LV150_HUMAN Loading...

Probable non-functional immunoglobulin lambda variable 1-50

Probable non-functional open reading frame (ORF) of V region of the variable domain of immunoglobulin light chains¹. Non-functional ORF generally cannot participate in the synthesis of a productive immunoglobulin chain due to altered V-(D)-J or switch recombination and/or splicing site (at mRNA level) and/or conserved amino acid change (protein level)². Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens^3,4. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen^5,6.

AlphaFold DB , UniProt , Accession A0A075B6I6, Species HUMAN (Homo sapiens, Human), Gene IGLV1-50, Length 118 aa.

						>LV150_HUMAN|A0A075B6I6|IGLV1-50
MAWSSLLLTLLAHCTGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYVVHWYQQLPGTAPKLLIYGNSNRPSGVPDQFSGSKSGTSASLAITGLQSEDEADYYCKAWDNSLNA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.3	Low	59.2	Low	248 Å²	248	152.2 Å²	152.2	100%	1.222	83%	0.827	S	S	*	*				0	110.9	0	-64.1	179.9	-164.1	0	0	106.3
2	A	52.8	Low	59.9	Low	98 Å²	98	146.7 Å²	146.7	81%	0.81	82%	0.817	S	S	*	*			trans	-86.1	123.3	-167.6	0	0	0	0	0	110.6	S4	A2-S4 PolarHBondContact O-N 3.47Å
3	W	50.1	Low	59.9	Low	254 Å²	254	146.3 Å²	146.3	96%	0.962	81%	0.805	S	S	*	*			trans	-79.2	109.5	166	-88.1	-31.3	0	0	0	108.9
4	S	55.8	Low	60.2	Low	105 Å²	105	145 Å²	145	73%	0.734	81%	0.809	S	S	*	*			trans	-91.6	99.4	165.4	-68.4	0	0	0	0	108.7	A2 L6	A2-S4 PolarHBondContact O-N 3.47Å; S4-L6 PolarHBondContact O-N 3.22Å
5	S	57.1	Low	60.1	Low	107 Å²	107	143.3 Å²	143.3	75%	0.748	80%	0.804	S	S	*	*			trans	-68.3	105.2	164.4	-60.3	0	0	0	0	108.7	L7	S5-L7 PolarHBondContact O-N 3.31Å
6	L	56.6	Low	59.8	Low	158 Å²	158	138.1 Å²	138.1	83%	0.827	79%	0.793	S	S	*	*			trans	-76.1	104.7	165.5	-90	112.4	0	0	0	108.6	S4	S4-L6 PolarHBondContact O-N 3.22Å
7	L	67.9	Low	59.6	Low	149 Å²	149	136.9 Å²	136.9	78%	0.78	79%	0.794	S	S	*	*			trans	-73.8	117.8	162.6	-104.6	94.5	0	0	0	108.6	S5	S5-L7 PolarHBondContact O-N 3.31Å
8	L	63.1	Low	59.2	Low	154 Å²	154	143.4 Å²	143.4	81%	0.806	80%	0.804	S	S	*	*			trans	-84.7	105.5	163.7	-117.7	84	0	0	0	108.4	L10	L8-L10 PolarHBondContact O-N 3.36Å
9	T	67	Low	59.2	Low	115 Å²	115	140.6 Å²	140.6	71%	0.706	80%	0.8	S	S	*	*			trans	-81.4	100.9	165.7	45.6	0	0	0	0	109	L11	T9-L11 PolarHBondContact O-N 3.21Å
10	L	65.2	Low	59.2	Low	156 Å²	156	140.2 Å²	140.2	82%	0.817	79%	0.791	S	S	*	*			trans	-79	95.4	169.8	-160.8	80.9	0	0	0	108.6	L8 A12	L8-L10 PolarHBondContact O-N 3.36Å; L10-A12 PolarHBondContact O-N 2.92Å
11	L	65.3	Low	59.4	Low	130 Å²	130	135 Å²	135	68%	0.681	76%	0.764	S	S	*	*			trans	-70.9	95	167.7	-82.8	144.6	0	0	0	108	T9 H13	T9-L11 PolarHBondContact O-N 3.21Å; L11-H13 VanDerWaalsContact C-N 3.25Å; L11-H13 PolarHBondContact O-N 3.04Å
12	A	67.3	Low	61	Low	86 Å²	86	127.6 Å²	127.6	71%	0.711	73%	0.732	S	S	*	*			trans	-70	86.2	167.9	0	0	0	0	0	108.5	L10 C14	L10-A12 PolarHBondContact O-N 2.92Å; A12-C14 PolarHBondContact O-N 3.31Å; A12-C14 VanDerWaalsContact O-N 3.16Å
13	H	60.5	Low	63	Low	142 Å²	142	124.7 Å²	124.7	66%	0.657	70%	0.703	S	S	*	*			trans	-72.5	102	166.5	-66.9	-11.7	0	0	0	107.7	L11 T15	L11-H13 VanDerWaalsContact C-N 3.25Å; L11-H13 PolarHBondContact O-N 3.04Å; H13-T15 PolarHBondContact O-N 3.28Å
14	C	63.2	Low	65.2	Low	128 Å²	128	116.9 Å²	116.9	87%	0.865	68%	0.683	S	S	*	*			trans	-64.2	79	156.8	-76.3	0	0	0	0	107.6	A12 G16	A12-C14 PolarHBondContact O-N 3.31Å; A12-C14 VanDerWaalsContact O-N 3.16Å; C14-G16 PolarHBondContact O-N 3.17Å
15	T	59.5	Low	67.2	Low	120 Å²	120	114.4 Å²	114.4	74%	0.736	66%	0.66	S	S	*	*			trans	-59.4	109.4	160.9	41.7	0	0	0	0	106	H13 S17	H13-T15 PolarHBondContact O-N 3.28Å; T15-S17 PolarHBondContact O-N 3.05Å; T15-S17 VanDerWaalsContact O-N 3.14Å
16	G	54.3	Low	69.1	Low	60 Å²	60	111.4 Å²	111.4	62%	0.619	64%	0.639	S	S	*	*			trans	-47.1	122.2	-179.7	0	0	0	0	0	110.2	C14 W18	C14-G16 PolarHBondContact O-N 3.17Å; G16-W18 PolarHBondContact O-N 3.14Å; G16-W18 VanDerWaalsContact O-N 3.09Å
17	S	56.8	Low	71	Confident	118 Å²	118	110.6 Å²	110.6	83%	0.825	64%	0.642	S	S	*	*			trans	-62.3	112.6	167.9	-72.6	0	0	0	0	107.3	T15 A19	T15-S17 PolarHBondContact O-N 3.05Å; T15-S17 VanDerWaalsContact O-N 3.14Å; S17-A19 PolarHBondContact O-N 3.03Å
18	W	53.6	Low	72.4	Confident	254 Å²	254	108.2 Å²	108.2	96%	0.962	64%	0.638	S	S	*	*			trans	-65.9	82.7	162.7	-63.1	87.1	0	0	0	106.8	G16 Q20	G16-W18 PolarHBondContact O-N 3.14Å; G16-W18 VanDerWaalsContact O-N 3.09Å; W18-Q20 PolarHBondContact O-N 3.39Å
19	A	59	Low	74.1	Confident	89 Å²	89	104 Å²	104	74%	0.736	62%	0.619	S	S	*	*			trans	-60.6	123	172.1	0	0	0	0	0	106.9	S17	S17-A19 PolarHBondContact O-N 3.03Å
20	Q	58.2	Low	75.5	Confident	132 Å²	132	104 Å²	104	62%	0.617	62%	0.623	S	S	*	*			trans	-49.9	147.6	172.8	-173.2	169.1	-60	0	0	109.4	W18 V22 L116	W18-Q20 PolarHBondContact O-N 3.39Å; Q20-V22 VanDerWaalsContact C-N 3.31Å; Q20-V22 HydrophobicContact CB-CG2 4.13Å; Q20-V22 HydrophobicContact CG-CG2 4.45Å; Q20-V22 WeakPolarHBondContact O-CG2 3.39Å; Q20-V22 PolarHBondContact O-N 3.16Å; Q20-L116 HydrophobicContact CG-CD2 3.98Å
21	S	63.8	Low	77.1	Confident	32 Å²	32	98 Å²	98	22%	0.224	60%	0.599	C	S	.	*	S	Bend	trans	-59.9	96.5	173.6	176.8	0	0	0	0	108.7	S44 S46 N47 D113	S21-S44 PolarHBondContact OG-OG 3.14Å; S21-S46 PolarHBondContact OG-OG 2.8Å; S21-S46 VanDerWaalsContact OG-OG 3.05Å; S21-N47 PolarHBondContact OG-ND2 3.32Å; S21-D113 VanDerWaalsContact CB-OD2 3.24Å; S21-D113 WeakPolarHBondContact CB-OD2 3.48Å; S21-D113 PolarHBondContact OG-OD2 3.01Å
22	V	83.1	Confident	78.6	Confident	92 Å²	92	94 Å²	94	56%	0.558	59%	0.585	S	S	*	*			trans	-119.5	137.6	-175.4	171.6	0	0	0	0	107.6	Q20 T24	Q20-V22 VanDerWaalsContact C-N 3.31Å; Q20-V22 HydrophobicContact CB-CG2 4.13Å; Q20-V22 HydrophobicContact CG-CG2 4.45Å; Q20-V22 WeakPolarHBondContact O-CG2 3.39Å; Q20-V22 PolarHBondContact O-N 3.16Å; V22-T24 PolarHBondContact O-N 3.38Å
23	L	95	Very high	80.1	Confident	38 Å²	38	95.5 Å²	95.5	20%	0.199	59%	0.588	C	S	.	*			trans	-66.1	127.2	171.6	-60.2	-179.4	0	0	0	109.2	T42 N47 I48 A111	L23-T42 WeakPolarHBondContact CA-O 3.4Å; L23-N47 HydrophobicContact CD2-CB 4.45Å; L23-I48 HydrophobicContact CD2-CD1 3.78Å; L23-I48 HydrophobicContact CD2-CG1 3.81Å; L23-A111 HydrophobicContact CD1-CB 3.94Å; L23-A111 HydrophobicContact CD2-CB 4.38Å
24	T	96.4	Very high	81.8	Confident	89 Å²	89	91.4 Å²	91.4	55%	0.546	58%	0.584	S	S	.	*	B	Isolated β-bridge	trans	-103.5	128.9	-177.7	-57.4	0	0	0	0	110	V22 C41 T42	V22-T24 PolarHBondContact O-N 3.38Å; T24-C41 CarbonylContact O-C 3.59Å; T24-C41 WeakPolarHBondContact O-CA 3.35Å; T24-T42 PolarHBondContact N-O 3.27Å; T24-T42 PolarHBondContact O-N 3.07Å
25	Q	97.7	Very high	83.5	Confident	53 Å²	53	90.4 Å²	90.4	25%	0.248	57%	0.566	C	S	.	*			trans	-123.4	156.3	173.1	-61.5	-170.4	143.8	0	0	109.5	C41 W56 Y107 C109	Q25-C41 HydrophobicContact CG-CB 4.23Å; Q25-W56 VanDerWaalsContact OE1-CZ3 3.32Å; Q25-Y107 PolarHBondContact NE2-O 2.81Å; Q25-C109 VanDerWaalsContact OE1-CB 3.29Å; Q25-C109 PolarHBondContact OE1-SG 2.86Å
26	P	97.6	Very high	85.4	Confident	45 Å²	45	92.9 Å²	92.9	29%	0.292	56%	0.562	S	S	.	*			trans	-60.3	145.5	167.2	27.5	-34.2	0	0	0	110	S28 V29 I39 S40	P26-S28 PolarHBondContact O-N 3.39Å; P26-V29 HydrophobicContact CB-CG2 4.18Å; P26-V29 HydrophobicContact CG-CG2 3.56Å; P26-I39 HydrophobicContact CG-CG2 4.48Å; P26-S40 VanDerWaalsContact CD-O 3.25Å; P26-S40 WeakPolarHBondContact CD-O 3.27Å
27	P	97.1	Very high	87.5	Confident	140 Å²	140	90.7 Å²	90.7	91%	0.909	54%	0.537	S	S	*	.	S	Bend	trans	-66.5	-26.6	-179	27.2	-35.1	0	0	0	112.7
28	S	97.6	Very high	89.4	Confident	99 Å²	99	88.3 Å²	88.3	69%	0.692	52%	0.517	S	S	*	.			trans	-157.1	155.9	172.7	61.3	0	0	0	0	110.3	P26	P26-S28 PolarHBondContact O-N 3.39Å
29	V	97.7	Very high	91.6	Very high	67 Å²	67	76.9 Å²	76.9	41%	0.406	48%	0.475	S	S	.	.			trans	-137.6	138.9	168.7	-167.8	0	0	0	0	107.4	P26 V37 I39	P26-V29 HydrophobicContact CB-CG2 4.18Å; P26-V29 HydrophobicContact CG-CG2 3.56Å; V29-V37 HydrophobicContact CB-CG1 4.09Å; V29-V37 HydrophobicContact CG1-CG1 3.34Å; V29-I39 HydrophobicContact CG2-CG1 4.29Å
30	S	97.6	Very high	93.5	Very high	113 Å²	113	75.3 Å²	75.3	79%	0.79	46%	0.459	S	S	*	.			trans	-131	152.7	-178.7	59.9	0	0	0	0	111
31	G	97.3	Very high	95.4	Very high	30 Å²	30	69 Å²	69	31%	0.309	43%	0.429	S	S	.	.			trans	-155	164	173	0	0	0	0	0	110.9	L99	G31-L99 WeakPolarHBondContact O-CD2 3.17Å
32	A	97.7	Very high	97	Very high	46 Å²	46	70.4 Å²	70.4	38%	0.38	44%	0.437	S	S	.	.			trans	-79.8	154.8	171.9	0	0	0	0	0	111	G34 Q35	A32-G34 PolarHBondContact O-N 3.17Å; A32-Q35 HydrophobicContact CB-CG 4.08Å; A32-Q35 VanDerWaalsContact O-CB 3.27Å; A32-Q35 WeakPolarHBondContact O-CB 3.4Å; A32-Q35 PolarHBondContact O-N 3.31Å
33	P	97.7	Very high	97.6	Very high	119 Å²	119	66.7 Å²	66.7	77%	0.773	42%	0.417	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.6	135.2	174.1	-28.1	35.5	0	0	0	112.3	Q35 L99	P33-Q35 VanDerWaalsContact C-N 3.28Å; P33-Q35 PolarHBondContact O-N 2.85Å; P33-L99 CarbonylContact C-O 3.56Å; P33-L99 WeakPolarHBondContact CA-O 3.27Å
34	G	98	Very high	97.6	Very high	56 Å²	56	66.6 Å²	66.6	58%	0.577	42%	0.419	S	S	*	.	T	Hydrogen-bonded Turn	trans	82.5	-11.1	-177.2	0	0	0	0	0	115.4	A32 L99	A32-G34 PolarHBondContact O-N 3.17Å; G34-L99 PolarHBondContact N-O 3.42Å
35	Q	98.2	Very high	97.5	Very high	106 Å²	106	67.3 Å²	67.3	50%	0.495	43%	0.428	S	S	.	.			trans	-73.2	164.5	176	-68.9	-169.4	-39.4	0	0	112.3	A32 P33 G98 L99	A32-Q35 HydrophobicContact CB-CG 4.08Å; A32-Q35 VanDerWaalsContact O-CB 3.27Å; A32-Q35 WeakPolarHBondContact O-CB 3.4Å; A32-Q35 PolarHBondContact O-N 3.31Å; P33-Q35 VanDerWaalsContact C-N 3.28Å; P33-Q35 PolarHBondContact O-N 2.85Å; Q35-G98 PolarHBondContact O-N 3.44Å; Q35-G98 VanDerWaalsContact O-N 3.07Å; Q35-L99 WeakPolarHBondContact O-CB 3.35Å; Q35-L99 PolarHBondContact O-N 2.8Å
36	R	98.3	Very high	97.3	Very high	173 Å²	173	65.5 Å²	65.5	65%	0.653	42%	0.421	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.5	126.4	166.5	-179.7	-179.2	-177.1	-174.5	2.6	109.3	I96 T97	R36-I96 CarbonylContact C-O 3.57Å; R36-I96 VanDerWaalsContact CA-O 3.32Å; R36-I96 WeakPolarHBondContact CA-O 3.45Å; R36-T97 HydrophobicContact CG-CG2 4.01Å
37	V	98.2	Very high	97.2	Very high	14 Å²	14	63.5 Å²	63.5	9%	0.085	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.3	148.3	171.5	175.2	0	0	0	0	109.2	V29 A95 I96 L99	V29-V37 HydrophobicContact CB-CG1 4.09Å; V29-V37 HydrophobicContact CG1-CG1 3.34Å; V37-A95 WeakPolarHBondContact O-CA 3.25Å; V37-I96 PolarHBondContact N-O 2.96Å; V37-I96 PolarHBondContact O-N 3.03Å; V37-L99 HydrophobicContact CG2-CD1 4.39Å; V37-L99 HydrophobicContact CG2-CD2 3.95Å
38	T	98.5	Very high	97.2	Very high	67 Å²	67	56.9 Å²	56.9	41%	0.411	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.6	121.9	174.7	-60	0	0	0	0	109.8	L94	T38-L94 CarbonylContact C-O 3.55Å; T38-L94 WeakPolarHBondContact CA-O 3.48Å
39	I	98.6	Very high	97.1	Very high	14 Å²	14	53.9 Å²	53.9	7%	0.072	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.4	124.3	176.2	-52.3	177.2	0	0	0	107.4	P26 V29 W56 S93 L94 I96 Y107	P26-I39 HydrophobicContact CG-CG2 4.48Å; V29-I39 HydrophobicContact CG2-CG1 4.29Å; I39-W56 HydrophobicContact CB-CH2 4.3Å; I39-W56 HydrophobicContact CB-CZ3 4.23Å; I39-W56 HydrophobicContact CG2-CH2 4.05Å; I39-W56 HydrophobicContact CG2-CZ3 3.86Å; I39-W56 WeakPolarHBondContact O-CH2 3.41Å; I39-S93 CarbonylContact O-C 3.52Å; I39-S93 WeakPolarHBondContact O-CA 3.12Å; I39-L94 HydrophobicContact CB-CB 4.49Å; I39-L94 HydrophobicContact CD1-CD2 4.46Å; I39-L94 PolarHBondContact N-O 2.91Å; I39-L94 PolarHBondContact O-N 2.74Å; I39-I96 HydrophobicContact CD1-CD1 4.43Å; I39-Y107 HydrophobicContact CD1-CD1 4.12Å; I39-Y107 HydrophobicContact CD1-CD2 3.65Å; I39-Y107 HydrophobicContact CD1-CE2 4.3Å; I39-Y107 HydrophobicContact CD1-CG 3.54Å
40	S	98.4	Very high	97	Very high	57 Å²	57	52.7 Å²	52.7	40%	0.399	35%	0.347	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	149.1	177	54.7	0	0	0	0	111.5	P26	P26-S40 VanDerWaalsContact CD-O 3.25Å; P26-S40 WeakPolarHBondContact CD-O 3.27Å
41	C	98.3	Very high	96.9	Very high	0 Å²	0	49.6 Å²	49.6	0%	0	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.5	118.6	170.3	172.5	0	0	0	0	108.6	T24 Q25 W56 S91 A92 C109	T24-C41 CarbonylContact O-C 3.59Å; T24-C41 WeakPolarHBondContact O-CA 3.35Å; Q25-C41 HydrophobicContact CG-CB 4.23Å; C41-W56 HydrophobicContact CB-CH2 3.66Å; C41-W56 HydrophobicContact CB-CZ2 3.83Å; C41-S91 CarbonylContact O-C 3.51Å; C41-S91 WeakPolarHBondContact O-CA 3.34Å; C41-A92 PolarHBondContact N-O 2.76Å; C41-A92 PolarHBondContact O-N 2.88Å; C41-C109 HydrophobicContact CB-CB 3.46Å; C41-C109 VanDerWaalsContact CB-CB 3.46Å; C41-C109 WeakPolarHBondContact CB-SG 3.45Å; C41-C109 WeakPolarHBondContact SG-CB 3.32Å; C41-C109 CovalentContact SG-SG 2.03Å; C41-C109 PolarHBondContact SG-SG 2.96Å
42	T	97.8	Very high	96.8	Very high	61 Å²	61	51.9 Å²	51.9	37%	0.374	33%	0.333	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	132.6	-179.9	-58.8	0	0	0	0	109.7	L23 T24	L23-T42 WeakPolarHBondContact CA-O 3.4Å; T24-T42 PolarHBondContact N-O 3.27Å; T24-T42 PolarHBondContact O-N 3.07Å
43	G	96	Very high	96.8	Very high	14 Å²	14	52.8 Å²	52.8	14%	0.144	33%	0.333	C	S	.	.			trans	-117	-161.8	175.5	0	0	0	0	0	112.1	N47 T90	G43-N47 WeakPolarHBondContact CA-OD1 3.41Å; G43-T90 PolarHBondContact N-O 3.35Å
44	S	94.5	Very high	96.9	Very high	35 Å²	35	47.1 Å²	47.1	25%	0.245	30%	0.297	C	S	.	.			trans	-120.9	-176.2	-179.3	73.2	0	0	0	0	110.5	S21 S46 N47 G49	S21-S44 PolarHBondContact OG-OG 3.14Å; S44-S46 PolarHBondContact O-N 3.47Å; S44-S46 PolarHBondContact OG-N 2.96Å; S44-S46 VanDerWaalsContact OG-N 3.17Å; S44-S46 PolarHBondContact OG-OG 3.09Å; S44-N47 PolarHBondContact N-OD1 2.78Å; S44-N47 PolarHBondContact O-OD1 3.03Å; S44-N47 PolarHBondContact OG-ND2 2.86Å; S44-G49 VanDerWaalsContact O-CA 3.31Å; S44-G49 WeakPolarHBondContact O-CA 3.42Å; S44-G49 PolarHBondContact O-N 2.91Å
45	S	94.6	Very high	96.9	Very high	104 Å²	104	46.6 Å²	46.6	73%	0.727	28%	0.279	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68	-13.6	172.2	54.9	0	0	0	0	114.2	A50	S45-A50 WeakPolarHBondContact O-CB 3.17Å; S45-A50 PolarHBondContact O-N 2.92Å
46	S	94.1	Very high	96.9	Very high	16 Å²	16	41.6 Å²	41.6	11%	0.112	26%	0.255	C	S	.	.	T	Hydrogen-bonded Turn	trans	-93.2	-13.2	179.5	64.9	0	0	0	0	113.7	S21 S44 D113 N114	S21-S46 PolarHBondContact OG-OG 2.8Å; S21-S46 VanDerWaalsContact OG-OG 3.05Å; S44-S46 PolarHBondContact O-N 3.47Å; S44-S46 PolarHBondContact OG-N 2.96Å; S44-S46 VanDerWaalsContact OG-N 3.17Å; S44-S46 PolarHBondContact OG-OG 3.09Å; S46-D113 VanDerWaalsContact CB-OD1 3.28Å; S46-D113 WeakPolarHBondContact CB-OD1 3.32Å; S46-D113 VanDerWaalsContact OG-CG 3.31Å; S46-D113 PolarHBondContact OG-OD1 2.8Å; S46-D113 PolarHBondContact OG-OD2 3.25Å; S46-D113 VanDerWaalsContact OG-OD2 3.05Å; S46-N114 WeakPolarHBondContact CA-OD1 3.25Å; S46-N114 VanDerWaalsContact CB-OD1 3.24Å; S46-N114 WeakPolarHBondContact CB-OD1 3.48Å; S46-N114 VanDerWaalsContact O-CG 3.29Å; S46-N114 PolarHBondContact O-N 3.07Å; S46-N114 PolarHBondContact O-OD1 3.2Å
47	N	94.7	Very high	96.9	Very high	3 Å²	3	36.1 Å²	36.1	2%	0.016	24%	0.235	C	C	.	.	T	Hydrogen-bonded Turn	trans	-122.1	-101.6	-179.4	52.3	50.7	0	0	0	112.9	S21 L23 G43 S44 G49 A50 Y52 A111 W112 D113	S21-N47 PolarHBondContact OG-ND2 3.32Å; L23-N47 HydrophobicContact CD2-CB 4.45Å; G43-N47 WeakPolarHBondContact CA-OD1 3.41Å; S44-N47 PolarHBondContact N-OD1 2.78Å; S44-N47 PolarHBondContact O-OD1 3.03Å; S44-N47 PolarHBondContact OG-ND2 2.86Å; N47-G49 PolarHBondContact O-N 2.86Å; N47-A50 WeakPolarHBondContact O-CB 3.19Å; N47-A50 PolarHBondContact O-N 2.82Å; N47-Y52 WeakPolarHBondContact O-CD2 3.37Å; N47-A111 HydrophobicContact CB-CB 4.42Å; N47-W112 VanDerWaalsContact CA-O 3.26Å; N47-W112 WeakPolarHBondContact CA-O 3.35Å; N47-W112 WeakPolarHBondContact CB-O 3.45Å; N47-D113 HydrophobicContact CB-CB 4.08Å; N47-D113 PolarHBondContact ND2-OD2 2.83Å
48	I	96.8	Very high	96.9	Very high	1 Å²	1	36.5 Å²	36.5	1%	0.005	24%	0.236	C	C	.	.	G	3₁₀ helix	trans	-55.1	-43.6	-178.8	-57.3	-173	0	0	0	110.6	L23 A50 G51 V54 K87 A92 A111	L23-I48 HydrophobicContact CD2-CD1 3.78Å; L23-I48 HydrophobicContact CD2-CG1 3.81Å; I48-A50 VanDerWaalsContact C-N 3.31Å; I48-A50 PolarHBondContact O-N 3.21Å; I48-G51 PolarHBondContact O-N 2.95Å; I48-G51 VanDerWaalsContact O-N 3.16Å; I48-V54 HydrophobicContact CD1-CG2 3.85Å; I48-V54 HydrophobicContact CG1-CG2 3.8Å; I48-V54 HydrophobicContact CG2-CG2 4.17Å; I48-K87 HydrophobicContact CG2-CD 3.7Å; I48-K87 HydrophobicContact CG2-CG 3.83Å; I48-A92 HydrophobicContact CD1-CB 4.34Å; I48-A111 HydrophobicContact CG1-CB 4.06Å
49	G	95.9	Very high	96.9	Very high	36 Å²	36	35.8 Å²	35.8	37%	0.371	23%	0.228	S	C	.	.	G	3₁₀ helix	trans	-69.5	-21.9	177.8	0	0	0	0	0	114.6	S44 N47 G51	S44-G49 VanDerWaalsContact O-CA 3.31Å; S44-G49 WeakPolarHBondContact O-CA 3.42Å; S44-G49 PolarHBondContact O-N 2.91Å; N47-G49 PolarHBondContact O-N 2.86Å; G49-G51 PolarHBondContact O-N 2.86Å
50	A	95.5	Very high	96.9	Very high	42 Å²	42	38.4 Å²	38.4	35%	0.347	24%	0.242	S	C	.	.	G	3₁₀ helix	trans	-75.6	1.3	172.5	0	0	0	0	0	112.7	S45 N47 I48 Y52	S45-A50 WeakPolarHBondContact O-CB 3.17Å; S45-A50 PolarHBondContact O-N 2.92Å; N47-A50 WeakPolarHBondContact O-CB 3.19Å; N47-A50 PolarHBondContact O-N 2.82Å; I48-A50 VanDerWaalsContact C-N 3.31Å; I48-A50 PolarHBondContact O-N 3.21Å; A50-Y52 HydrophobicContact CB-CD2 3.72Å; A50-Y52 HydrophobicContact CB-CE2 3.64Å
51	G	95.6	Very high	96.8	Very high	48 Å²	48	41.1 Å²	41.1	50%	0.495	26%	0.258	S	S	.	.	T	Hydrogen-bonded Turn	trans	91.6	-3.4	-179.3	0	0	0	0	0	114.1	I48 G49 K87	I48-G51 PolarHBondContact O-N 2.95Å; I48-G51 VanDerWaalsContact O-N 3.16Å; G49-G51 PolarHBondContact O-N 2.86Å; G51-K87 VanDerWaalsContact C-NZ 3.3Å; G51-K87 PolarHBondContact O-NZ 3.28Å
52	Y	96.2	Very high	96.7	Very high	78 Å²	78	45.6 Å²	45.6	31%	0.306	30%	0.304	S	S	.	.			trans	-58.7	147.2	177.1	-65.9	-62.9	0	0	0	112.1	N47 A50 K87 W112 N114	N47-Y52 WeakPolarHBondContact O-CD2 3.37Å; A50-Y52 HydrophobicContact CB-CD2 3.72Å; A50-Y52 HydrophobicContact CB-CE2 3.64Å; Y52-K87 PolarHBondContact O-NZ 2.81Å; Y52-W112 HydrophobicContact CD1-CB 3.86Å; Y52-W112 HydrophobicContact CD1-CG 4.22Å; Y52-W112 HydrophobicContact CD2-CB 4.22Å; Y52-W112 AromaticContact CD2-CD1 4Å; Y52-W112 VanDerWaalsContact CD2-O 3.27Å; Y52-W112 WeakPolarHBondContact CD2-O 3.48Å; Y52-W112 HydrophobicContact CE1-CB 4.27Å; Y52-W112 AromaticContact CE1-CD1 3.58Å; Y52-W112 HydrophobicContact CE1-CG 4.14Å; Y52-W112 AromaticContact CE2-CD1 3.58Å; Y52-W112 HydrophobicContact CE2-CG 4.49Å; Y52-W112 HydrophobicContact CG-CB 3.85Å; Y52-W112 HydrophobicContact CG-CG 4.45Å; Y52-W112 AromaticContact CZ-CD1 3.36Å; Y52-N114 HydrophobicContact CE2-CB 3.86Å; Y52-N114 WeakPolarHBondContact OH-CB 3.34Å
53	V	97.6	Very high	96.7	Very high	64 Å²	64	45.7 Å²	45.7	39%	0.388	31%	0.305	S	S	.	.			trans	-74.2	148.8	177.5	-64.2	0	0	0	0	110.4	N72	V53-N72 WeakPolarHBondContact CA-OD1 3.24Å
54	V	98.3	Very high	96.8	Very high	1 Å²	1	48.8 Å²	48.8	1%	0.006	33%	0.329	C	S	.	.			trans	-104.3	136.3	174.2	-176.7	0	0	0	0	109.4	I48 N72 K87 A92 C109 K110 A111	I48-V54 HydrophobicContact CD1-CG2 3.85Å; I48-V54 HydrophobicContact CG1-CG2 3.8Å; I48-V54 HydrophobicContact CG2-CG2 4.17Å; V54-N72 PolarHBondContact N-OD1 2.03Å; V54-N72 PolarHBondContact O-N 3.49Å; V54-K87 HydrophobicContact CG2-CD 4.09Å; V54-A92 HydrophobicContact CB-CB 4.04Å; V54-A92 HydrophobicContact CG1-CB 3.9Å; V54-A92 HydrophobicContact CG2-CB 3.82Å; V54-C109 HydrophobicContact CG1-CB 4.11Å; V54-K110 WeakPolarHBondContact CA-O 3.35Å; V54-A111 HydrophobicContact CG2-CB 4.32Å
55	H	98.5	Very high	96.9	Very high	44 Å²	44	50.5 Å²	50.5	20%	0.204	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112	149.5	170.8	-55.8	-88	0	0	0	109.5	Y57 L67 I69 Y70 C109 K110	H55-Y57 HydrophobicContact CB-CD2 4.47Å; H55-Y57 HydrophobicContact CB-CE2 3.74Å; H55-L67 HydrophobicContact CB-CD1 4.15Å; H55-I69 CarbonylContact C-O 3.6Å; H55-I69 VanDerWaalsContact CA-O 3.24Å; H55-I69 WeakPolarHBondContact CA-O 3.38Å; H55-Y70 WeakPolarHBondContact ND1-CA 3.45Å; H55-Y70 WeakPolarHBondContact ND1-CB 3.37Å; H55-C109 CarbonylContact O-C 3.56Å; H55-C109 WeakPolarHBondContact O-CA 3.37Å; H55-K110 HydrophobicContact CB-CB 4.43Å; H55-K110 PolarHBondContact N-O 3.16Å; H55-K110 PolarHBondContact O-N 3.25Å
56	W	98.7	Very high	97	Very high	1 Å²	1	50.9 Å²	50.9	0%	0.004	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	133	175.4	-70.2	93.6	0	0	0	110.3	Q25 I39 C41 L68 I69 A92 S93 L94 Y108 C109	Q25-W56 VanDerWaalsContact OE1-CZ3 3.32Å; I39-W56 HydrophobicContact CB-CH2 4.3Å; I39-W56 HydrophobicContact CB-CZ3 4.23Å; I39-W56 HydrophobicContact CG2-CH2 4.05Å; I39-W56 HydrophobicContact CG2-CZ3 3.86Å; I39-W56 WeakPolarHBondContact O-CH2 3.41Å; C41-W56 HydrophobicContact CB-CH2 3.66Å; C41-W56 HydrophobicContact CB-CZ2 3.83Å; W56-L68 PolarHBondContact O-N 2.92Å; W56-I69 HydrophobicContact CB-CB 4.02Å; W56-I69 HydrophobicContact CB-CG1 4.33Å; W56-I69 HydrophobicContact CG-CB 4.36Å; W56-I69 PolarHBondContact N-O 2.66Å; W56-I69 PolarHBondContact O-N 3.39Å; W56-A92 HydrophobicContact CZ2-CB 4.46Å; W56-S93 VanDerWaalsContact CZ2-C 3.44Å; W56-L94 HydrophobicContact CB-CD1 4.33Å; W56-L94 HydrophobicContact CB-CD2 4.28Å; W56-L94 HydrophobicContact CD2-CB 3.5Å; W56-L94 HydrophobicContact CD2-CD2 4.12Å; W56-L94 HydrophobicContact CD2-CG 4.27Å; W56-L94 HydrophobicContact CE3-CB 3.66Å; W56-L94 HydrophobicContact CE3-CD2 3.83Å; W56-L94 HydrophobicContact CE3-CG 4.35Å; W56-L94 HydrophobicContact CG-CB 4.02Å; W56-L94 HydrophobicContact CG-CD1 4.21Å; W56-L94 HydrophobicContact CG-CD2 4.33Å; W56-L94 HydrophobicContact CG-CG 4.43Å; W56-L94 HydrophobicContact CH2-CB 3.96Å; W56-L94 HydrophobicContact CZ2-CB 3.83Å; W56-L94 VanDerWaalsContact CZ2-N 3.33Å; W56-L94 HydrophobicContact CZ3-CB 3.88Å; W56-L94 HydrophobicContact CZ3-CD2 4.45Å; W56-Y108 WeakPolarHBondContact CA-O 3.26Å; W56-C109 HydrophobicContact CD2-CB 4.26Å; W56-C109 HydrophobicContact CE3-CB 4.07Å; W56-C109 HydrophobicContact CH2-CB 3.99Å; W56-C109 HydrophobicContact CZ2-CB 4.15Å; W56-C109 HydrophobicContact CZ3-CB 3.94Å
57	Y	98.5	Very high	97.3	Very high	59 Å²	59	52.7 Å²	52.7	23%	0.231	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	146.8	177.2	-63.6	-98.1	0	0	0	110.2	H55 P65 K66 L67 Y107 Y108 K110	H55-Y57 HydrophobicContact CB-CD2 4.47Å; H55-Y57 HydrophobicContact CB-CE2 3.74Å; Y57-P65 HydrophobicContact CD1-CB 4.38Å; Y57-K66 CarbonylContact C-O 3.57Å; Y57-K66 WeakPolarHBondContact CA-O 3.21Å; Y57-L67 HydrophobicContact CD1-CB 4.24Å; Y57-L67 HydrophobicContact CD1-CD1 4.35Å; Y57-L67 HydrophobicContact CE1-CB 4.02Å; Y57-L67 HydrophobicContact CE1-CD1 3.88Å; Y57-L67 HydrophobicContact CE2-CD1 4.18Å; Y57-Y107 WeakPolarHBondContact O-CA 3.37Å; Y57-Y108 PolarHBondContact N-O 3.32Å; Y57-Y108 PolarHBondContact O-N 3.27Å; Y57-K110 HydrophobicContact CD2-CB 4.43Å; Y57-K110 HydrophobicContact CE2-CB 3.99Å; Y57-K110 HydrophobicContact CE2-CD 4.05Å
58	Q	98.4	Very high	97.4	Very high	21 Å²	21	52.6 Å²	52.6	10%	0.098	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	135.4	171.1	-177.4	-172.3	36.2	0	0	108.8	P65 K66 L68 A105 D106 Y107	Q58-P65 CarbonylContact O-C 3.58Å; Q58-P65 WeakPolarHBondContact O-CA 3.02Å; Q58-K66 PolarHBondContact N-O 3Å; Q58-K66 PolarHBondContact O-N 2.82Å; Q58-L68 HydrophobicContact CB-CD1 3.62Å; Q58-L68 HydrophobicContact CB-CD2 4.2Å; Q58-L68 HydrophobicContact CB-CG 3.78Å; Q58-L68 HydrophobicContact CG-CD1 4.46Å; Q58-A105 HydrophobicContact CG-CB 3.47Å; Q58-A105 VanDerWaalsContact CG-CB 3.47Å; Q58-D106 CarbonylContact C-O 3.57Å; Q58-D106 WeakPolarHBondContact CA-O 3.27Å; Q58-Y107 HydrophobicContact CB-CD1 4.26Å; Q58-Y107 HydrophobicContact CB-CE1 4.02Å; Q58-Y107 HydrophobicContact CG-CD1 4.41Å; Q58-Y107 HydrophobicContact CG-CE1 3.87Å; Q58-Y107 PolarHBondContact NE2-OH 2.85Å; Q58-Y107 VanDerWaalsContact NE2-OH 3.07Å
59	Q	98.2	Very high	97.5	Very high	52 Å²	52	52.6 Å²	52.6	24%	0.243	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	114.1	173.9	-175.5	175.4	14.2	0	0	109.2	T63 P65 A105 D106 Y108	Q59-T63 WeakPolarHBondContact CG-O 3.45Å; Q59-T63 PolarHBondContact NE2-O 2.86Å; Q59-P65 HydrophobicContact CB-CB 4.45Å; Q59-P65 HydrophobicContact CB-CG 4.31Å; Q59-P65 HydrophobicContact CG-CG 4.3Å; Q59-A105 WeakPolarHBondContact O-CB 3.27Å; Q59-D106 HydrophobicContact CB-CB 4.34Å; Q59-D106 PolarHBondContact N-O 2.97Å; Q59-D106 PolarHBondContact O-N 3.31Å; Q59-Y108 HydrophobicContact CB-CE2 3.88Å; Q59-Y108 PolarHBondContact OE1-OH 3.44Å
60	L	97.4	Very high	97.6	Very high	69 Å²	69	55.7 Å²	55.7	36%	0.361	34%	0.337	S	S	.	.			trans	-78.5	155.5	170.9	-66.3	167	0	0	0	109.5	G62 T63 A105	L60-G62 PolarHBondContact O-N 2.79Å; L60-G62 VanDerWaalsContact O-N 3.17Å; L60-T63 HydrophobicContact CB-CG2 3.96Å; L60-T63 PolarHBondContact N-OG1 2.79Å; L60-T63 PolarHBondContact O-N 2.82Å; L60-T63 PolarHBondContact O-OG1 2.91Å; L60-T63 VanDerWaalsContact O-OG1 3.14Å; L60-A105 HydrophobicContact CD2-CB 4.01Å
61	P	96.9	Very high	97.8	Very high	115 Å²	115	54.5 Å²	54.5	75%	0.747	33%	0.329	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.8	123.7	176.1	-28.2	35.8	0	0	0	112.1	T63	P61-T63 VanDerWaalsContact C-N 3.3Å; P61-T63 PolarHBondContact O-N 2.9Å
62	G	96.9	Very high	97.9	Very high	93 Å²	93	53.9 Å²	53.9	96%	0.959	31%	0.314	S	S	*	.	T	Hydrogen-bonded Turn	trans	76.1	6.5	178.5	0	0	0	0	0	115.9	L60	L60-G62 PolarHBondContact O-N 2.79Å; L60-G62 VanDerWaalsContact O-N 3.17Å
63	T	97.3	Very high	98	Very high	63 Å²	63	53.5 Å²	53.5	39%	0.387	32%	0.323	S	S	.	.	S	Bend	trans	-109.3	164.4	177.9	78.4	0	0	0	0	112.5	Q59 L60 P61	Q59-T63 WeakPolarHBondContact CG-O 3.45Å; Q59-T63 PolarHBondContact NE2-O 2.86Å; L60-T63 HydrophobicContact CB-CG2 3.96Å; L60-T63 PolarHBondContact N-OG1 2.79Å; L60-T63 PolarHBondContact O-N 2.82Å; L60-T63 PolarHBondContact O-OG1 2.91Å; L60-T63 VanDerWaalsContact O-OG1 3.14Å; P61-T63 VanDerWaalsContact C-N 3.3Å; P61-T63 PolarHBondContact O-N 2.9Å
64	A	97.2	Very high	98	Very high	80 Å²	80	54 Å²	54	66%	0.661	32%	0.323	S	S	*	.			trans	-71.8	151.8	166.5	0	0	0	0	0	110.8	K66	A64-K66 PolarHBondContact O-N 3.34Å
65	P	97.4	Very high	98	Very high	70 Å²	70	59 Å²	59	46%	0.455	34%	0.342	S	S	.	.			trans	-60.9	132.4	173	-23.9	33.8	0	0	0	112.7	Y57 Q58 Q59	Y57-P65 HydrophobicContact CD1-CB 4.38Å; Q58-P65 CarbonylContact O-C 3.58Å; Q58-P65 WeakPolarHBondContact O-CA 3.02Å; Q59-P65 HydrophobicContact CB-CB 4.45Å; Q59-P65 HydrophobicContact CB-CG 4.31Å; Q59-P65 HydrophobicContact CG-CG 4.3Å
66	K	97.8	Very high	98	Very high	112 Å²	112	58.5 Å²	58.5	49%	0.487	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.6	138.4	175.3	-177	-177.8	175	-172.7	0	110.3	Y57 Q58 A64 L68	Y57-K66 CarbonylContact C-O 3.57Å; Y57-K66 WeakPolarHBondContact CA-O 3.21Å; Q58-K66 PolarHBondContact N-O 3Å; Q58-K66 PolarHBondContact O-N 2.82Å; A64-K66 PolarHBondContact O-N 3.34Å; K66-L68 PolarHBondContact O-N 2.78Å
67	L	98.4	Very high	97.9	Very high	54 Å²	54	64.7 Å²	64.7	28%	0.283	39%	0.386	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.5	124.7	175	-178.2	67.4	0	0	0	111	H55 Y57 I69 P76	H55-L67 HydrophobicContact CB-CD1 4.15Å; Y57-L67 HydrophobicContact CD1-CB 4.24Å; Y57-L67 HydrophobicContact CD1-CD1 4.35Å; Y57-L67 HydrophobicContact CE1-CB 4.02Å; Y57-L67 HydrophobicContact CE1-CD1 3.88Å; Y57-L67 HydrophobicContact CE2-CD1 4.18Å; L67-I69 WeakPolarHBondContact CD1-O 3.49Å; L67-P76 HydrophobicContact CB-CG 4.45Å; L67-P76 HydrophobicContact CD2-CG 3.83Å; L67-P76 HydrophobicContact CG-CG 3.91Å
68	L	98.3	Very high	97.8	Very high	2 Å²	2	64.9 Å²	64.9	1%	0.01	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	-49.4	174.5	-70.2	-174.9	0	0	0	112.5	W56 Q58 K66 P76 V79 F83 L94 Y107	W56-L68 PolarHBondContact O-N 2.92Å; Q58-L68 HydrophobicContact CB-CD1 3.62Å; Q58-L68 HydrophobicContact CB-CD2 4.2Å; Q58-L68 HydrophobicContact CB-CG 3.78Å; Q58-L68 HydrophobicContact CG-CD1 4.46Å; K66-L68 PolarHBondContact O-N 2.78Å; L68-P76 WeakPolarHBondContact O-CD 3.46Å; L68-V79 HydrophobicContact CD2-CG1 3.9Å; L68-V79 HydrophobicContact CD2-CG2 4.36Å; L68-F83 HydrophobicContact CD1-CD1 3.68Å; L68-F83 HydrophobicContact CD1-CE1 3.73Å; L68-F83 HydrophobicContact CD1-CG 4.25Å; L68-F83 HydrophobicContact CD1-CZ 4.33Å; L68-F83 HydrophobicContact CD2-CD2 4.39Å; L68-F83 HydrophobicContact CD2-CE2 4.39Å; L68-F83 HydrophobicContact CD2-CG 4.49Å; L68-F83 HydrophobicContact CD2-CZ 4.5Å; L68-L94 HydrophobicContact CD1-CD2 4.21Å; L68-Y107 HydrophobicContact CD1-CD1 4.05Å; L68-Y107 HydrophobicContact CD1-CE1 3.63Å
69	I	98.8	Very high	97.8	Very high	0 Å²	0	64.6 Å²	64.6	0%	0	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.8	135.9	-179.2	-54.3	-67.6	0	0	0	109.2	H55 W56 L67 N74 R75 F83 L94	H55-I69 CarbonylContact C-O 3.6Å; H55-I69 VanDerWaalsContact CA-O 3.24Å; H55-I69 WeakPolarHBondContact CA-O 3.38Å; W56-I69 HydrophobicContact CB-CB 4.02Å; W56-I69 HydrophobicContact CB-CG1 4.33Å; W56-I69 HydrophobicContact CG-CB 4.36Å; W56-I69 PolarHBondContact N-O 2.66Å; W56-I69 PolarHBondContact O-N 3.39Å; L67-I69 WeakPolarHBondContact CD1-O 3.49Å; I69-N74 CarbonylContact C-O 3.51Å; I69-N74 VanDerWaalsContact CA-O 3.28Å; I69-N74 WeakPolarHBondContact CA-O 3.39Å; I69-R75 HydrophobicContact CD1-CG 3.49Å; I69-R75 VanDerWaalsContact CD1-CG 3.49Å; I69-F83 HydrophobicContact CD1-CB 4.49Å; I69-L94 HydrophobicContact CG1-CD1 3.75Å
70	Y	98.4	Very high	97.7	Very high	101 Å²	101	65 Å²	65	40%	0.396	41%	0.413	S	S	.	.	B	Isolated β-bridge	trans	-125.6	155.3	170.1	72.7	-83.5	0	0	0	111.2	H55 N72 N74 P76	H55-Y70 WeakPolarHBondContact ND1-CA 3.45Å; H55-Y70 WeakPolarHBondContact ND1-CB 3.37Å; Y70-N72 VanDerWaalsContact C-N 3.28Å; Y70-N72 PolarHBondContact O-N 2.82Å; Y70-N74 HydrophobicContact CD1-CB 3.9Å; Y70-N74 VanDerWaalsContact CD1-O 3.26Å; Y70-N74 WeakPolarHBondContact CD1-O 3.01Å; Y70-N74 HydrophobicContact CD2-CB 4.11Å; Y70-N74 HydrophobicContact CE1-CB 3.49Å; Y70-N74 VanDerWaalsContact CE1-CB 3.49Å; Y70-N74 HydrophobicContact CE2-CB 3.71Å; Y70-N74 HydrophobicContact CG-CB 4.19Å; Y70-N74 PolarHBondContact N-O 2.95Å; Y70-N74 WeakPolarHBondContact O-CB 3.27Å; Y70-N74 PolarHBondContact O-N 3.05Å; Y70-P76 HydrophobicContact CD1-CG 3.96Å; Y70-P76 HydrophobicContact CE1-CG 4.31Å
71	G	98.1	Very high	97.7	Very high	18 Å²	18	68 Å²	68	19%	0.186	43%	0.429	C	S	.	.	T	Hydrogen-bonded Turn	trans	59.6	40	176	0	0	0	0	0	112.7	S73	G71-S73 PolarHBondContact O-N 2.81Å
72	N	98.1	Very high	97.7	Very high	35 Å²	35	63.5 Å²	63.5	19%	0.187	40%	0.398	C	S	.	.	T	Hydrogen-bonded Turn	trans	71.7	-39.5	-177.3	-46.1	-50.1	0	0	0	116.7	V53 V54 Y70 G85 S86 K87	V53-N72 WeakPolarHBondContact CA-OD1 3.24Å; V54-N72 PolarHBondContact N-OD1 2.03Å; V54-N72 PolarHBondContact O-N 3.49Å; Y70-N72 VanDerWaalsContact C-N 3.28Å; Y70-N72 PolarHBondContact O-N 2.82Å; N72-G85 CarbonylContact O-C 2.98Å; N72-G85 VanDerWaalsContact O-CA 3.27Å; N72-G85 WeakPolarHBondContact O-CA 3.34Å; N72-S86 PolarHBondContact O-N 2.85Å; N72-K87 HydrophobicContact CB-CB 4.11Å; N72-K87 WeakPolarHBondContact OD1-CD 3.24Å
73	S	98.3	Very high	97.8	Very high	69 Å²	69	59.3 Å²	59.3	48%	0.483	35%	0.354	S	S	.	.	T	Hydrogen-bonded Turn	trans	-143.5	-3.2	-169.9	60.3	0	0	0	0	115.8	G71	G71-S73 PolarHBondContact O-N 2.81Å
74	N	98.4	Very high	97.9	Very high	76 Å²	76	58.4 Å²	58.4	41%	0.406	35%	0.35	S	S	.	.	B	Isolated β-bridge	trans	-89.7	137.2	-176.9	-58.5	-57.7	0	0	0	111.4	I69 Y70	I69-N74 CarbonylContact C-O 3.51Å; I69-N74 VanDerWaalsContact CA-O 3.28Å; I69-N74 WeakPolarHBondContact CA-O 3.39Å; Y70-N74 HydrophobicContact CD1-CB 3.9Å; Y70-N74 VanDerWaalsContact CD1-O 3.26Å; Y70-N74 WeakPolarHBondContact CD1-O 3.01Å; Y70-N74 HydrophobicContact CD2-CB 4.11Å; Y70-N74 HydrophobicContact CE1-CB 3.49Å; Y70-N74 VanDerWaalsContact CE1-CB 3.49Å; Y70-N74 HydrophobicContact CE2-CB 3.71Å; Y70-N74 HydrophobicContact CG-CB 4.19Å; Y70-N74 PolarHBondContact N-O 2.95Å; Y70-N74 WeakPolarHBondContact O-CB 3.27Å; Y70-N74 PolarHBondContact O-N 3.05Å
75	R	97.9	Very high	97.9	Very high	104 Å²	104	55.1 Å²	55.1	39%	0.392	32%	0.324	S	S	.	.	P	Polyproline II helix	trans	-96.9	134.1	172.6	-76	-177	-65	-86.9	-1.1	110.7	I69 V79 P80 F83	I69-R75 HydrophobicContact CD1-CG 3.49Å; I69-R75 VanDerWaalsContact CD1-CG 3.49Å; R75-V79 HydrophobicContact CB-CB 4.33Å; R75-V79 HydrophobicContact CG-CB 4.46Å; R75-V79 HydrophobicContact CG-CG1 4.14Å; R75-P80 WeakPolarHBondContact CD-O 3.33Å; R75-F83 WeakPolarHBondContact CD-O 3.33Å; R75-F83 PolarHBondContact NH1-O 2.87Å
76	P	97.8	Very high	98	Very high	35 Å²	35	54.7 Å²	54.7	23%	0.227	32%	0.322	C	S	.	.	P	Polyproline II helix	trans	-60.4	160.7	162.1	-19.3	32.7	0	0	0	111.5	L67 L68 Y70 V79	L67-P76 HydrophobicContact CB-CG 4.45Å; L67-P76 HydrophobicContact CD2-CG 3.83Å; L67-P76 HydrophobicContact CG-CG 3.91Å; L68-P76 WeakPolarHBondContact O-CD 3.46Å; Y70-P76 HydrophobicContact CD1-CG 3.96Å; Y70-P76 HydrophobicContact CE1-CG 4.31Å; P76-V79 HydrophobicContact CB-CG2 4.34Å; P76-V79 HydrophobicContact CG-CG2 4.39Å; P76-V79 PolarHBondContact O-N 3.18Å
77	S	97.5	Very high	98	Very high	131 Å²	131	52.3 Å²	52.3	92%	0.916	31%	0.312	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.5	141.4	171.9	-172.6	0	0	0	0	111.1	V79	S77-V79 VanDerWaalsContact C-N 3.33Å
78	G	96.8	Very high	98	Very high	63 Å²	63	54.4 Å²	54.4	65%	0.649	33%	0.331	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.8	8.7	-179.4	0	0	0	0	0	115.4
79	V	97.3	Very high	97.9	Very high	15 Å²	15	57 Å²	57	9%	0.091	36%	0.359	C	S	.	.			trans	-92.9	125.7	166.4	177	0	0	0	0	108.8	L68 R75 P76 S77 F83	L68-V79 HydrophobicContact CD2-CG1 3.9Å; L68-V79 HydrophobicContact CD2-CG2 4.36Å; R75-V79 HydrophobicContact CB-CB 4.33Å; R75-V79 HydrophobicContact CG-CB 4.46Å; R75-V79 HydrophobicContact CG-CG1 4.14Å; P76-V79 HydrophobicContact CB-CG2 4.34Å; P76-V79 HydrophobicContact CG-CG2 4.39Å; P76-V79 PolarHBondContact O-N 3.18Å; S77-V79 VanDerWaalsContact C-N 3.33Å; V79-F83 HydrophobicContact CG1-CB 4.19Å; V79-F83 HydrophobicContact CG1-CD2 3.83Å; V79-F83 HydrophobicContact CG1-CG 4.3Å
80	P	97.2	Very high	97.8	Very high	60 Å²	60	59.9 Å²	59.9	39%	0.39	38%	0.377	S	S	.	.			trans	-55.5	149.9	177.7	-26.4	35.1	0	0	0	113.1	R75 Q82 F83	R75-P80 WeakPolarHBondContact CD-O 3.33Å; P80-Q82 HydrophobicContact CB-CG 4.04Å; P80-Q82 PolarHBondContact O-N 3.38Å; P80-F83 HydrophobicContact CB-CD2 4.2Å; P80-F83 HydrophobicContact CB-CE2 4.26Å; P80-F83 HydrophobicContact CG-CD2 4.48Å; P80-F83 HydrophobicContact CG-CE2 4.2Å; P80-F83 PolarHBondContact O-N 3.28Å
81	D	96.7	Very high	97.8	Very high	132 Å²	132	57.4 Å²	57.4	71%	0.706	37%	0.374	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.3	-14.3	-178.8	63	-15.5	0	0	0	113.8	F83	D81-F83 PolarHBondContact O-N 2.87Å
82	Q	97.5	Very high	97.8	Very high	20 Å²	20	56.8 Å²	56.8	9%	0.093	37%	0.367	C	S	.	.	T	Hydrogen-bonded Turn	trans	-58.7	-24.5	172.7	76.5	-162.5	62	0	0	114	P80 I96 T97 D103	P80-Q82 HydrophobicContact CB-CG 4.04Å; P80-Q82 PolarHBondContact O-N 3.38Å; Q82-I96 HydrophobicContact CG-CG2 4.36Å; Q82-I96 WeakPolarHBondContact O-CA 3.47Å; Q82-T97 WeakPolarHBondContact CA-OG1 3.33Å; Q82-T97 VanDerWaalsContact CB-O 3.27Å; Q82-T97 WeakPolarHBondContact CB-O 3.47Å; Q82-T97 PolarHBondContact O-N 2.57Å; Q82-T97 PolarHBondContact O-OG1 2.89Å; Q82-D103 VanDerWaalsContact NE2-CG 3.28Å; Q82-D103 PolarHBondContact NE2-OD1 2.89Å; Q82-D103 PolarHBondContact NE2-OD2 3.45Å
83	F	98.5	Very high	97.8	Very high	6 Å²	6	56.5 Å²	56.5	3%	0.026	37%	0.368	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.3	128.1	177.6	-61.6	-78.5	0	0	0	110.9	L68 I69 R75 V79 P80 D81 L94 I96 D103 Y107	L68-F83 HydrophobicContact CD1-CD1 3.68Å; L68-F83 HydrophobicContact CD1-CE1 3.73Å; L68-F83 HydrophobicContact CD1-CG 4.25Å; L68-F83 HydrophobicContact CD1-CZ 4.33Å; L68-F83 HydrophobicContact CD2-CD2 4.39Å; L68-F83 HydrophobicContact CD2-CE2 4.39Å; L68-F83 HydrophobicContact CD2-CG 4.49Å; L68-F83 HydrophobicContact CD2-CZ 4.5Å; I69-F83 HydrophobicContact CD1-CB 4.49Å; R75-F83 WeakPolarHBondContact CD-O 3.33Å; R75-F83 PolarHBondContact NH1-O 2.87Å; V79-F83 HydrophobicContact CG1-CB 4.19Å; V79-F83 HydrophobicContact CG1-CD2 3.83Å; V79-F83 HydrophobicContact CG1-CG 4.3Å; P80-F83 HydrophobicContact CB-CD2 4.2Å; P80-F83 HydrophobicContact CB-CE2 4.26Å; P80-F83 HydrophobicContact CG-CD2 4.48Å; P80-F83 HydrophobicContact CG-CE2 4.2Å; P80-F83 PolarHBondContact O-N 3.28Å; D81-F83 PolarHBondContact O-N 2.87Å; F83-L94 HydrophobicContact CD1-CD1 4.49Å; F83-I96 HydrophobicContact CD1-CD1 4.37Å; F83-I96 HydrophobicContact CD1-CG1 3.88Å; F83-I96 HydrophobicContact CD1-CG2 4.39Å; F83-I96 HydrophobicContact CE1-CD1 3.93Å; F83-I96 HydrophobicContact CE1-CG1 3.89Å; F83-I96 HydrophobicContact CE1-CG2 4.06Å; F83-D103 WeakPolarHBondContact CZ-OD1 3.33Å; F83-Y107 HydrophobicContact CE1-CE1 4.14Å
84	S	98.5	Very high	97.8	Very high	44 Å²	44	53.2 Å²	53.2	31%	0.308	35%	0.345	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.6	135.4	174.6	56.1	0	0	0	0	111.3	L94 A95	S84-L94 CarbonylContact O-C 3.54Å; S84-L94 WeakPolarHBondContact O-CA 3.23Å; S84-A95 PolarHBondContact N-O 3.32Å; S84-A95 PolarHBondContact O-N 2.9Å
85	G	98.6	Very high	97.8	Very high	11 Å²	11	49.8 Å²	49.8	11%	0.113	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	152.4	176.4	0	0	0	0	0	112.4	N72 S93	N72-G85 CarbonylContact O-C 2.98Å; N72-G85 VanDerWaalsContact O-CA 3.27Å; N72-G85 WeakPolarHBondContact O-CA 3.34Å; G85-S93 CarbonylContact C-O 3.55Å; G85-S93 WeakPolarHBondContact CA-O 3.38Å
86	S	98.5	Very high	97.9	Very high	60 Å²	60	45 Å²	45	42%	0.42	31%	0.309	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146	160.4	169.8	69.1	0	0	0	0	111.7	N72 A92 S93	N72-S86 PolarHBondContact O-N 2.85Å; S86-A92 CarbonylContact O-C 3.57Å; S86-A92 VanDerWaalsContact O-CA 3.23Å; S86-A92 WeakPolarHBondContact O-CA 3.09Å; S86-A92 WeakPolarHBondContact O-CB 3.31Å; S86-S93 PolarHBondContact N-O 2.81Å; S86-S93 PolarHBondContact O-N 2.91Å; S86-S93 PolarHBondContact OG-OG 2.8Å
87	K	98.2	Very high	97.9	Very high	62 Å²	62	46.3 Å²	46.3	27%	0.27	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.2	137.2	175.4	-171.6	-177.6	74.7	150.1	0	110.2	I48 G51 Y52 V54 N72 S91 A92	I48-K87 HydrophobicContact CG2-CD 3.7Å; I48-K87 HydrophobicContact CG2-CG 3.83Å; G51-K87 VanDerWaalsContact C-NZ 3.3Å; G51-K87 PolarHBondContact O-NZ 3.28Å; Y52-K87 PolarHBondContact O-NZ 2.81Å; V54-K87 HydrophobicContact CG2-CD 4.09Å; N72-K87 HydrophobicContact CB-CB 4.11Å; N72-K87 WeakPolarHBondContact OD1-CD 3.24Å; K87-S91 CarbonylContact C-O 3.58Å; K87-S91 WeakPolarHBondContact CA-O 3.34Å; K87-S91 WeakPolarHBondContact CG-O 3.28Å; K87-A92 HydrophobicContact CB-CB 4.48Å; K87-A92 HydrophobicContact CG-CB 4.42Å
88	S	97.6	Very high	97.9	Very high	98 Å²	98	41.6 Å²	41.6	69%	0.685	29%	0.288	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-148.3	126.1	172.2	-176	0	0	0	0	110.8	T90 S91	S88-T90 PolarHBondContact O-N 3.41Å; S88-S91 CarbonylContact C-O 3.57Å; S88-S91 PolarHBondContact N-O 2.92Å; S88-S91 PolarHBondContact O-N 3.36Å
89	G	96.7	Very high	98	Very high	58 Å²	58	39.9 Å²	39.9	60%	0.598	26%	0.264	S	S	*	.	T	Hydrogen-bonded Turn	trans	55.8	-124.3	-177.4	0	0	0	0	0	112.2	S91	G89-S91 VanDerWaalsContact C-N 3.34Å
90	T	96.8	Very high	98	Very high	60 Å²	60	44 Å²	44	37%	0.368	28%	0.282	S	S	.	.	T	Hydrogen-bonded Turn	trans	-90.5	7.9	175.9	54.6	0	0	0	0	113.4	G43 S88	G43-T90 PolarHBondContact N-O 3.35Å; S88-T90 PolarHBondContact O-N 3.41Å
91	S	97.9	Very high	97.9	Very high	49 Å²	49	45.6 Å²	45.6	34%	0.343	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	149.2	-176.9	-62.7	0	0	0	0	112.3	C41 K87 S88 G89	C41-S91 CarbonylContact O-C 3.51Å; C41-S91 WeakPolarHBondContact O-CA 3.34Å; K87-S91 CarbonylContact C-O 3.58Å; K87-S91 WeakPolarHBondContact CA-O 3.34Å; K87-S91 WeakPolarHBondContact CG-O 3.28Å; S88-S91 CarbonylContact C-O 3.57Å; S88-S91 PolarHBondContact N-O 2.92Å; S88-S91 PolarHBondContact O-N 3.36Å; G89-S91 VanDerWaalsContact C-N 3.34Å
92	A	98.5	Very high	97.9	Very high	5 Å²	5	45.1 Å²	45.1	4%	0.041	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	160.6	169.1	0	0	0	0	0	109.9	C41 I48 V54 W56 S86 K87	C41-A92 PolarHBondContact N-O 2.76Å; C41-A92 PolarHBondContact O-N 2.88Å; I48-A92 HydrophobicContact CD1-CB 4.34Å; V54-A92 HydrophobicContact CB-CB 4.04Å; V54-A92 HydrophobicContact CG1-CB 3.9Å; V54-A92 HydrophobicContact CG2-CB 3.82Å; W56-A92 HydrophobicContact CZ2-CB 4.46Å; S86-A92 CarbonylContact O-C 3.57Å; S86-A92 VanDerWaalsContact O-CA 3.23Å; S86-A92 WeakPolarHBondContact O-CA 3.09Å; S86-A92 WeakPolarHBondContact O-CB 3.31Å; K87-A92 HydrophobicContact CB-CB 4.48Å; K87-A92 HydrophobicContact CG-CB 4.42Å
93	S	98.6	Very high	97.8	Very high	28 Å²	28	44.7 Å²	44.7	20%	0.196	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.4	150	173.5	64.6	0	0	0	0	112.3	I39 W56 G85 S86	I39-S93 CarbonylContact O-C 3.52Å; I39-S93 WeakPolarHBondContact O-CA 3.12Å; W56-S93 VanDerWaalsContact CZ2-C 3.44Å; G85-S93 CarbonylContact C-O 3.55Å; G85-S93 WeakPolarHBondContact CA-O 3.38Å; S86-S93 PolarHBondContact N-O 2.81Å; S86-S93 PolarHBondContact O-N 2.91Å; S86-S93 PolarHBondContact OG-OG 2.8Å
94	L	98.8	Very high	97.8	Very high	0 Å²	0	52.2 Å²	52.2	0%	0	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.4	118.6	165.6	176.7	68.3	0	0	0	107.6	T38 I39 W56 L68 I69 F83 S84 I96 Y107	T38-L94 CarbonylContact C-O 3.55Å; T38-L94 WeakPolarHBondContact CA-O 3.48Å; I39-L94 HydrophobicContact CB-CB 4.49Å; I39-L94 HydrophobicContact CD1-CD2 4.46Å; I39-L94 PolarHBondContact N-O 2.91Å; I39-L94 PolarHBondContact O-N 2.74Å; W56-L94 HydrophobicContact CB-CD1 4.33Å; W56-L94 HydrophobicContact CB-CD2 4.28Å; W56-L94 HydrophobicContact CD2-CB 3.5Å; W56-L94 HydrophobicContact CD2-CD2 4.12Å; W56-L94 HydrophobicContact CD2-CG 4.27Å; W56-L94 HydrophobicContact CE3-CB 3.66Å; W56-L94 HydrophobicContact CE3-CD2 3.83Å; W56-L94 HydrophobicContact CE3-CG 4.35Å; W56-L94 HydrophobicContact CG-CB 4.02Å; W56-L94 HydrophobicContact CG-CD1 4.21Å; W56-L94 HydrophobicContact CG-CD2 4.33Å; W56-L94 HydrophobicContact CG-CG 4.43Å; W56-L94 HydrophobicContact CH2-CB 3.96Å; W56-L94 HydrophobicContact CZ2-CB 3.83Å; W56-L94 VanDerWaalsContact CZ2-N 3.33Å; W56-L94 HydrophobicContact CZ3-CB 3.88Å; W56-L94 HydrophobicContact CZ3-CD2 4.45Å; L68-L94 HydrophobicContact CD1-CD2 4.21Å; I69-L94 HydrophobicContact CG1-CD1 3.75Å; F83-L94 HydrophobicContact CD1-CD1 4.49Å; S84-L94 CarbonylContact O-C 3.54Å; S84-L94 WeakPolarHBondContact O-CA 3.23Å; L94-I96 HydrophobicContact CG-CG1 4.47Å; L94-Y107 HydrophobicContact CD2-CD1 3.55Å; L94-Y107 HydrophobicContact CD2-CE1 3.95Å; L94-Y107 HydrophobicContact CD2-CG 4.44Å
95	A	98.5	Very high	97.8	Very high	4 Å²	4	51.3 Å²	51.3	3%	0.033	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.8	136.2	170.9	0	0	0	0	0	110.2	V37 S84	V37-A95 WeakPolarHBondContact O-CA 3.25Å; S84-A95 PolarHBondContact N-O 3.32Å; S84-A95 PolarHBondContact O-N 2.9Å
96	I	98.5	Very high	97.8	Very high	3 Å²	3	55.2 Å²	55.2	2%	0.015	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	114.5	174	-49.7	175.6	0	0	0	106	R36 V37 I39 Q82 F83 L94 L99 Y107	R36-I96 CarbonylContact C-O 3.57Å; R36-I96 VanDerWaalsContact CA-O 3.32Å; R36-I96 WeakPolarHBondContact CA-O 3.45Å; V37-I96 PolarHBondContact N-O 2.96Å; V37-I96 PolarHBondContact O-N 3.03Å; I39-I96 HydrophobicContact CD1-CD1 4.43Å; Q82-I96 HydrophobicContact CG-CG2 4.36Å; Q82-I96 WeakPolarHBondContact O-CA 3.47Å; F83-I96 HydrophobicContact CD1-CD1 4.37Å; F83-I96 HydrophobicContact CD1-CG1 3.88Å; F83-I96 HydrophobicContact CD1-CG2 4.39Å; F83-I96 HydrophobicContact CE1-CD1 3.93Å; F83-I96 HydrophobicContact CE1-CG1 3.89Å; F83-I96 HydrophobicContact CE1-CG2 4.06Å; L94-I96 HydrophobicContact CG-CG1 4.47Å; I96-L99 HydrophobicContact CG2-CD1 4.13Å; I96-Y107 HydrophobicContact CD1-CE1 3.92Å; I96-Y107 HydrophobicContact CD1-CE2 4.24Å
97	T	98.4	Very high	97.8	Very high	64 Å²	64	53.5 Å²	53.5	39%	0.393	32%	0.321	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	129.6	-178.9	55.3	0	0	0	0	111	R36 Q82	R36-T97 HydrophobicContact CG-CG2 4.01Å; Q82-T97 WeakPolarHBondContact CA-OG1 3.33Å; Q82-T97 VanDerWaalsContact CB-O 3.27Å; Q82-T97 WeakPolarHBondContact CB-O 3.47Å; Q82-T97 PolarHBondContact O-N 2.57Å; Q82-T97 PolarHBondContact O-OG1 2.89Å
98	G	98.2	Very high	97.8	Very high	31 Å²	31	55.3 Å²	55.3	32%	0.32	33%	0.326	S	S	.	.	S	Bend	trans	75.9	48.2	-179.4	0	0	0	0	0	111.5	Q35 Q100	Q35-G98 PolarHBondContact O-N 3.44Å; Q35-G98 VanDerWaalsContact O-N 3.07Å; G98-Q100 VanDerWaalsContact O-CG 3.27Å; G98-Q100 WeakPolarHBondContact O-CG 3.24Å; G98-Q100 PolarHBondContact O-N 3.05Å
99	L	98.2	Very high	97.8	Very high	27 Å²	27	51.5 Å²	51.5	14%	0.141	30%	0.299	C	S	.	.			trans	-45	130.7	-175.9	-170.7	73.5	0	0	0	112.3	G31 P33 G34 Q35 V37 I96 D103	G31-L99 WeakPolarHBondContact O-CD2 3.17Å; P33-L99 CarbonylContact C-O 3.56Å; P33-L99 WeakPolarHBondContact CA-O 3.27Å; G34-L99 PolarHBondContact N-O 3.42Å; Q35-L99 WeakPolarHBondContact O-CB 3.35Å; Q35-L99 PolarHBondContact O-N 2.8Å; V37-L99 HydrophobicContact CG2-CD1 4.39Å; V37-L99 HydrophobicContact CG2-CD2 3.95Å; I96-L99 HydrophobicContact CG2-CD1 4.13Å; L99-D103 HydrophobicContact CD1-CB 3.66Å
100	Q	97.5	Very high	97.8	Very high	101 Å²	101	54.3 Å²	54.3	47%	0.472	30%	0.295	S	S	.	.			trans	-117.5	167.3	179.8	-53.1	-173.2	-25.1	0	0	111.1	G98 E102 D103	G98-Q100 VanDerWaalsContact O-CG 3.27Å; G98-Q100 WeakPolarHBondContact O-CG 3.24Å; G98-Q100 PolarHBondContact O-N 3.05Å; Q100-E102 WeakPolarHBondContact CB-OE2 3.26Å; Q100-E102 PolarHBondContact O-N 2.91Å; Q100-D103 PolarHBondContact N-OD2 3.28Å; Q100-D103 WeakPolarHBondContact O-CB 3.28Å; Q100-D103 PolarHBondContact O-N 2.87Å; Q100-D103 VanDerWaalsContact O-N 3.17Å
101	S	95.7	Very high	97.8	Very high	94 Å²	94	52.3 Å²	52.3	66%	0.657	29%	0.285	S	S	*	.	G	3₁₀ helix	trans	-59.6	-32.6	175.8	31.2	0	0	0	0	112.9	D103 E104	S101-D103 PolarHBondContact O-N 3.02Å; S101-E104 WeakPolarHBondContact O-CB 3.36Å; S101-E104 PolarHBondContact O-N 3.02Å
102	E	95.5	Very high	97.6	Very high	122 Å²	122	57.8 Å²	57.8	57%	0.57	30%	0.298	S	S	*	.	G	3₁₀ helix	trans	-72.6	-12.3	-179.1	-63	77.1	-175.3	0	0	112.8	Q100 E104	Q100-E102 WeakPolarHBondContact CB-OE2 3.26Å; Q100-E102 PolarHBondContact O-N 2.91Å; E102-E104 VanDerWaalsContact C-N 3.29Å
103	D	97.4	Very high	97.3	Very high	11 Å²	11	58.2 Å²	58.2	6%	0.059	30%	0.299	C	S	.	.	G	3₁₀ helix	trans	-84.1	-3.4	175.2	-62	-39.9	0	0	0	112.5	Q82 F83 L99 Q100 S101 A105 Y107	Q82-D103 VanDerWaalsContact NE2-CG 3.28Å; Q82-D103 PolarHBondContact NE2-OD1 2.89Å; Q82-D103 PolarHBondContact NE2-OD2 3.45Å; F83-D103 WeakPolarHBondContact CZ-OD1 3.33Å; L99-D103 HydrophobicContact CD1-CB 3.66Å; Q100-D103 PolarHBondContact N-OD2 3.28Å; Q100-D103 WeakPolarHBondContact O-CB 3.28Å; Q100-D103 PolarHBondContact O-N 2.87Å; Q100-D103 VanDerWaalsContact O-N 3.17Å; S101-D103 PolarHBondContact O-N 3.02Å; D103-A105 PolarHBondContact O-N 2.99Å; D103-Y107 WeakPolarHBondContact O-CE2 3.35Å; D103-Y107 PolarHBondContact O-OH 3.17Å
104	E	97.8	Very high	97	Very high	164 Å²	164	61 Å²	61	77%	0.766	31%	0.312	S	S	*	.			trans	-71.7	100.4	174.1	-169.1	175.1	168	0	0	110.2	S101 E102	S101-E104 WeakPolarHBondContact O-CB 3.36Å; S101-E104 PolarHBondContact O-N 3.02Å; E102-E104 VanDerWaalsContact C-N 3.29Å
105	A	98	Very high	96.6	Very high	25 Å²	25	64 Å²	64	21%	0.207	33%	0.334	C	S	.	.	S	Bend	trans	-158.2	165.9	-172	0	0	0	0	0	111.7	Q58 Q59 L60 D103 Y107	Q58-A105 HydrophobicContact CG-CB 3.47Å; Q58-A105 VanDerWaalsContact CG-CB 3.47Å; Q59-A105 WeakPolarHBondContact O-CB 3.27Å; L60-A105 HydrophobicContact CD2-CB 4.01Å; D103-A105 PolarHBondContact O-N 2.99Å; A105-Y107 HydrophobicContact CB-CD2 4.39Å; A105-Y107 HydrophobicContact CB-CE2 3.83Å; A105-Y107 VanDerWaalsContact O-CD2 3.25Å; A105-Y107 WeakPolarHBondContact O-CD2 3.37Å; A105-Y107 WeakPolarHBondContact O-CE2 3.31Å
106	D	98.3	Very high	96	Very high	94 Å²	94	67.5 Å²	67.5	50%	0.503	35%	0.351	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.9	134.2	163.3	-65.3	-43.3	0	0	0	109.7	Q58 Q59 Y108	Q58-D106 CarbonylContact C-O 3.57Å; Q58-D106 WeakPolarHBondContact CA-O 3.27Å; Q59-D106 HydrophobicContact CB-CB 4.34Å; Q59-D106 PolarHBondContact N-O 2.97Å; Q59-D106 PolarHBondContact O-N 3.31Å; D106-Y108 HydrophobicContact CB-CE2 3.61Å; D106-Y108 WeakPolarHBondContact CB-OH 3.34Å
107	Y	98.5	Very high	94.7	Very high	24 Å²	24	75 Å²	75	9%	0.094	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	134.1	179.8	-69.8	-93	0	0	0	110.9	Q25 I39 Y57 Q58 L68 F83 L94 I96 D103 A105	Q25-Y107 PolarHBondContact NE2-O 2.81Å; I39-Y107 HydrophobicContact CD1-CD1 4.12Å; I39-Y107 HydrophobicContact CD1-CD2 3.65Å; I39-Y107 HydrophobicContact CD1-CE2 4.3Å; I39-Y107 HydrophobicContact CD1-CG 3.54Å; Y57-Y107 WeakPolarHBondContact O-CA 3.37Å; Q58-Y107 HydrophobicContact CB-CD1 4.26Å; Q58-Y107 HydrophobicContact CB-CE1 4.02Å; Q58-Y107 HydrophobicContact CG-CD1 4.41Å; Q58-Y107 HydrophobicContact CG-CE1 3.87Å; Q58-Y107 PolarHBondContact NE2-OH 2.85Å; Q58-Y107 VanDerWaalsContact NE2-OH 3.07Å; L68-Y107 HydrophobicContact CD1-CD1 4.05Å; L68-Y107 HydrophobicContact CD1-CE1 3.63Å; F83-Y107 HydrophobicContact CE1-CE1 4.14Å; L94-Y107 HydrophobicContact CD2-CD1 3.55Å; L94-Y107 HydrophobicContact CD2-CE1 3.95Å; L94-Y107 HydrophobicContact CD2-CG 4.44Å; I96-Y107 HydrophobicContact CD1-CE1 3.92Å; I96-Y107 HydrophobicContact CD1-CE2 4.24Å; D103-Y107 WeakPolarHBondContact O-CE2 3.35Å; D103-Y107 PolarHBondContact O-OH 3.17Å; A105-Y107 HydrophobicContact CB-CD2 4.39Å; A105-Y107 HydrophobicContact CB-CE2 3.83Å; A105-Y107 VanDerWaalsContact O-CD2 3.25Å; A105-Y107 WeakPolarHBondContact O-CD2 3.37Å; A105-Y107 WeakPolarHBondContact O-CE2 3.31Å
108	Y	98.2	Very high	92.8	Very high	99 Å²	99	80.1 Å²	80.1	39%	0.388	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	124.7	-176.5	-55.1	-82	0	0	0	111.6	W56 Y57 Q59 D106	W56-Y108 WeakPolarHBondContact CA-O 3.26Å; Y57-Y108 PolarHBondContact N-O 3.32Å; Y57-Y108 PolarHBondContact O-N 3.27Å; Q59-Y108 HydrophobicContact CB-CE2 3.88Å; Q59-Y108 PolarHBondContact OE1-OH 3.44Å; D106-Y108 HydrophobicContact CB-CE2 3.61Å; D106-Y108 WeakPolarHBondContact CB-OH 3.34Å
109	C	98	Very high	92.6	Very high	18 Å²	18	82.6 Å²	82.6	12%	0.122	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.7	144.9	164.6	69.7	0	0	0	0	111.1	Q25 C41 V54 H55 W56	Q25-C109 VanDerWaalsContact OE1-CB 3.29Å; Q25-C109 PolarHBondContact OE1-SG 2.86Å; C41-C109 HydrophobicContact CB-CB 3.46Å; C41-C109 VanDerWaalsContact CB-CB 3.46Å; C41-C109 WeakPolarHBondContact CB-SG 3.45Å; C41-C109 WeakPolarHBondContact SG-CB 3.32Å; C41-C109 CovalentContact SG-SG 2.03Å; C41-C109 PolarHBondContact SG-SG 2.96Å; V54-C109 HydrophobicContact CG1-CB 4.11Å; H55-C109 CarbonylContact O-C 3.56Å; H55-C109 WeakPolarHBondContact O-CA 3.37Å; W56-C109 HydrophobicContact CD2-CB 4.26Å; W56-C109 HydrophobicContact CE3-CB 4.07Å; W56-C109 HydrophobicContact CH2-CB 3.99Å; W56-C109 HydrophobicContact CZ2-CB 4.15Å; W56-C109 HydrophobicContact CZ3-CB 3.94Å
110	K	96.9	Very high	92.3	Very high	117 Å²	117	85.5 Å²	85.5	51%	0.509	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.7	135.1	175.6	-176.9	-165.7	175.9	-160.3	0	109.9	V54 H55 Y57	V54-K110 WeakPolarHBondContact CA-O 3.35Å; H55-K110 HydrophobicContact CB-CB 4.43Å; H55-K110 PolarHBondContact N-O 3.16Å; H55-K110 PolarHBondContact O-N 3.25Å; Y57-K110 HydrophobicContact CD2-CB 4.43Å; Y57-K110 HydrophobicContact CE2-CB 3.99Å; Y57-K110 HydrophobicContact CE2-CD 4.05Å
111	A	96.3	Very high	92	Very high	18 Å²	18	84.7 Å²	84.7	15%	0.149	46%	0.462	C	S	.	.			trans	-139.6	155.5	170.1	0	0	0	0	0	109	L23 N47 I48 V54	L23-A111 HydrophobicContact CD1-CB 3.94Å; L23-A111 HydrophobicContact CD2-CB 4.38Å; N47-A111 HydrophobicContact CB-CB 4.42Å; I48-A111 HydrophobicContact CG1-CB 4.06Å; V54-A111 HydrophobicContact CG2-CB 4.32Å
112	W	94.6	Very high	91.8	Very high	164 Å²	164	84.1 Å²	84.1	62%	0.621	45%	0.45	S	S	*	.			trans	-70.8	145.2	167.6	-177.8	-88.7	0	0	0	109.8	N47 Y52	N47-W112 VanDerWaalsContact CA-O 3.26Å; N47-W112 WeakPolarHBondContact CA-O 3.35Å; N47-W112 WeakPolarHBondContact CB-O 3.45Å; Y52-W112 HydrophobicContact CD1-CB 3.86Å; Y52-W112 HydrophobicContact CD1-CG 4.22Å; Y52-W112 HydrophobicContact CD2-CB 4.22Å; Y52-W112 AromaticContact CD2-CD1 4Å; Y52-W112 VanDerWaalsContact CD2-O 3.27Å; Y52-W112 WeakPolarHBondContact CD2-O 3.48Å; Y52-W112 HydrophobicContact CE1-CB 4.27Å; Y52-W112 AromaticContact CE1-CD1 3.58Å; Y52-W112 HydrophobicContact CE1-CG 4.14Å; Y52-W112 AromaticContact CE2-CD1 3.58Å; Y52-W112 HydrophobicContact CE2-CG 4.49Å; Y52-W112 HydrophobicContact CG-CB 3.85Å; Y52-W112 HydrophobicContact CG-CG 4.45Å; Y52-W112 AromaticContact CZ-CD1 3.36Å
113	D	92.7	Very high	91.6	Very high	14 Å²	14	81.8 Å²	81.8	8%	0.075	44%	0.443	C	S	.	.			trans	-122.2	119	173.3	-163.3	-47.5	0	0	0	109.1	S21 S46 N47 S115 L116	S21-D113 VanDerWaalsContact CB-OD2 3.24Å; S21-D113 WeakPolarHBondContact CB-OD2 3.48Å; S21-D113 PolarHBondContact OG-OD2 3.01Å; S46-D113 VanDerWaalsContact CB-OD1 3.28Å; S46-D113 WeakPolarHBondContact CB-OD1 3.32Å; S46-D113 VanDerWaalsContact OG-CG 3.31Å; S46-D113 PolarHBondContact OG-OD1 2.8Å; S46-D113 PolarHBondContact OG-OD2 3.25Å; S46-D113 VanDerWaalsContact OG-OD2 3.05Å; N47-D113 HydrophobicContact CB-CB 4.08Å; N47-D113 PolarHBondContact ND2-OD2 2.83Å; D113-S115 VanDerWaalsContact C-N 3.27Å; D113-S115 PolarHBondContact O-N 3.04Å; D113-S115 VanDerWaalsContact OD1-CB 3.31Å; D113-S115 WeakPolarHBondContact OD1-CB 3.41Å; D113-S115 PolarHBondContact OD1-N 2.85Å; D113-S115 PolarHBondContact OD1-OG 3Å; D113-L116 HydrophobicContact CB-CD1 3.9Å; D113-L116 HydrophobicContact CB-CG 3.99Å
114	N	92.1	Very high	91.2	Very high	86 Å²	86	86.5 Å²	86.5	46%	0.46	47%	0.468	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.4	-3.6	-177.9	66.3	12.2	0	0	0	114.4	S46 Y52	S46-N114 WeakPolarHBondContact CA-OD1 3.25Å; S46-N114 VanDerWaalsContact CB-OD1 3.24Å; S46-N114 WeakPolarHBondContact CB-OD1 3.48Å; S46-N114 VanDerWaalsContact O-CG 3.29Å; S46-N114 PolarHBondContact O-N 3.07Å; S46-N114 PolarHBondContact O-OD1 3.2Å; Y52-N114 HydrophobicContact CE2-CB 3.86Å; Y52-N114 WeakPolarHBondContact OH-CB 3.34Å
115	S	89.6	Confident	90.7	Very high	65 Å²	65	80.9 Å²	80.9	46%	0.455	45%	0.447	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.3	-14.5	172.8	70.8	0	0	0	0	112.9	D113	D113-S115 VanDerWaalsContact C-N 3.27Å; D113-S115 PolarHBondContact O-N 3.04Å; D113-S115 VanDerWaalsContact OD1-CB 3.31Å; D113-S115 WeakPolarHBondContact OD1-CB 3.41Å; D113-S115 PolarHBondContact OD1-N 2.85Å; D113-S115 PolarHBondContact OD1-OG 3Å
116	L	84.9	Confident	90.1	Very high	77 Å²	77	85.2 Å²	85.2	40%	0.403	47%	0.466	S	S	.	.			trans	-91.2	119.4	-179.9	-58.6	179.7	0	0	0	109.5	Q20 D113	Q20-L116 HydrophobicContact CG-CD2 3.98Å; D113-L116 HydrophobicContact CB-CD1 3.9Å; D113-L116 HydrophobicContact CB-CG 3.99Å
117	N	72.6	Confident	89.5	Confident	161 Å²	161	84.5 Å²	84.5	86%	0.861	46%	0.462	S	S	*	.			trans	-81.3	134.9	163.7	-64.1	-44.3	0	0	0	108.2
118	A	59.1	Low	88.6	Confident	171 Å²	171	90 Å²	90	100%	1.413	50%	0.496	S	S	*	.			trans	-74.4	0	171.8	0	0	0	0	0	111.8

Retrieved 118 of 118 residues in 80.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).