	.	T	Hydrogen-bonded Turn	trans	-137.2	6.3	-170	67.6	-3.7	0	0	0	115	R70 R74 A84	R70-N72 PolarHBondContact O-N 3.07Å; R70-N72 VanDerWaalsContact O-N 3.11Å; N72-R74 PolarHBondContact O-N 2.92Å; N72-A84 VanDerWaalsContact CB-O 3.32Å; N72-A84 WeakPolarHBondContact CB-O 3.27Å
73	N	95.8	Very high	96.6	Very high	60 Å²	60	70.9 Å²	70.9	32%	0.321	39%	0.386	S	S	.	.	B	Isolated β-bridge	trans	-71.2	122.3	176.2	-66.9	16.1	0	0	0	109.1	S68 Y69	S68-N73 CarbonylContact C-O 3.48Å; S68-N73 WeakPolarHBondContact CA-O 3.47Å; S68-N73 WeakPolarHBondContact CB-O 3.33Å; Y69-N73 HydrophobicContact CD1-CB 3.83Å; Y69-N73 VanDerWaalsContact CD1-O 3.23Å; Y69-N73 WeakPolarHBondContact CD1-O 3.32Å; Y69-N73 HydrophobicContact CD2-CB 4.11Å; Y69-N73 HydrophobicContact CE1-CB 3.49Å; Y69-N73 VanDerWaalsContact CE1-CB 3.49Å; Y69-N73 HydrophobicContact CE2-CB 3.81Å; Y69-N73 HydrophobicContact CG-CB 4.12Å; Y69-N73 VanDerWaalsContact CZ-CB 3.48Å; Y69-N73 PolarHBondContact N-O 2.84Å; Y69-N73 VanDerWaalsContact O-CB 3.3Å; Y69-N73 WeakPolarHBondContact O-CB 3.36Å; Y69-N73 PolarHBondContact O-N 2.9Å
74	R	96.9	Very high	96.6	Very high	101 Å²	101	66.5 Å²	66.5	38%	0.381	36%	0.358	S	S	.	.	P	Polyproline II helix	trans	-102	121	179.6	-177.1	167.6	63.6	-131.7	-0.1	110	N72 I78 E80 F82	N72-R74 PolarHBondContact O-N 2.92Å; R74-I78 HydrophobicContact CG-CB 3.65Å; R74-I78 HydrophobicContact CG-CG1 4.4Å; R74-I78 HydrophobicContact CG-CG2 3.89Å; R74-E80 IonicContact NH2-OE1 3.49Å; R74-E80 PolarHBondContact NH2-OE1 2.89Å; R74-F82 PolarHBondContact NH1-O 2.97Å
75	P	97.4	Very high	96.6	Very high	35 Å²	35	65.7 Å²	65.7	23%	0.227	36%	0.355	C	S	.	.	P	Polyproline II helix	trans	-58.7	156.2	172.1	-23.1	33.3	0	0	0	112.7	L66 L67 Y69 I78	L66-P75 HydrophobicContact CB-CG 4.47Å; L66-P75 HydrophobicContact CD2-CG 3.91Å; L66-P75 HydrophobicContact CG-CG 4.05Å; L67-P75 WeakPolarHBondContact O-CD 3.49Å; Y69-P75 HydrophobicContact CD1-CG 4.09Å; Y69-P75 HydrophobicContact CE1-CG 4.12Å; P75-I78 HydrophobicContact CB-CG1 4.06Å; P75-I78 HydrophobicContact CG-CG1 4.36Å; P75-I78 WeakPolarHBondContact O-CG1 3.25Å; P75-I78 PolarHBondContact O-N 2.8Å
76	S	97.3	Very high	96.4	Very high	127 Å²	127	64.9 Å²	64.9	89%	0.888	35%	0.349	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60	142.8	172.7	-55.7	0	0	0	0	111.5	I78	S76-I78 VanDerWaalsContact C-N 3.3Å; S76-I78 PolarHBondContact O-N 2.74Å
77	G	97.1	Very high	96.3	Very high	74 Å²	74	66.5 Å²	66.5	76%	0.763	37%	0.365	S	S	*	.	T	Hydrogen-bonded Turn	trans	80.9	3	-180	0	0	0	0	0	115.2
78	I	97.8	Very high	96.1	Very high	18 Å²	18	69 Å²	69	9%	0.092	39%	0.391	C	S	.	.			trans	-90.6	130.8	169.8	-53.4	-56.8	0	0	0	109.5	K65 L66 L67 R74 P75 S76 F82	K65-I78 HydrophobicContact CD-CD1 4.33Å; K65-I78 HydrophobicContact CG-CD1 4.39Å; L66-I78 WeakPolarHBondContact O-CD1 3.32Å; L67-I78 HydrophobicContact CD2-CD1 4.33Å; L67-I78 HydrophobicContact CD2-CG2 4.14Å; R74-I78 HydrophobicContact CG-CB 3.65Å; R74-I78 HydrophobicContact CG-CG1 4.4Å; R74-I78 HydrophobicContact CG-CG2 3.89Å; P75-I78 HydrophobicContact CB-CG1 4.06Å; P75-I78 HydrophobicContact CG-CG1 4.36Å; P75-I78 WeakPolarHBondContact O-CG1 3.25Å; P75-I78 PolarHBondContact O-N 2.8Å; S76-I78 VanDerWaalsContact C-N 3.3Å; S76-I78 PolarHBondContact O-N 2.74Å; I78-F82 HydrophobicContact CG2-CB 4.23Å; I78-F82 HydrophobicContact CG2-CD2 4.11Å; I78-F82 HydrophobicContact CG2-CG 4.42Å
79	S	97.6	Very high	95.9	Very high	51 Å²	51	72 Å²	72	36%	0.357	41%	0.407	S	S	.	.			trans	-59.6	142.8	-179.7	177.1	0	0	0	0	112.1	R81 F82	S79-R81 PolarHBondContact O-N 2.93Å; S79-R81 VanDerWaalsContact O-N 3.16Å; S79-R81 WeakPolarHBondContact OG-CG 3.46Å; S79-R81 PolarHBondContact OG-N 3.2Å; S79-F82 PolarHBondContact O-N 3.29Å; S79-F82 VanDerWaalsContact O-N 3.13Å
80	E	97.4	Very high	96	Very high	153 Å²	153	69.7 Å²	69.7	72%	0.715	40%	0.403	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.7	-14.4	175.2	-52.9	-160.1	136	0	0	113.2	R74 F82	R74-E80 IonicContact NH2-OE1 3.49Å; R74-E80 PolarHBondContact NH2-OE1 2.89Å; E80-F82 PolarHBondContact O-N 2.87Å
81	R	98	Very high	96.3	Very high	36 Å²	36	61.2 Å²	61.2	14%	0.136	37%	0.371	C	S	.	.	T	Hydrogen-bonded Turn	trans	-56.6	-29.5	171.2	-67.2	-167.9	-47.6	95.8	0.6	112.1	S79 I95 T96 G97 D102	S79-R81 PolarHBondContact O-N 2.93Å; S79-R81 VanDerWaalsContact O-N 3.16Å; S79-R81 WeakPolarHBondContact OG-CG 3.46Å; S79-R81 PolarHBondContact OG-N 3.2Å; R81-I95 WeakPolarHBondContact O-CA 3.17Å; R81-T96 WeakPolarHBondContact CA-OG1 3.34Å; R81-T96 WeakPolarHBondContact CB-O 3.22Å; R81-T96 VanDerWaalsContact CD-O 3.3Å; R81-T96 WeakPolarHBondContact CD-O 3.35Å; R81-T96 WeakPolarHBondContact CG-O 3.44Å; R81-T96 PolarHBondContact NH1-O 2.83Å; R81-T96 PolarHBondContact O-N 3.48Å; R81-T96 PolarHBondContact O-OG1 2.89Å; R81-G97 PolarHBondContact NH1-O 2.96Å; R81-D102 IonicContact CZ-OD1 3.7Å; R81-D102 IonicContact CZ-OD2 3.26Å; R81-D102 VanDerWaalsContact CZ-OD2 3.26Å; R81-D102 IonicContact NH1-OD1 3.73Å; R81-D102 IonicContact NH1-OD2 2.7Å; R81-D102 PolarHBondContact NH1-OD2 3.3Å; R81-D102 VanDerWaalsContact NH2-CG 3.27Å; R81-D102 IonicContact NH2-OD1 2.77Å; R81-D102 PolarHBondContact NH2-OD1 3.12Å; R81-D102 IonicContact NH2-OD2 2.98Å; R81-D102 PolarHBondContact NH2-OD2 2.99Å
82	F	98.4	Very high	96.6	Very high	15 Å²	15	60.8 Å²	60.8	7%	0.066	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.1	120.4	174.7	-60.2	-86.5	0	0	0	110.5	L67 R74 I78 S79 E80 L93 I95 D102 Y106	L67-F82 HydrophobicContact CD1-CD1 3.65Å; L67-F82 HydrophobicContact CD1-CE1 3.8Å; L67-F82 HydrophobicContact CD1-CG 4.41Å; L67-F82 HydrophobicContact CD2-CD1 4.32Å; L67-F82 HydrophobicContact CD2-CE1 4.36Å; L67-F82 HydrophobicContact CD2-CG 4.43Å; L67-F82 HydrophobicContact CD2-CZ 4.5Å; R74-F82 PolarHBondContact NH1-O 2.97Å; I78-F82 HydrophobicContact CG2-CB 4.23Å; I78-F82 HydrophobicContact CG2-CD2 4.11Å; I78-F82 HydrophobicContact CG2-CG 4.42Å; S79-F82 PolarHBondContact O-N 3.29Å; S79-F82 VanDerWaalsContact O-N 3.13Å; E80-F82 PolarHBondContact O-N 2.87Å; F82-L93 HydrophobicContact CB-CD1 4.41Å; F82-I95 HydrophobicContact CD1-CB 4.48Å; F82-I95 HydrophobicContact CD1-CD1 4.16Å; F82-I95 HydrophobicContact CD1-CG1 3.73Å; F82-I95 HydrophobicContact CD1-CG2 4.22Å; F82-I95 HydrophobicContact CE1-CB 4.48Å; F82-I95 HydrophobicContact CE1-CD1 3.78Å; F82-I95 HydrophobicContact CE1-CG1 3.81Å; F82-I95 HydrophobicContact CE1-CG2 3.92Å; F82-I95 HydrophobicContact CZ-CG2 4.35Å; F82-D102 VanDerWaalsContact CZ-OD1 3.3Å; F82-D102 WeakPolarHBondContact CZ-OD1 3.34Å; F82-Y106 HydrophobicContact CE1-CE1 4.29Å
83	S	97.9	Very high	96.9	Very high	64 Å²	64	56.3 Å²	56.3	45%	0.448	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	124.5	175.5	-177.6	0	0	0	0	110.2	T94	S83-T94 PolarHBondContact N-O 2.97Å; S83-T94 PolarHBondContact O-N 2.9Å
84	A	97.9	Very high	97	Very high	11 Å²	11	55 Å²	55	9%	0.091	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	146.9	176.3	0	0	0	0	0	111.4	S68 N71 N72 S92 L93	S68-A84 WeakPolarHBondContact OG-CB 3.31Å; N71-A84 WeakPolarHBondContact O-CB 3.22Å; N72-A84 VanDerWaalsContact CB-O 3.32Å; N72-A84 WeakPolarHBondContact CB-O 3.27Å; A84-S92 CarbonylContact C-O 3.58Å; A84-S92 VanDerWaalsContact CA-O 3.27Å; A84-S92 WeakPolarHBondContact CA-O 3.38Å; A84-L93 HydrophobicContact CB-CD1 4.28Å
85	S	96.8	Very high	97.1	Very high	55 Å²	55	50.4 Å²	50.4	39%	0.385	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.6	167.8	-179.8	66.8	0	0	0	0	111.3	A91 S92	S85-A91 CarbonylContact O-C 3.57Å; S85-A91 WeakPolarHBondContact O-CA 3.04Å; S85-S92 PolarHBondContact N-O 3.48Å; S85-S92 PolarHBondContact O-N 3.34Å
86	R	94.7	Very high	97.1	Very high	91 Å²	91	51.6 Å²	51.6	34%	0.343	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.2	138	177.2	176.3	-177.4	69.9	-174.6	5.5	110.4	V48 G49 N50 N71 T90	V48-R86 HydrophobicContact CG1-CG 4.32Å; V48-R86 WeakPolarHBondContact O-CD 3.45Å; V48-R86 PolarHBondContact O-NH1 3.31Å; G49-R86 PolarHBondContact O-NH1 2.02Å; N50-R86 PolarHBondContact O-NH1 2.97Å; N71-R86 WeakPolarHBondContact OD1-CB 3.07Å; N71-R86 PolarHBondContact OD1-N 3.11Å; N71-R86 VanDerWaalsContact OD1-N 3.07Å; R86-T90 WeakPolarHBondContact CA-O 3.35Å
87	S	95.3	Very high	97.2	Very high	100 Å²	100	46.5 Å²	46.5	70%	0.699	30%	0.298	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-132.2	120.9	166.4	-174.8	0	0	0	0	109.3	N89 T90	S87-N89 PolarHBondContact O-N 3.38Å; S87-T90 PolarHBondContact N-O 2.83Å; S87-T90 PolarHBondContact O-N 3.08Å
88	G	94.2	Very high	97.2	Very high	54 Å²	54	43.9 Å²	43.9	56%	0.557	27%	0.266	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.9	-121.8	-173.1	0	0	0	0	0	111.5
89	N	94.5	Very high	97.3	Very high	69 Å²	69	45.6 Å²	45.6	37%	0.369	27%	0.274	S	S	.	.	T	Hydrogen-bonded Turn	trans	-96.7	11.5	-178.8	-54.7	-22.9	0	0	0	113.7	T42 G43 S45 V48 S87	T42-N89 WeakPolarHBondContact CA-O 3.19Å; G43-N89 PolarHBondContact N-O 2.81Å; G43-N89 VanDerWaalsContact O-CB 3.25Å; G43-N89 WeakPolarHBondContact O-CB 3.34Å; S45-N89 WeakPolarHBondContact CA-OD1 3.34Å; V48-N89 WeakPolarHBondContact CB-O 3.32Å; V48-N89 WeakPolarHBondContact CG1-O 3.37Å; S87-N89 PolarHBondContact O-N 3.38Å
90	T	96.1	Very high	97.3	Very high	45 Å²	45	47.5 Å²	47.5	28%	0.276	29%	0.285	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	122.5	179.3	-59.1	0	0	0	0	110	C41 T42 R86 S87	C41-T90 CarbonylContact O-C 3.42Å; C41-T90 WeakPolarHBondContact O-CA 3.48Å; T42-T90 PolarHBondContact OG1-OG1 2.99Å; T42-T90 VanDerWaalsContact OG1-OG1 3.08Å; R86-T90 WeakPolarHBondContact CA-O 3.35Å; S87-T90 PolarHBondContact N-O 2.83Å; S87-T90 PolarHBondContact O-N 3.08Å
91	A	96.5	Very high	97.3	Very high	0 Å²	0	45.1 Å²	45.1	0%	0	27%	0.274	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.7	148	167.1	0	0	0	0	0	109.8	T40 C41 V48 A53 W55 S85	T40-A91 CarbonylContact C-O 3.53Å; T40-A91 WeakPolarHBondContact CA-O 3.3Å; C41-A91 PolarHBondContact N-O 2.94Å; C41-A91 PolarHBondContact O-N 3.17Å; V48-A91 HydrophobicContact CG1-CB 3.94Å; A53-A91 HydrophobicContact CB-CB 3.47Å; A53-A91 VanDerWaalsContact CB-CB 3.47Å; W55-A91 HydrophobicContact CZ2-CB 4.35Å; S85-A91 CarbonylContact O-C 3.57Å; S85-A91 WeakPolarHBondContact O-CA 3.04Å
92	S	98	Very high	97.3	Very high	22 Å²	22	43.9 Å²	43.9	15%	0.154	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	143.6	177.9	-61.1	0	0	0	0	110.2	L39 A84 S85	L39-S92 CarbonylContact O-C 3.57Å; L39-S92 WeakPolarHBondContact O-CA 3.35Å; A84-S92 CarbonylContact C-O 3.58Å; A84-S92 VanDerWaalsContact CA-O 3.27Å; A84-S92 WeakPolarHBondContact CA-O 3.38Å; S85-S92 PolarHBondContact N-O 3.48Å; S85-S92 PolarHBondContact O-N 3.34Å
93	L	98.5	Very high	97.2	Very high	1 Å²	1	51.5 Å²	51.5	1%	0.005	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	115.9	165.7	176.8	70.1	0	0	0	108	T38 L39 W55 L67 F82 A84 I95 Y106	T38-L93 CarbonylContact C-O 3.59Å; T38-L93 WeakPolarHBondContact CA-O 3.22Å; L39-L93 HydrophobicContact CB-CB 4.44Å; L39-L93 HydrophobicContact CD1-CB 4.41Å; L39-L93 HydrophobicContact CD1-CD2 4.21Å; L39-L93 HydrophobicContact CD1-CG 4.42Å; L39-L93 PolarHBondContact N-O 2.85Å; L39-L93 PolarHBondContact O-N 2.74Å; W55-L93 HydrophobicContact CB-CD1 4.38Å; W55-L93 HydrophobicContact CB-CD2 4.05Å; W55-L93 HydrophobicContact CD2-CB 3.52Å; W55-L93 HydrophobicContact CD2-CD2 4.16Å; W55-L93 HydrophobicContact CD2-CG 4.36Å; W55-L93 HydrophobicContact CE3-CB 3.92Å; W55-L93 HydrophobicContact CE3-CD2 4.13Å; W55-L93 HydrophobicContact CG-CB 3.83Å; W55-L93 HydrophobicContact CG-CD1 4.28Å; W55-L93 HydrophobicContact CG-CD2 4.15Å; W55-L93 HydrophobicContact CG-CG 4.32Å; W55-L93 HydrophobicContact CH2-CB 4.32Å; W55-L93 HydrophobicContact CZ2-CB 3.98Å; W55-L93 HydrophobicContact CZ3-CB 4.3Å; L67-L93 HydrophobicContact CD1-CD2 3.66Å; F82-L93 HydrophobicContact CB-CD1 4.41Å; A84-L93 HydrophobicContact CB-CD1 4.28Å; L93-I95 HydrophobicContact CD2-CD1 4.5Å; L93-I95 HydrophobicContact CD2-CG1 4.46Å; L93-I95 HydrophobicContact CG-CG1 4.33Å; L93-Y106 HydrophobicContact CD2-CD1 3.87Å; L93-Y106 HydrophobicContact CD2-CE1 4.11Å
94	T	98.5	Very high	97.2	Very high	34 Å²	34	49.8 Å²	49.8	21%	0.209	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.6	128.3	174.9	-62.1	0	0	0	0	109.5	T36 A37 T38 S83 T96	T36-T94 HydrophobicContact CG2-CG2 3.46Å; T36-T94 VanDerWaalsContact CG2-CG2 3.46Å; A37-T94 CarbonylContact O-C 3.54Å; A37-T94 WeakPolarHBondContact O-CA 3.05Å; T38-T94 PolarHBondContact OG1-OG1 3.1Å; S83-T94 PolarHBondContact N-O 2.97Å; S83-T94 PolarHBondContact O-N 2.9Å; T94-T96 HydrophobicContact CG2-CG2 4.12Å
95	I	98.6	Very high	97.3	Very high	3 Å²	3	53.6 Å²	53.6	2%	0.015	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.2	108.9	176.4	-49.1	173.4	0	0	0	106.8	T36 A37 L39 R81 F82 L93 L98 Y106	T36-I95 CarbonylContact C-O 3.57Å; T36-I95 VanDerWaalsContact CA-O 3.26Å; T36-I95 WeakPolarHBondContact CA-O 2.91Å; A37-I95 PolarHBondContact N-O 3.47Å; A37-I95 PolarHBondContact O-N 2.88Å; L39-I95 HydrophobicContact CD1-CD1 3.72Å; L39-I95 HydrophobicContact CD1-CG1 4.19Å; R81-I95 WeakPolarHBondContact O-CA 3.17Å; F82-I95 HydrophobicContact CD1-CB 4.48Å; F82-I95 HydrophobicContact CD1-CD1 4.16Å; F82-I95 HydrophobicContact CD1-CG1 3.73Å; F82-I95 HydrophobicContact CD1-CG2 4.22Å; F82-I95 HydrophobicContact CE1-CB 4.48Å; F82-I95 HydrophobicContact CE1-CD1 3.78Å; F82-I95 HydrophobicContact CE1-CG1 3.81Å; F82-I95 HydrophobicContact CE1-CG2 3.92Å; F82-I95 HydrophobicContact CZ-CG2 4.35Å; L93-I95 HydrophobicContact CD2-CD1 4.5Å; L93-I95 HydrophobicContact CD2-CG1 4.46Å; L93-I95 HydrophobicContact CG-CG1 4.33Å; I95-L98 HydrophobicContact CB-CD2 4.21Å; I95-L98 HydrophobicContact CG2-CD2 3.79Å; I95-L98 HydrophobicContact CG2-CG 4.48Å; I95-Y106 HydrophobicContact CD1-CE1 3.76Å; I95-Y106 HydrophobicContact CD1-CE2 4.46Å; I95-Y106 WeakPolarHBondContact CD1-OH 3.4Å
96	T	98.5	Very high	97.3	Very high	61 Å²	61	52.2 Å²	52.2	37%	0.374	30%	0.301	S	S	.	.			trans	-91.1	148.7	177.7	58.4	0	0	0	0	110.7	T36 R81 T94 L98	T36-T96 HydrophobicContact CG2-CG2 4.07Å; R81-T96 WeakPolarHBondContact CA-OG1 3.34Å; R81-T96 WeakPolarHBondContact CB-O 3.22Å; R81-T96 VanDerWaalsContact CD-O 3.3Å; R81-T96 WeakPolarHBondContact CD-O 3.35Å; R81-T96 WeakPolarHBondContact CG-O 3.44Å; R81-T96 PolarHBondContact NH1-O 2.83Å; R81-T96 PolarHBondContact O-N 3.48Å; R81-T96 PolarHBondContact O-OG1 2.89Å; T94-T96 HydrophobicContact CG2-CG2 4.12Å; T96-L98 PolarHBondContact O-N 3.29Å
97	G	98.3	Very high	97.4	Very high	20 Å²	20	52.4 Å²	52.4	21%	0.206	30%	0.302	C	S	.	.	S	Bend	trans	58.6	49.5	174.8	0	0	0	0	0	113	Q35 R81 Q99	Q35-G97 PolarHBondContact O-N 3.23Å; R81-G97 PolarHBondContact NH1-O 2.96Å; G97-Q99 WeakPolarHBondContact O-CG 3.45Å; G97-Q99 PolarHBondContact O-N 3.11Å
98	L	98.5	Very high	97.4	Very high	18 Å²	18	48.3 Å²	48.3	9%	0.094	27%	0.274	C	S	.	.			trans	-43	135.4	-176.5	-83.6	168.4	0	0	0	113.5	K31 R34 Q35 A37 I95 T96 D102	K31-L98 HydrophobicContact CB-CD1 3.42Å; K31-L98 VanDerWaalsContact CB-CD1 3.42Å; K31-L98 HydrophobicContact CG-CD1 4.39Å; R34-L98 PolarHBondContact N-O 2.63Å; Q35-L98 WeakPolarHBondContact O-CG 2.93Å; Q35-L98 PolarHBondContact O-N 3.25Å; A37-L98 HydrophobicContact CB-CD1 3.87Å; A37-L98 HydrophobicContact CB-CD2 4.38Å; A37-L98 HydrophobicContact CB-CG 4.41Å; I95-L98 HydrophobicContact CB-CD2 4.21Å; I95-L98 HydrophobicContact CG2-CD2 3.79Å; I95-L98 HydrophobicContact CG2-CG 4.48Å; T96-L98 PolarHBondContact O-N 3.29Å; L98-D102 WeakPolarHBondContact CA-OD2 3.42Å; L98-D102 HydrophobicContact CD2-CB 3.7Å
99	Q	98.4	Very high	97.4	Very high	55 Å²	55	48.6 Å²	48.6	26%	0.257	27%	0.267	S	S	.	.			trans	-119.7	159.2	179.5	-56.1	-179.6	-59.4	0	0	110.1	G97 E101 D102	G97-Q99 WeakPolarHBondContact O-CG 3.45Å; G97-Q99 PolarHBondContact O-N 3.11Å; Q99-E101 HydrophobicContact CB-CG 4.09Å; Q99-E101 WeakPolarHBondContact CB-OE1 3.38Å; Q99-E101 WeakPolarHBondContact CB-OE2 3.42Å; Q99-E101 PolarHBondContact O-N 2.86Å; Q99-E101 PolarHBondContact OE1-OE1 3.19Å; Q99-D102 PolarHBondContact N-OD2 3.01Å; Q99-D102 VanDerWaalsContact O-CB 3.32Å; Q99-D102 WeakPolarHBondContact O-CB 3.22Å; Q99-D102 PolarHBondContact O-N 2.92Å
100	P	97.8	Very high	97.2	Very high	90 Å²	90	46.5 Å²	46.5	58%	0.584	26%	0.259	S	S	*	.	G	3₁₀ helix	trans	-55	-35.6	178.7	-26.6	35.9	0	0	0	113.6	L33 D102 E103	L33-P100 HydrophobicContact CD1-CG 4.46Å; L33-P100 HydrophobicContact CD2-CG 4.07Å; P100-D102 PolarHBondContact O-N 3.46Å; P100-E103 PolarHBondContact O-N 3.22Å
101	E	97.1	Very high	96.8	Very high	104 Å²	104	50.6 Å²	50.6	49%	0.486	28%	0.279	S	S	.	.	G	3₁₀ helix	trans	-68.4	-7.8	176	63.5	-92.3	-149.1	0	0	114.5	H59 Q99 E103	H59-E101 PolarHBondContact NE2-O 3Å; Q99-E101 HydrophobicContact CB-CG 4.09Å; Q99-E101 WeakPolarHBondContact CB-OE1 3.38Å; Q99-E101 WeakPolarHBondContact CB-OE2 3.42Å; Q99-E101 PolarHBondContact O-N 2.86Å; Q99-E101 PolarHBondContact OE1-OE1 3.19Å; E101-E103 VanDerWaalsContact C-N 3.3Å
102	D	98.1	Very high	96.1	Very high	9 Å²	9	52.5 Å²	52.5	5%	0.048	29%	0.289	C	S	.	.	G	3₁₀ helix	trans	-83.1	-8.7	174.9	-61.3	-34	0	0	0	112.6	R81 F82 L98 Q99 P100 A104 Y106	R81-D102 IonicContact CZ-OD1 3.7Å; R81-D102 IonicContact CZ-OD2 3.26Å; R81-D102 VanDerWaalsContact CZ-OD2 3.26Å; R81-D102 IonicContact NH1-OD1 3.73Å; R81-D102 IonicContact NH1-OD2 2.7Å; R81-D102 PolarHBondContact NH1-OD2 3.3Å; R81-D102 VanDerWaalsContact NH2-CG 3.27Å; R81-D102 IonicContact NH2-OD1 2.77Å; R81-D102 PolarHBondContact NH2-OD1 3.12Å; R81-D102 IonicContact NH2-OD2 2.98Å; R81-D102 PolarHBondContact NH2-OD2 2.99Å; F82-D102 VanDerWaalsContact CZ-OD1 3.3Å; F82-D102 WeakPolarHBondContact CZ-OD1 3.34Å; L98-D102 WeakPolarHBondContact CA-OD2 3.42Å; L98-D102 HydrophobicContact CD2-CB 3.7Å; Q99-D102 PolarHBondContact N-OD2 3.01Å; Q99-D102 VanDerWaalsContact O-CB 3.32Å; Q99-D102 WeakPolarHBondContact O-CB 3.22Å; Q99-D102 PolarHBondContact O-N 2.92Å; P100-D102 PolarHBondContact O-N 3.46Å; D102-A104 PolarHBondContact O-N 2.84Å; D102-A104 VanDerWaalsContact O-N 3.14Å; D102-Y106 VanDerWaalsContact O-CE2 3.31Å; D102-Y106 WeakPolarHBondContact O-CE2 3.49Å; D102-Y106 PolarHBondContact O-OH 2.91Å
103	E	97.8	Very high	95.1	Very high	176 Å²	176	54.3 Å²	54.3	82%	0.822	30%	0.302	S	S	*	.			trans	-71.3	103.7	172.4	-171.4	168.9	-178.1	0	0	109.9	H59 P100 E101	H59-E103 PolarHBondContact CD2-O 3.3Å; P100-E103 PolarHBondContact O-N 3.22Å; E101-E103 VanDerWaalsContact C-N 3.3Å
104	A	98.2	Very high	94.2	Very high	28 Å²	28	57.6 Å²	57.6	23%	0.231	33%	0.325	C	S	.	.	S	Bend	trans	-161.7	166.8	-172	0	0	0	0	0	110.5	Q57 Q58 D102 Y106	Q57-A104 HydrophobicContact CG-CB 3.58Å; Q58-A104 WeakPolarHBondContact O-CB 3.22Å; D102-A104 PolarHBondContact O-N 2.84Å; D102-A104 VanDerWaalsContact O-N 3.14Å; A104-Y106 HydrophobicContact CB-CE2 3.98Å; A104-Y106 VanDerWaalsContact O-CD2 3.22Å; A104-Y106 WeakPolarHBondContact O-CD2 3.47Å; A104-Y106 WeakPolarHBondContact O-CE2 3.44Å
105	D	98.2	Very high	93	Very high	90 Å²	90	62.4 Å²	62.4	48%	0.481	35%	0.348	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.3	136.4	164.4	-67.1	-49.8	0	0	0	109.7	Q57 Q58 Y107	Q57-D105 CarbonylContact C-O 3.6Å; Q58-D105 HydrophobicContact CB-CB 4.44Å; Q58-D105 PolarHBondContact N-O 2.88Å; Q58-D105 PolarHBondContact O-N 2.82Å; D105-Y107 HydrophobicContact CB-CE2 3.79Å
106	Y	98.3	Very high	91.4	Very high	27 Å²	27	67.6 Å²	67.6	11%	0.106	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	131.3	177.9	-69.1	-96.7	0	0	0	110.3	Q25 L39 L56 Q57 L67 F82 L93 I95 D102 A104	Q25-Y106 PolarHBondContact NE2-O 2.98Å; L39-Y106 VanDerWaalsContact CD2-CB 3.49Å; L39-Y106 HydrophobicContact CD2-CD1 4.35Å; L39-Y106 HydrophobicContact CD2-CD2 3.95Å; L39-Y106 HydrophobicContact CD2-CG 3.68Å; L56-Y106 WeakPolarHBondContact O-CA 3.41Å; Q57-Y106 HydrophobicContact CB-CD1 4.25Å; Q57-Y106 HydrophobicContact CB-CE1 4Å; Q57-Y106 HydrophobicContact CG-CD1 4.41Å; Q57-Y106 HydrophobicContact CG-CE1 3.86Å; Q57-Y106 PolarHBondContact NE2-OH 2.9Å; L67-Y106 HydrophobicContact CD1-CD1 4.08Å; L67-Y106 HydrophobicContact CD1-CE1 3.76Å; F82-Y106 HydrophobicContact CE1-CE1 4.29Å; L93-Y106 HydrophobicContact CD2-CD1 3.87Å; L93-Y106 HydrophobicContact CD2-CE1 4.11Å; I95-Y106 HydrophobicContact CD1-CE1 3.76Å; I95-Y106 HydrophobicContact CD1-CE2 4.46Å; I95-Y106 WeakPolarHBondContact CD1-OH 3.4Å; D102-Y106 VanDerWaalsContact O-CE2 3.31Å; D102-Y106 WeakPolarHBondContact O-CE2 3.49Å; D102-Y106 PolarHBondContact O-OH 2.91Å; A104-Y106 HydrophobicContact CB-CE2 3.98Å; A104-Y106 VanDerWaalsContact O-CD2 3.22Å; A104-Y106 WeakPolarHBondContact O-CD2 3.47Å; A104-Y106 WeakPolarHBondContact O-CE2 3.44Å
107	Y	96.9	Very high	89.4	Confident	94 Å²	94	72.9 Å²	72.9	37%	0.369	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	131.5	-178.9	-55.4	-77.7	0	0	0	110.8	L56 Q58 D105	L56-Y107 PolarHBondContact N-O 3.14Å; L56-Y107 PolarHBondContact O-N 2.79Å; Q58-Y107 HydrophobicContact CB-CD2 4.42Å; Q58-Y107 HydrophobicContact CB-CE2 3.87Å; Q58-Y107 VanDerWaalsContact OE1-CE2 3.29Å; D105-Y107 HydrophobicContact CB-CE2 3.79Å
108	C	95.4	Very high	89	Confident	15 Å²	15	75.6 Å²	75.6	10%	0.101	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.2	136.9	167.2	-179.2	0	0	0	0	110	L23 C41 A53 W55	L23-C108 HydrophobicContact CD1-CB 4.29Å; L23-C108 WeakPolarHBondContact CD1-O 3.25Å; C41-C108 HydrophobicContact CB-CB 3.42Å; C41-C108 VanDerWaalsContact CB-CB 3.42Å; C41-C108 WeakPolarHBondContact CB-SG 3.49Å; C41-C108 WeakPolarHBondContact SG-CB 3.46Å; C41-C108 CovalentContact SG-SG 2.02Å; C41-C108 PolarHBondContact SG-SG 3.15Å; A53-C108 VanDerWaalsContact CB-SG 3.53Å; W55-C108 HydrophobicContact CE3-CB 4.24Å; W55-C108 HydrophobicContact CH2-CB 4.2Å; W55-C108 HydrophobicContact CZ3-CB 3.98Å
109	S	93.6	Very high	88.5	Confident	59 Å²	59	78.6 Å²	78.6	41%	0.413	47%	0.465	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.4	146.5	174.6	-177.1	0	0	0	0	110.1	A53 A54	A53-S109 CarbonylContact C-O 3.57Å; A53-S109 VanDerWaalsContact CA-O 3.3Å; A53-S109 WeakPolarHBondContact CA-O 3.33Å; A54-S109 PolarHBondContact N-O 3.1Å; A54-S109 PolarHBondContact O-N 3.49Å
110	A	90.9	Very high	87.9	Confident	25 Å²	25	79.9 Å²	79.9	21%	0.207	48%	0.476	C	S	.	.			trans	-154.2	151.6	177.4	0	0	0	0	0	109.9	L23 I47 V48 G52	L23-A110 HydrophobicContact CD1-CB 4.3Å; L23-A110 HydrophobicContact CD2-CB 4.27Å; I47-A110 HydrophobicContact CG2-CB 3.23Å; V48-A110 HydrophobicContact CG2-CB 4.27Å; G52-A110 WeakPolarHBondContact O-CB 3.28Å
111	L	85.9	Confident	87.3	Confident	131 Å²	131	79.3 Å²	79.3	69%	0.686	47%	0.47	S	S	*	.			trans	-88.8	129.5	179.8	-67	173.2	0	0	0	109.9	I47 S113	I47-L111 WeakPolarHBondContact CA-O 3.47Å; L111-S113 PolarHBondContact O-N 3.31Å
112	D	83.3	Confident	86.7	Confident	41 Å²	41	77.8 Å²	77.8	22%	0.219	47%	0.469	C	S	.	.			trans	-79.7	108	169.5	-166	-21.3	0	0	0	109.9	I47 S114 L115	I47-D112 HydrophobicContact CD1-CB 4.29Å; I47-D112 HydrophobicContact CG1-CB 3.72Å; D112-S114 PolarHBondContact O-N 3.28Å; D112-S114 WeakPolarHBondContact OD1-CB 3.45Å; D112-S114 PolarHBondContact OD1-N 3.29Å; D112-S114 PolarHBondContact OD1-OG 3.38Å; D112-S114 PolarHBondContact OD2-OG 3.16Å; D112-L115 HydrophobicContact CB-CB 4.48Å; D112-L115 HydrophobicContact CB-CD1 3.83Å; D112-L115 HydrophobicContact CB-CG 3.95Å; D112-L115 PolarHBondContact O-N 3.2Å
113	S	77	Confident	85.9	Confident	60 Å²	60	82.3 Å²	82.3	42%	0.42	50%	0.497	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.9	-9.9	178	55.5	0	0	0	0	114.3	N46 N50 L111	N46-S113 PolarHBondContact O-N 3.44Å; N46-S113 PolarHBondContact O-OG 3.41Å; N50-S113 PolarHBondContact ND2-OG 3.48Å; L111-S113 PolarHBondContact O-N 3.31Å
114	S	77.9	Confident	85.1	Confident	70 Å²	70	75.6 Å²	75.6	49%	0.49	47%	0.474	S	S	.	.	T	Hydrogen-bonded Turn	trans	-85.4	-16.4	174.7	71.6	0	0	0	0	113.8	D112 S116	D112-S114 PolarHBondContact O-N 3.28Å; D112-S114 WeakPolarHBondContact OD1-CB 3.45Å; D112-S114 PolarHBondContact OD1-N 3.29Å; D112-S114 PolarHBondContact OD1-OG 3.38Å; D112-S114 PolarHBondContact OD2-OG 3.16Å; S114-S116 PolarHBondContact O-N 3.29Å; S114-S116 VanDerWaalsContact O-N 3.11Å
115	L	73.7	Confident	84.1	Confident	135 Å²	135	79.3 Å²	79.3	71%	0.707	49%	0.493	S	S	*	.			trans	-81.1	88	172.1	-63.8	174.7	0	0	0	108.6	D112	D112-L115 HydrophobicContact CB-CB 4.48Å; D112-L115 HydrophobicContact CB-CD1 3.83Å; D112-L115 HydrophobicContact CB-CG 3.95Å; D112-L115 PolarHBondContact O-N 3.2Å
116	S	65.7	Low	82.9	Confident	111 Å²	111	78.4 Å²	78.4	78%	0.776	49%	0.494	S	S	*	.			trans	-65.8	126.9	158.2	53.1	0	0	0	0	108.4	S114	S114-S116 PolarHBondContact O-N 3.29Å; S114-S116 VanDerWaalsContact O-N 3.11Å
117	A	56.2	Low	81.5	Confident	173 Å²	173	83.1 Å²	83.1	100%	1.43	53%	0.529	S	S	*	.			trans	-60.4	0	169.5	0	0	0	0	0	111.7

Retrieved 117 of 117 residues in 65.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).