LV548_HUMAN Loading...

Probable non-functional immunoglobulin lambda variable 5-48

Probable non-functional open reading frame (ORF) of V region of the variable domain of immunoglobulin light chains¹. Non-functional ORF generally cannot participate in the synthesis of a productive immunoglobulin chain due to altered V-(D)-J or switch recombination and/or splicing site (at mRNA level) and/or conserved amino acid change (protein level)². Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens^3,4. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen^5,6.

AlphaFold DB , UniProt , Accession A0A075B6I7, Species HUMAN (Homo sapiens, Human), Gene IGLV5-48, Length 105 aa.

						>LV548_HUMAN|A0A075B6I7|IGLV5-48
MAWTPLLLLFLSHCTGSLSQAVLTQPTSLSASPGASARLTCTLRSGISVGSYRIYWYQQKPGSPPRYLLNYYSDSDKHQGSGVPSRFSGSKDASTNAGILFISGL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.3	Low	65.3	Low	239 Å²	239	128.5 Å²	128.5	100%	1.177	67%	0.665	S	S	*	*				0	59.7	0	-67.3	170.6	-173.7	0	0	110.7
2	A	68.3	Low	65.2	Low	75 Å²	75	124.7 Å²	124.7	62%	0.62	66%	0.658	S	S	*	*			trans	-132	14.4	-171.5	0	0	0	0	0	114.6	P5	A2-P5 WeakPolarHBondContact O-CD 3.11Å
3	W	63.6	Low	64.8	Low	201 Å²	201	125.5 Å²	125.5	76%	0.761	66%	0.656	S	S	*	*			trans	-92.8	-14	-177.4	-66.4	59.2	0	0	0	112.9	L6 L7	W3-L6 PolarHBondContact O-N 3.39Å; W3-L6 VanDerWaalsContact O-N 3.14Å; W3-L7 PolarHBondContact O-N 2.98Å
4	T	67.8	Low	64.6	Low	91 Å²	91	124.6 Å²	124.6	56%	0.558	66%	0.664	S	S	*	*	H	α-helix	trans	-51.2	-44.9	175.3	-1.5	0	0	0	0	114.1	L6 L7 L8	T4-L6 PolarHBondContact O-N 2.75Å; T4-L7 PolarHBondContact O-N 3.3Å; T4-L8 WeakPolarHBondContact O-CG 3.47Å; T4-L8 PolarHBondContact O-N 3.16Å; T4-L8 VanDerWaalsContact O-N 3.14Å
5	P	66.6	Low	64.7	Low	82 Å²	82	124.3 Å²	124.3	53%	0.532	67%	0.669	S	S	.	*	H	α-helix	trans	-67.8	-32.9	177.6	23.9	-32.8	0	0	0	113.3	A2 L8 L9	A2-P5 WeakPolarHBondContact O-CD 3.11Å; P5-L8 PolarHBondContact O-N 2.97Å; P5-L9 PolarHBondContact O-N 3.21Å
6	L	69.3	Low	64.7	Low	101 Å²	101	120.6 Å²	120.6	53%	0.529	67%	0.668	S	S	.	*	H	α-helix	trans	-67.5	-41.9	178.7	-152	91.8	0	0	0	111	W3 T4 L9 F10	W3-L6 PolarHBondContact O-N 3.39Å; W3-L6 VanDerWaalsContact O-N 3.14Å; T4-L6 PolarHBondContact O-N 2.75Å; L6-L9 WeakPolarHBondContact O-CB 3.43Å; L6-L9 PolarHBondContact O-N 3.26Å; L6-F10 HydrophobicContact CD2-CE2 4.15Å; L6-F10 HydrophobicContact CG-CE2 4.34Å; L6-F10 VanDerWaalsContact O-CD2 3.32Å; L6-F10 WeakPolarHBondContact O-CD2 3.28Å; L6-F10 PolarHBondContact O-N 3.25Å; L6-F10 VanDerWaalsContact O-N 3.09Å
7	L	67.5	Low	65	Low	109 Å²	109	119.9 Å²	119.9	57%	0.571	67%	0.674	S	S	*	*	H	α-helix	trans	-63.2	-42.9	175.4	-75.1	165.4	0	0	0	111.9	W3 T4 L9 F10 L11	W3-L7 PolarHBondContact O-N 2.98Å; T4-L7 PolarHBondContact O-N 3.3Å; L7-L9 VanDerWaalsContact C-N 3.3Å; L7-L9 PolarHBondContact O-N 2.99Å; L7-F10 PolarHBondContact O-N 3.42Å; L7-L11 WeakPolarHBondContact O-CD1 3.35Å; L7-L11 PolarHBondContact O-N 2.81Å; L7-L11 VanDerWaalsContact O-N 3.12Å
8	L	67	Low	65.1	Low	122 Å²	122	122.8 Å²	122.8	64%	0.639	69%	0.686	S	S	*	*	H	α-helix	trans	-63.8	-36	175.8	-72.2	166.3	0	0	0	112.1	T4 P5 L11 S12	T4-L8 WeakPolarHBondContact O-CG 3.47Å; T4-L8 PolarHBondContact O-N 3.16Å; T4-L8 VanDerWaalsContact O-N 3.14Å; P5-L8 PolarHBondContact O-N 2.97Å; L8-L11 PolarHBondContact O-N 3.35Å; L8-S12 PolarHBondContact O-N 2.74Å
9	L	66.3	Low	65.2	Low	114 Å²	114	121.8 Å²	121.8	60%	0.597	69%	0.689	S	S	*	*	H	α-helix	trans	-61.7	-48.8	173.2	-141.1	85.8	0	0	0	110.3	P5 L6 L7 L11 S12 H13	P5-L9 PolarHBondContact O-N 3.21Å; L6-L9 WeakPolarHBondContact O-CB 3.43Å; L6-L9 PolarHBondContact O-N 3.26Å; L7-L9 VanDerWaalsContact C-N 3.3Å; L7-L9 PolarHBondContact O-N 2.99Å; L9-L11 VanDerWaalsContact C-N 3.35Å; L9-L11 PolarHBondContact O-N 3.26Å; L9-S12 WeakPolarHBondContact O-CB 3.31Å; L9-S12 PolarHBondContact O-N 3.09Å; L9-S12 VanDerWaalsContact O-N 3.11Å; L9-H13 PolarHBondContact O-CE1 2.99Å; L9-H13 PolarHBondContact O-ND1 2.79Å
10	F	63.2	Low	65.5	Low	147 Å²	147	124.1 Å²	124.1	65%	0.645	69%	0.693	S	S	*	*	H	α-helix	trans	-59.1	-39.9	179	-87	-73.9	0	0	0	113.4	L6 L7 S12	L6-F10 HydrophobicContact CD2-CE2 4.15Å; L6-F10 HydrophobicContact CG-CE2 4.34Å; L6-F10 VanDerWaalsContact O-CD2 3.32Å; L6-F10 WeakPolarHBondContact O-CD2 3.28Å; L6-F10 PolarHBondContact O-N 3.25Å; L6-F10 VanDerWaalsContact O-N 3.09Å; L7-F10 PolarHBondContact O-N 3.42Å; F10-S12 VanDerWaalsContact C-N 3.3Å; F10-S12 PolarHBondContact O-N 2.97Å
11	L	62.7	Low	65.9	Low	132 Å²	132	121.2 Å²	121.2	69%	0.691	69%	0.686	S	S	*	*	H	α-helix	trans	-67.9	-26.6	176.9	-87.4	88.2	0	0	0	113.6	L7 L8 L9 H13	L7-L11 WeakPolarHBondContact O-CD1 3.35Å; L7-L11 PolarHBondContact O-N 2.81Å; L7-L11 VanDerWaalsContact O-N 3.12Å; L8-L11 PolarHBondContact O-N 3.35Å; L9-L11 VanDerWaalsContact C-N 3.35Å; L9-L11 PolarHBondContact O-N 3.26Å; L11-H13 VanDerWaalsContact C-N 3.27Å; L11-H13 PolarHBondContact O-N 2.93Å
12	S	63.6	Low	67.4	Low	83 Å²	83	113.6 Å²	113.6	58%	0.58	65%	0.652	S	S	*	*	H	α-helix	trans	-66.6	-24.6	-179.4	-174.8	0	0	0	0	113.6	L8 L9 F10 C14	L8-S12 PolarHBondContact O-N 2.74Å; L9-S12 WeakPolarHBondContact O-CB 3.31Å; L9-S12 PolarHBondContact O-N 3.09Å; L9-S12 VanDerWaalsContact O-N 3.11Å; F10-S12 VanDerWaalsContact C-N 3.3Å; F10-S12 PolarHBondContact O-N 2.97Å; S12-C14 VanDerWaalsContact C-N 3.25Å; S12-C14 PolarHBondContact O-N 3Å
13	H	60.5	Low	68.4	Low	135 Å²	135	114.8 Å²	114.8	63%	0.625	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.2	0.7	-173.3	-57.3	92.4	0	0	0	114.9	L9 L11	L9-H13 PolarHBondContact O-CE1 2.99Å; L9-H13 PolarHBondContact O-ND1 2.79Å; L11-H13 VanDerWaalsContact C-N 3.27Å; L11-H13 PolarHBondContact O-N 2.93Å
14	C	61.9	Low	69.9	Low	114 Å²	114	109.8 Å²	109.8	77%	0.77	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.8	23.4	-177.9	-71.8	0	0	0	0	114.2	S12 G16	S12-C14 VanDerWaalsContact C-N 3.25Å; S12-C14 PolarHBondContact O-N 3Å; C14-G16 PolarHBondContact O-N 3.28Å
15	T	65.5	Low	71.1	Confident	120 Å²	120	111.3 Å²	111.3	74%	0.736	64%	0.64	S	S	*	*			trans	-82.3	62.8	166.3	-45.9	0	0	0	0	109.6	S17	T15-S17 PolarHBondContact O-N 3.26Å
16	G	65.3	Low	72.4	Confident	64 Å²	64	110.6 Å²	110.6	66%	0.66	64%	0.635	S	S	*	*			trans	-68.3	99.8	166.6	0	0	0	0	0	108.4	C14 L18	C14-G16 PolarHBondContact O-N 3.28Å; G16-L18 PolarHBondContact O-N 2.89Å
17	S	69.1	Low	73.6	Confident	109 Å²	109	112.9 Å²	112.9	76%	0.762	65%	0.654	S	S	*	*			trans	-66.3	101.6	167.8	-61.6	0	0	0	0	108	T15 S19	T15-S17 PolarHBondContact O-N 3.26Å; S17-S19 VanDerWaalsContact C-N 3.31Å; S17-S19 PolarHBondContact O-N 2.86Å
18	L	66.7	Low	74.9	Confident	172 Å²	172	112.2 Å²	112.2	90%	0.901	66%	0.658	S	S	*	*			trans	-62.8	95.7	168.6	-64.5	171.6	0	0	0	107.3	G16 Q20	G16-L18 PolarHBondContact O-N 2.89Å; L18-Q20 PolarHBondContact O-N 2.85Å
19	S	67.2	Low	76.2	Confident	104 Å²	104	110.5 Å²	110.5	73%	0.727	65%	0.649	S	S	*	*			trans	-66.8	106.8	175.2	66.8	0	0	0	0	108.1	S17	S17-S19 VanDerWaalsContact C-N 3.31Å; S17-S19 PolarHBondContact O-N 2.86Å
20	Q	71.7	Confident	77.6	Confident	168 Å²	168	110.7 Å²	110.7	79%	0.785	66%	0.66	S	S	*	*	P	Polyproline II helix	trans	-64.1	139.8	175.3	-171.4	174.2	4.2	0	0	109.9	L18 V22	L18-Q20 PolarHBondContact O-N 2.85Å; Q20-V22 PolarHBondContact O-N 3.4Å
21	A	74.5	Confident	79	Confident	64 Å²	64	106 Å²	106	53%	0.529	65%	0.649	S	S	.	*	P	Polyproline II helix	trans	-62.6	117.9	171.6	0	0	0	0	0	109.2	I47	A21-I47 HydrophobicContact CB-CD1 3.57Å
22	V	86.3	Confident	80.6	Confident	78 Å²	78	103.8 Å²	103.8	47%	0.473	64%	0.644	S	S	.	*	P	Polyproline II helix	trans	-99.5	131.7	177.8	-177.7	0	0	0	0	108.8	Q20 R44	Q20-V22 PolarHBondContact O-N 3.4Å; V22-R44 PolarHBondContact O-N 3.48Å
23	L	90.9	Very high	82.2	Confident	100 Å²	100	105.9 Å²	105.9	52%	0.524	66%	0.656	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-106	138.6	174.7	-64	175.9	0	0	0	109.5	T42 L43	L23-T42 WeakPolarHBondContact CA-O 3.26Å; L23-L43 HydrophobicContact CD2-CD1 3.89Å; L23-L43 HydrophobicContact CD2-CG 3.76Å
24	T	94.2	Very high	83.8	Confident	96 Å²	96	102.2 Å²	102.2	59%	0.589	66%	0.655	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-115.6	127.2	175.7	-56.8	0	0	0	0	109.6	T42	T24-T42 PolarHBondContact N-O 3.04Å; T24-T42 PolarHBondContact O-N 3.44Å
25	Q	94.1	Very high	85.5	Confident	124 Å²	124	98.5 Å²	98.5	58%	0.579	63%	0.632	S	S	*	*			trans	-144.4	159.1	179.2	61.2	175.5	70.6	0	0	110.9	T40	Q25-T40 WeakPolarHBondContact CB-O 3.2Å
26	P	93.9	Very high	87	Confident	66 Å²	66	97 Å²	97	43%	0.429	63%	0.626	S	S	.	*			trans	-57.6	142.5	170.5	-22.3	33.5	0	0	0	111.6	T40	P26-T40 VanDerWaalsContact CD-O 3.31Å; P26-T40 WeakPolarHBondContact CD-O 3.32Å
27	T	94	Very high	88.5	Confident	149 Å²	149	94.3 Å²	94.3	91%	0.914	60%	0.598	S	S	*	*	S	Bend	trans	-73.6	-30.5	178.3	50.1	0	0	0	0	112.5
28	S	94.7	Very high	89.8	Confident	95 Å²	95	95.6 Å²	95.6	66%	0.664	59%	0.586	S	S	*	*			trans	-151.4	157.5	175.9	63.6	0	0	0	0	110.8
29	L	94	Very high	91.3	Very high	86 Å²	86	89.8 Å²	89.8	45%	0.45	56%	0.556	S	S	.	*			trans	-140.8	137.9	172.3	-173.4	83.1	0	0	0	107.5	A37 L39	L29-A37 HydrophobicContact CD2-CB 3.44Å; L29-A37 VanDerWaalsContact CD2-CB 3.44Å; L29-L39 HydrophobicContact CB-CD2 3.93Å; L29-L39 HydrophobicContact CD2-CD2 3.78Å; L29-L39 HydrophobicContact CD2-CG 4.37Å; L29-L39 HydrophobicContact CG-CD2 4.41Å
30	S	94.6	Very high	92.7	Very high	119 Å²	119	86.3 Å²	86.3	83%	0.832	53%	0.53	S	S	*	.			trans	-125.1	145.7	171.4	-65.3	0	0	0	0	109.3
31	A	93.7	Very high	93.8	Very high	49 Å²	49	78.9 Å²	78.9	41%	0.405	50%	0.497	S	S	.	.			trans	-150.7	151	178.6	0	0	0	0	0	109.6	A35 L105	A31-A35 HydrophobicContact CB-CB 4.33Å; A31-L105 HydrophobicContact CB-CD1 3.43Å; A31-L105 VanDerWaalsContact CB-CD1 3.43Å
32	S	96.4	Very high	94.8	Very high	85 Å²	85	78.1 Å²	78.1	59%	0.594	49%	0.486	S	S	*	.			trans	-69.1	152.5	178.9	-55.5	0	0	0	0	111.4	G34 A35	S32-G34 PolarHBondContact O-N 3.15Å; S32-A35 WeakPolarHBondContact O-CB 3.36Å; S32-A35 PolarHBondContact O-N 3.19Å
33	P	96.2	Very high	95.1	Very high	126 Å²	126	75.2 Å²	75.2	82%	0.818	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.5	136.5	171.3	-25.8	35	0	0	0	111.8	A35	P33-A35 PolarHBondContact O-N 3.39Å
34	G	95.8	Very high	95	Very high	59 Å²	59	77.7 Å²	77.7	61%	0.608	47%	0.47	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.9	-12.3	-175.2	0	0	0	0	0	115	S32 L105	S32-G34 PolarHBondContact O-N 3.15Å; G34-L105 PolarHBondContact N-O 3.48Å
35	A	97.1	Very high	94.5	Very high	35 Å²	35	78.1 Å²	78.1	29%	0.289	48%	0.476	S	S	.	.			trans	-73.5	165	176.6	0	0	0	0	0	111.8	A31 S32 P33 G104 L105	A31-A35 HydrophobicContact CB-CB 4.33Å; S32-A35 WeakPolarHBondContact O-CB 3.36Å; S32-A35 PolarHBondContact O-N 3.19Å; P33-A35 PolarHBondContact O-N 3.39Å; A35-G104 PolarHBondContact O-N 3.48Å; A35-L105 PolarHBondContact O-N 3.14Å
36	S	97	Very high	94.1	Very high	89 Å²	89	76.4 Å²	76.4	62%	0.622	49%	0.492	S	S	*	.			trans	-99	142.3	170.9	-61.3	0	0	0	0	110.7	I102	S36-I102 CarbonylContact C-O 3.48Å; S36-I102 WeakPolarHBondContact CA-O 3.46Å
37	A	96.5	Very high	93.8	Very high	8 Å²	8	75.4 Å²	75.4	7%	0.066	48%	0.483	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	144.5	172.6	0	0	0	0	0	111.2	L29 F101 I102 L105	L29-A37 HydrophobicContact CD2-CB 3.44Å; L29-A37 VanDerWaalsContact CD2-CB 3.44Å; A37-F101 WeakPolarHBondContact O-CA 3.32Å; A37-I102 HydrophobicContact CB-CB 4.3Å; A37-I102 PolarHBondContact N-O 3.14Å; A37-I102 PolarHBondContact O-N 3.43Å; A37-L105 HydrophobicContact CB-CD1 3.69Å; A37-L105 HydrophobicContact CB-CG 4.47Å
38	R	96.8	Very high	93.8	Very high	135 Å²	135	71.2 Å²	71.2	51%	0.509	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.2	114.2	173.4	175.2	-177.6	152	-164	-2.6	108.7	I99 L100 F101	R38-I99 HydrophobicContact CG-CG2 3.76Å; R38-L100 WeakPolarHBondContact CA-O 3.34Å; R38-F101 HydrophobicContact CB-CD1 4.23Å; R38-F101 HydrophobicContact CB-CE1 4.27Å; R38-F101 HydrophobicContact CG-CD1 4.26Å; R38-F101 HydrophobicContact CG-CE1 3.93Å
39	L	96.8	Very high	93.8	Very high	51 Å²	51	66.8 Å²	66.8	27%	0.267	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.6	132.3	173.6	-64.7	171.4	0	0	0	109	L29 W56 I99 L100 I102	L29-L39 HydrophobicContact CB-CD2 3.93Å; L29-L39 HydrophobicContact CD2-CD2 3.78Å; L29-L39 HydrophobicContact CD2-CG 4.37Å; L29-L39 HydrophobicContact CG-CD2 4.41Å; L39-W56 HydrophobicContact CB-CH2 4.36Å; L39-W56 HydrophobicContact CB-CZ3 4.33Å; L39-I99 WeakPolarHBondContact O-CA 3.29Å; L39-L100 HydrophobicContact CB-CB 4.3Å; L39-L100 HydrophobicContact CD1-CD2 4.18Å; L39-L100 PolarHBondContact N-O 3.01Å; L39-L100 PolarHBondContact O-N 3.29Å; L39-I102 HydrophobicContact CD1-CD1 4.24Å
40	T	96.9	Very high	93.8	Very high	31 Å²	31	64.4 Å²	64.4	19%	0.19	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	135.6	-177.4	-54.3	0	0	0	0	109.1	Q25 P26 A97	Q25-T40 WeakPolarHBondContact CB-O 3.2Å; P26-T40 VanDerWaalsContact CD-O 3.31Å; P26-T40 WeakPolarHBondContact CD-O 3.32Å; T40-A97 HydrophobicContact CG2-CB 3.62Å
41	C	95.1	Very high	93.7	Very high	11 Å²	11	62.6 Å²	62.6	7%	0.074	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	108	176.1	-179.4	0	0	0	0	108.9	W56 A97 G98	C41-W56 HydrophobicContact CB-CH2 3.88Å; C41-W56 HydrophobicContact CB-CZ2 4.36Å; C41-A97 CarbonylContact O-C 3.52Å; C41-A97 VanDerWaalsContact O-CA 3.28Å; C41-A97 WeakPolarHBondContact O-CA 3.47Å; C41-G98 PolarHBondContact N-O 2.92Å; C41-G98 PolarHBondContact O-N 3.24Å
42	T	95.8	Very high	93.6	Very high	49 Å²	49	66.5 Å²	66.5	30%	0.301	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.8	132.7	-175.6	-59.4	0	0	0	0	110.8	L23 T24 T95	L23-T42 WeakPolarHBondContact CA-O 3.26Å; T24-T42 PolarHBondContact N-O 3.04Å; T24-T42 PolarHBondContact O-N 3.44Å; T42-T95 WeakPolarHBondContact CG2-O 3.41Å
43	L	93.5	Very high	93.5	Very high	16 Å²	16	65.5 Å²	65.5	8%	0.084	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.7	140.2	173.9	-74	69.8	0	0	0	109.4	L23 I47 V49 I54 N96	L23-L43 HydrophobicContact CD2-CD1 3.89Å; L23-L43 HydrophobicContact CD2-CG 3.76Å; L43-I47 HydrophobicContact CD2-CB 4.43Å; L43-I47 HydrophobicContact CD2-CG2 3.75Å; L43-V49 HydrophobicContact CD1-CB 4.3Å; L43-V49 HydrophobicContact CD1-CG2 4.01Å; L43-V49 HydrophobicContact CD2-CB 4.38Å; L43-I54 HydrophobicContact CD1-CD1 4.25Å; L43-N96 WeakPolarHBondContact CB-ND2 3.22Å; L43-N96 PolarHBondContact N-O 2.71Å; L43-N96 PolarHBondContact O-ND2 3.34Å
44	R	88.1	Confident	93.5	Very high	153 Å²	153	60.5 Å²	60.5	58%	0.577	37%	0.367	S	S	*	.	P	Polyproline II helix	trans	-57.5	154.1	173.3	-172.2	178.2	177.4	-159.6	-0.5	111.5	V22 I47	V22-R44 PolarHBondContact O-N 3.48Å; R44-I47 PolarHBondContact O-N 2.85Å
45	S	84	Confident	93.5	Very high	104 Å²	104	63.6 Å²	63.6	73%	0.727	36%	0.361	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.2	143.9	170.9	53.9	0	0	0	0	112.5
46	G	85.4	Confident	93.6	Very high	89 Å²	89	63.2 Å²	63.2	92%	0.918	35%	0.352	S	S	*	.	T	Hydrogen-bonded Turn	trans	92.2	-13.5	-175.9	0	0	0	0	0	114.6
47	I	88.5	Confident	93.5	Very high	45 Å²	45	65.8 Å²	65.8	23%	0.231	35%	0.349	C	S	.	.	S	Bend	trans	-118.1	115.1	176	-52.1	179.9	0	0	0	108.6	A21 L43 R44 Y52 N96	A21-I47 HydrophobicContact CB-CD1 3.57Å; L43-I47 HydrophobicContact CD2-CB 4.43Å; L43-I47 HydrophobicContact CD2-CG2 3.75Å; R44-I47 PolarHBondContact O-N 2.85Å; I47-Y52 HydrophobicContact CG2-CD2 3.61Å; I47-Y52 HydrophobicContact CG2-CE2 3.26Å; I47-N96 PolarHBondContact O-ND2 3.23Å; I47-N96 PolarHBondContact O-OD1 3.26Å
48	S	92.6	Very high	93.5	Very high	61 Å²	61	68.3 Å²	68.3	43%	0.427	36%	0.36	S	S	.	.			trans	-83	123.2	178.6	174.7	0	0	0	0	111.5	G50 S51 Y52	S48-G50 PolarHBondContact O-N 2.93Å; S48-G50 VanDerWaalsContact O-N 3.12Å; S48-G50 PolarHBondContact OG-N 2.83Å; S48-S51 PolarHBondContact O-N 2.89Å; S48-Y52 VanDerWaalsContact O-CD2 3.29Å; S48-Y52 WeakPolarHBondContact O-CD2 3.42Å
49	V	94.9	Very high	93.4	Very high	1 Å²	1	68.1 Å²	68.1	1%	0.006	37%	0.365	C	S	.	.	G	3₁₀ helix	trans	-57.2	-26.2	174.2	71.9	0	0	0	0	112.9	L43 S51 Y52 I54 K91 N96	L43-V49 HydrophobicContact CD1-CB 4.3Å; L43-V49 HydrophobicContact CD1-CG2 4.01Å; L43-V49 HydrophobicContact CD2-CB 4.38Å; V49-S51 VanDerWaalsContact C-N 3.29Å; V49-S51 PolarHBondContact O-N 2.91Å; V49-Y52 PolarHBondContact O-N 3.37Å; V49-I54 HydrophobicContact CG2-CD1 4.06Å; V49-I54 HydrophobicContact CG2-CG1 4.23Å; V49-K91 HydrophobicContact CG2-CB 4.25Å; V49-K91 HydrophobicContact CG2-CD 4.1Å; V49-K91 HydrophobicContact CG2-CG 3.9Å; V49-K91 WeakPolarHBondContact O-CE 3.28Å; V49-K91 PolarHBondContact O-NZ 3.3Å; V49-N96 PolarHBondContact N-OD1 3.11Å
50	G	93.7	Very high	93.4	Very high	37 Å²	37	71.9 Å²	71.9	38%	0.381	38%	0.379	S	S	.	.	G	3₁₀ helix	trans	-63.2	-35.9	175.7	0	0	0	0	0	112.6	S48 Y52	S48-G50 PolarHBondContact O-N 2.93Å; S48-G50 VanDerWaalsContact O-N 3.12Å; S48-G50 PolarHBondContact OG-N 2.83Å; G50-Y52 PolarHBondContact O-N 3.32Å
51	S	92.5	Very high	93.3	Very high	81 Å²	81	76.8 Å²	76.8	57%	0.566	41%	0.411	S	S	*	.	G	3₁₀ helix	trans	-79.7	-13.8	-175.2	-54.3	0	0	0	0	114.1	S48 V49	S48-S51 PolarHBondContact O-N 2.89Å; V49-S51 VanDerWaalsContact C-N 3.29Å; V49-S51 PolarHBondContact O-N 2.91Å
52	Y	91.8	Very high	93.4	Very high	130 Å²	130	80.7 Å²	80.7	51%	0.51	45%	0.453	S	S	.	.	S	Bend	trans	-121.3	144.7	-172.8	-65.6	-83.7	0	0	0	112.6	I47 S48 V49 G50 K91	I47-Y52 HydrophobicContact CG2-CD2 3.61Å; I47-Y52 HydrophobicContact CG2-CE2 3.26Å; S48-Y52 VanDerWaalsContact O-CD2 3.29Å; S48-Y52 WeakPolarHBondContact O-CD2 3.42Å; V49-Y52 PolarHBondContact O-N 3.37Å; G50-Y52 PolarHBondContact O-N 3.32Å; Y52-K91 WeakPolarHBondContact O-CE 3.33Å; Y52-K91 PolarHBondContact O-NZ 3Å
53	R	95.1	Very high	93.5	Very high	64 Å²	64	81 Å²	81	24%	0.242	46%	0.457	C	S	.	.			trans	-77.4	131.3	169.4	-174.5	176.7	-64	-90.6	-1.1	109.5	Y55 N70 Y72 D76	R53-Y55 HydrophobicContact CB-CE2 3.89Å; R53-Y55 WeakPolarHBondContact CD-OH 3.48Å; R53-Y55 HydrophobicContact CG-CD2 4.42Å; R53-Y55 HydrophobicContact CG-CE1 4.48Å; R53-Y55 HydrophobicContact CG-CE2 3.92Å; R53-Y55 WeakPolarHBondContact O-CD2 3.35Å; R53-N70 WeakPolarHBondContact CD-OD1 3.43Å; R53-N70 HydrophobicContact CG-CB 4Å; R53-N70 PolarHBondContact NH1-OD1 2.99Å; R53-Y72 HydrophobicContact CB-CD2 4.26Å; R53-D76 IonicContact CZ-OD1 3.22Å; R53-D76 IonicContact CZ-OD2 3.77Å; R53-D76 PolarHBondContact NH1-O 2.87Å; R53-D76 IonicContact NH1-OD1 2.78Å; R53-D76 PolarHBondContact NH1-OD1 3.49Å; R53-D76 IonicContact NH1-OD2 3.99Å; R53-D76 IonicContact NH2-OD1 2.78Å; R53-D76 PolarHBondContact NH2-OD1 2.59Å; R53-D76 IonicContact NH2-OD2 2.71Å; R53-D76 PolarHBondContact NH2-OD2 2.9Å
54	I	95.9	Very high	93.7	Very high	22 Å²	22	85.2 Å²	85.2	11%	0.113	49%	0.486	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.9	129.8	175.5	-55.7	-48.8	0	0	0	108.7	L43 V49 W56 N70 Y71 K91	L43-I54 HydrophobicContact CD1-CD1 4.25Å; V49-I54 HydrophobicContact CG2-CD1 4.06Å; V49-I54 HydrophobicContact CG2-CG1 4.23Å; I54-W56 HydrophobicContact CG2-CZ2 4.31Å; I54-N70 CarbonylContact O-C 3.49Å; I54-N70 WeakPolarHBondContact O-CA 3.32Å; I54-Y71 PolarHBondContact N-O 2.85Å; I54-Y71 PolarHBondContact O-N 3.23Å; I54-K91 HydrophobicContact CG1-CG 4.19Å
55	Y	96.5	Very high	94.2	Very high	124 Å²	124	81.8 Å²	81.8	49%	0.486	48%	0.483	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.6	133	176.7	-62.6	-97.5	0	0	0	109.2	R53 Y67 N70	R53-Y55 HydrophobicContact CB-CE2 3.89Å; R53-Y55 WeakPolarHBondContact CD-OH 3.48Å; R53-Y55 HydrophobicContact CG-CD2 4.42Å; R53-Y55 HydrophobicContact CG-CE1 4.48Å; R53-Y55 HydrophobicContact CG-CE2 3.92Å; R53-Y55 WeakPolarHBondContact O-CD2 3.35Å; Y55-Y67 HydrophobicContact CD1-CE2 4.16Å; Y55-N70 HydrophobicContact CD1-CB 3.56Å; Y55-N70 HydrophobicContact CE1-CB 3.79Å; Y55-N70 HydrophobicContact CG-CB 4.19Å
56	W	97.3	Very high	94.8	Very high	26 Å²	26	82.7 Å²	82.7	10%	0.098	47%	0.471	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.6	134.7	176.4	-67.5	94.3	0	0	0	109.7	L39 C41 I54 L68 L69 I99 L100	L39-W56 HydrophobicContact CB-CH2 4.36Å; L39-W56 HydrophobicContact CB-CZ3 4.33Å; C41-W56 HydrophobicContact CB-CH2 3.88Å; C41-W56 HydrophobicContact CB-CZ2 4.36Å; I54-W56 HydrophobicContact CG2-CZ2 4.31Å; W56-L68 HydrophobicContact CB-CB 4.33Å; W56-L68 HydrophobicContact CB-CD2 4.31Å; W56-L68 WeakPolarHBondContact O-CA 3.49Å; W56-L68 VanDerWaalsContact O-CB 3.25Å; W56-L68 WeakPolarHBondContact O-CB 3.43Å; W56-L68 PolarHBondContact O-N 2.71Å; W56-L69 HydrophobicContact CB-CD1 4.31Å; W56-L69 HydrophobicContact CB-CG 4.17Å; W56-L69 VanDerWaalsContact CD1-CD1 3.46Å; W56-L69 HydrophobicContact CG-CD1 4.19Å; W56-L69 PolarHBondContact N-O 3.11Å; W56-L69 PolarHBondContact O-N 2.78Å; W56-I99 VanDerWaalsContact CZ2-C 3.45Å; W56-L100 HydrophobicContact CB-CD1 4.49Å; W56-L100 HydrophobicContact CB-CD2 4.47Å; W56-L100 HydrophobicContact CD2-CB 3.58Å; W56-L100 HydrophobicContact CD2-CD1 4.36Å; W56-L100 HydrophobicContact CD2-CD2 3.94Å; W56-L100 HydrophobicContact CD2-CG 4.18Å; W56-L100 HydrophobicContact CE3-CB 3.72Å; W56-L100 HydrophobicContact CE3-CD2 3.63Å; W56-L100 HydrophobicContact CE3-CG 4.25Å; W56-L100 HydrophobicContact CG-CB 4.25Å; W56-L100 HydrophobicContact CG-CD1 4.18Å; W56-L100 HydrophobicContact CG-CD2 4.31Å; W56-L100 HydrophobicContact CG-CG 4.5Å; W56-L100 HydrophobicContact CH2-CB 3.72Å; W56-L100 HydrophobicContact CZ2-CB 3.6Å; W56-L100 HydrophobicContact CZ3-CB 3.78Å; W56-L100 HydrophobicContact CZ3-CD2 4.15Å
57	Y	96.4	Very high	95.4	Very high	144 Å²	144	81.4 Å²	81.4	57%	0.565	44%	0.439	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.8	141.4	176.8	-65.7	-95	0	0	0	108.7	R66 Y67	Y57-R66 CarbonylContact C-O 3.55Å; Y57-R66 VanDerWaalsContact CA-O 3.3Å; Y57-R66 WeakPolarHBondContact CA-O 3.46Å; Y57-Y67 HydrophobicContact CE1-CD2 4.11Å
58	Q	95.5	Very high	95.8	Very high	61 Å²	61	79.5 Å²	79.5	29%	0.285	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	131.3	173.7	-179.7	179.6	56.8	0	0	109.1	R66 L68	Q58-R66 PolarHBondContact N-O 2.84Å; Q58-R66 PolarHBondContact O-N 2.89Å; Q58-L68 HydrophobicContact CB-CD1 4.32Å
59	Q	96	Very high	96.1	Very high	131 Å²	131	76.6 Å²	76.6	61%	0.612	41%	0.409	S	S	*	.			trans	-122.2	125.7	170.5	-168.7	174.8	17.4	0	0	109.3	S63 P65	Q59-S63 VanDerWaalsContact CG-O 3.22Å; Q59-S63 WeakPolarHBondContact CG-O 3.41Å; Q59-S63 PolarHBondContact NE2-O 3.43Å; Q59-P65 HydrophobicContact CG-CG 4.41Å
60	K	95	Very high	96.2	Very high	130 Å²	130	77.4 Å²	77.4	57%	0.565	41%	0.413	S	S	*	.			trans	-92.7	153.1	170.2	-66.3	-177.3	-179.9	-178.7	0	109.3	G62 S63	K60-G62 PolarHBondContact O-N 2.85Å; K60-S63 PolarHBondContact O-N 2.84Å
61	P	96.7	Very high	96.5	Very high	134 Å²	134	76.5 Å²	76.5	87%	0.87	40%	0.398	S	S	*	.	T	Hydrogen-bonded Turn	trans	-49.5	130.4	173.8	-27.4	35.3	0	0	0	111.6	S63	P61-S63 PolarHBondContact O-N 3.43Å
62	G	97.3	Very high	96.7	Very high	93 Å²	93	77.4 Å²	77.4	96%	0.959	39%	0.39	S	S	*	.	T	Hydrogen-bonded Turn	trans	73.5	2.4	179.9	0	0	0	0	0	116.2	K60	K60-G62 PolarHBondContact O-N 2.85Å
63	S	97.2	Very high	96.9	Very high	54 Å²	54	72.7 Å²	72.7	38%	0.378	38%	0.376	S	S	.	.	S	Bend	trans	-111.1	154.1	177.8	-60.3	0	0	0	0	111.7	Q59 K60 P61	Q59-S63 VanDerWaalsContact CG-O 3.22Å; Q59-S63 WeakPolarHBondContact CG-O 3.41Å; Q59-S63 PolarHBondContact NE2-O 3.43Å; K60-S63 PolarHBondContact O-N 2.84Å; P61-S63 PolarHBondContact O-N 3.43Å
64	P	97.7	Very high	97	Very high	105 Å²	105	75 Å²	75	68%	0.682	39%	0.393	S	S	*	.			trans	-67.7	158.5	169.3	29.5	-34.9	0	0	0	111.3	R66	P64-R66 PolarHBondContact O-N 2.93Å
65	P	97.4	Very high	97	Very high	82 Å²	82	79.7 Å²	79.7	53%	0.532	43%	0.428	S	S	.	.			trans	-57.7	133.6	170.7	-23.3	34.1	0	0	0	111.5	Q59	Q59-P65 HydrophobicContact CG-CG 4.41Å
66	R	97	Very high	97.1	Very high	123 Å²	123	77 Å²	77	46%	0.464	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	136.6	175.1	174.3	179.1	167.9	-167.9	-3.9	109.8	Y57 Q58 P64 L68 S81 G82	Y57-R66 CarbonylContact C-O 3.55Å; Y57-R66 VanDerWaalsContact CA-O 3.3Å; Y57-R66 WeakPolarHBondContact CA-O 3.46Å; Q58-R66 PolarHBondContact N-O 2.84Å; Q58-R66 PolarHBondContact O-N 2.89Å; P64-R66 PolarHBondContact O-N 2.93Å; R66-L68 PolarHBondContact O-N 2.78Å; R66-S81 PolarHBondContact NH2-O 3.5Å; R66-G82 PolarHBondContact NH2-O 3.31Å
67	Y	97.6	Very high	97.1	Very high	61 Å²	61	80.5 Å²	80.5	24%	0.239	44%	0.438	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.7	127.5	171.5	174.1	-112.1	0	0	0	111.3	Y55 Y57 L69 N70 H78	Y55-Y67 HydrophobicContact CD1-CE2 4.16Å; Y57-Y67 HydrophobicContact CE1-CD2 4.11Å; Y67-L69 WeakPolarHBondContact CE2-O 3.27Å; Y67-L69 WeakPolarHBondContact OH-CA 3.31Å; Y67-N70 HydrophobicContact CE2-CB 4.27Å; Y67-N70 WeakPolarHBondContact OH-CB 3.48Å; Y67-N70 PolarHBondContact OH-N 3.14Å; Y67-N70 PolarHBondContact OH-ND2 2.87Å; Y67-H78 AromaticContact CE1-CD2 3.77Å; Y67-H78 PolarHBondContact OH-CD2 3.12Å; Y67-H78 PolarHBondContact OH-O 3.46Å
68	L	97.7	Very high	97.2	Very high	5 Å²	5	78.7 Å²	78.7	3%	0.026	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	-62.1	-179.5	-169.6	72.4	0	0	0	110.5	W56 Q58 R66 G80 V83 F87 L100	W56-L68 HydrophobicContact CB-CB 4.33Å; W56-L68 HydrophobicContact CB-CD2 4.31Å; W56-L68 WeakPolarHBondContact O-CA 3.49Å; W56-L68 VanDerWaalsContact O-CB 3.25Å; W56-L68 WeakPolarHBondContact O-CB 3.43Å; W56-L68 PolarHBondContact O-N 2.71Å; Q58-L68 HydrophobicContact CB-CD1 4.32Å; R66-L68 PolarHBondContact O-N 2.78Å; L68-G80 PolarHBondContact O-N 2.65Å; L68-V83 HydrophobicContact CD1-CB 4.4Å; L68-V83 HydrophobicContact CD1-CG1 3.49Å; L68-V83 VanDerWaalsContact CD1-CG1 3.49Å; L68-V83 HydrophobicContact CD1-CG2 4Å; L68-V83 HydrophobicContact CG-CG1 4.03Å; L68-V83 WeakPolarHBondContact O-CG2 3.4Å; L68-F87 HydrophobicContact CD1-CD1 4.21Å; L68-F87 HydrophobicContact CD1-CD2 3.92Å; L68-F87 HydrophobicContact CD1-CE1 4.38Å; L68-F87 HydrophobicContact CD1-CE2 4.1Å; L68-F87 HydrophobicContact CD1-CG 3.97Å; L68-F87 HydrophobicContact CD1-CZ 4.32Å; L68-F87 HydrophobicContact CD2-CB 4.28Å; L68-F87 HydrophobicContact CD2-CD1 3.64Å; L68-F87 HydrophobicContact CD2-CE1 4.08Å; L68-F87 HydrophobicContact CD2-CG 3.99Å; L68-F87 HydrophobicContact CG-CB 4.41Å; L68-F87 HydrophobicContact CG-CD1 4.37Å; L68-F87 HydrophobicContact CG-CG 4.25Å; L68-L100 HydrophobicContact CD2-CD1 3.99Å; L68-L100 HydrophobicContact CD2-CD2 3.95Å
69	L	98.5	Very high	97.3	Very high	0 Å²	0	79.1 Å²	79.1	0%	0	44%	0.436	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-162.3	167.4	-179.8	61.3	90.3	0	0	0	112.6	W56 Y67 H78 Q79 F87 L100	W56-L69 HydrophobicContact CB-CD1 4.31Å; W56-L69 HydrophobicContact CB-CG 4.17Å; W56-L69 VanDerWaalsContact CD1-CD1 3.46Å; W56-L69 HydrophobicContact CG-CD1 4.19Å; W56-L69 PolarHBondContact N-O 3.11Å; W56-L69 PolarHBondContact O-N 2.78Å; Y67-L69 WeakPolarHBondContact CE2-O 3.27Å; Y67-L69 WeakPolarHBondContact OH-CA 3.31Å; L69-H78 CarbonylContact C-O 3.53Å; L69-H78 VanDerWaalsContact CA-O 3.27Å; L69-H78 WeakPolarHBondContact CA-O 3.25Å; L69-H78 VanDerWaalsContact CB-O 3.31Å; L69-H78 WeakPolarHBondContact CB-O 3.22Å; L69-Q79 VanDerWaalsContact CD2-OE1 3.28Å; L69-F87 HydrophobicContact CD2-CB 3.95Å; L69-L100 HydrophobicContact CD2-CD1 3.77Å; L69-L100 HydrophobicContact CG-CD1 4.38Å
70	N	98.1	Very high	97.3	Very high	18 Å²	18	73.3 Å²	73.3	10%	0.096	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.3	150.5	167.7	76.6	59.2	0	0	0	111.3	R53 I54 Y55 Y67 K77 H78	R53-N70 WeakPolarHBondContact CD-OD1 3.43Å; R53-N70 HydrophobicContact CG-CB 4Å; R53-N70 PolarHBondContact NH1-OD1 2.99Å; I54-N70 CarbonylContact O-C 3.49Å; I54-N70 WeakPolarHBondContact O-CA 3.32Å; Y55-N70 HydrophobicContact CD1-CB 3.56Å; Y55-N70 HydrophobicContact CE1-CB 3.79Å; Y55-N70 HydrophobicContact CG-CB 4.19Å; Y67-N70 HydrophobicContact CE2-CB 4.27Å; Y67-N70 WeakPolarHBondContact OH-CB 3.48Å; Y67-N70 PolarHBondContact OH-N 3.14Å; Y67-N70 PolarHBondContact OH-ND2 2.87Å; N70-K77 WeakPolarHBondContact O-CA 3.22Å; N70-K77 WeakPolarHBondContact O-CB 3.03Å; N70-H78 PolarHBondContact N-O 3.3Å; N70-H78 PolarHBondContact O-N 3.01Å; N70-H78 PolarHBondContact OD1-N 3.43Å
71	Y	98.4	Very high	97.4	Very high	19 Å²	19	72.6 Å²	72.6	8%	0.075	42%	0.423	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.2	119.7	179.8	-174.2	-84.5	0	0	0	110.3	I54 D74 K77 G89 K91	I54-Y71 PolarHBondContact N-O 2.85Å; I54-Y71 PolarHBondContact O-N 3.23Å; Y71-D74 PolarHBondContact OH-N 2.91Å; Y71-D74 PolarHBondContact OH-OD1 3.48Å; Y71-K77 HydrophobicContact CD2-CB 3.94Å; Y71-K77 HydrophobicContact CD2-CD 3.91Å; Y71-K77 HydrophobicContact CE2-CD 3.93Å; Y71-G89 WeakPolarHBondContact CD2-O 3.48Å; Y71-G89 VanDerWaalsContact CE2-O 3.22Å; Y71-G89 WeakPolarHBondContact CE2-O 3.32Å; Y71-K91 HydrophobicContact CD1-CD 3.93Å; Y71-K91 HydrophobicContact CD1-CG 3.73Å; Y71-K91 HydrophobicContact CE1-CB 4.25Å; Y71-K91 HydrophobicContact CE1-CD 4Å; Y71-K91 HydrophobicContact CE1-CG 3.88Å; Y71-K91 WeakPolarHBondContact O-CE 3.5Å
72	Y	97.1	Very high	97.4	Very high	99 Å²	99	69.3 Å²	69.3	39%	0.388	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	-52.7	167.1	-177.8	-103.3	0	0	0	110.7	R53 D76 K91	R53-Y72 HydrophobicContact CB-CD2 4.26Å; Y72-D76 WeakPolarHBondContact CB-O 3.3Å; Y72-D76 HydrophobicContact CD1-CB 4.33Å; Y72-D76 PolarHBondContact N-O 3.38Å; Y72-K91 WeakPolarHBondContact O-CE 3.42Å; Y72-K91 PolarHBondContact O-NZ 2.8Å
73	S	96.8	Very high	97.4	Very high	32 Å²	32	65.8 Å²	65.8	22%	0.224	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.9	177.2	174.5	66.7	0	0	0	0	109.9	S75 D76	S73-S75 VanDerWaalsContact C-N 3.27Å; S73-S75 PolarHBondContact O-N 2.89Å; S73-S75 PolarHBondContact OG-OG 3.05Å; S73-S75 VanDerWaalsContact OG-OG 3.11Å; S73-D76 PolarHBondContact N-O 2.82Å; S73-D76 VanDerWaalsContact N-O 3.14Å; S73-D76 CarbonylContact O-C 3.22Å; S73-D76 VanDerWaalsContact O-C 3.22Å; S73-D76 PolarHBondContact O-N 2.79Å; S73-D76 VanDerWaalsContact O-N 3.15Å; S73-D76 VanDerWaalsContact O-O 3.08Å; S73-D76 WeakPolarHBondContact OG-CB 3.49Å; S73-D76 PolarHBondContact OG-N 2.81Å
74	D	96	Very high	97.4	Very high	112 Å²	112	66 Å²	66	60%	0.599	37%	0.373	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.6	-31.3	176.3	-82.8	-49.1	0	0	0	114.1	Y71 K77	Y71-D74 PolarHBondContact OH-N 2.91Å; Y71-D74 PolarHBondContact OH-OD1 3.48Å; D74-K77 VanDerWaalsContact O-CE 3.22Å; D74-K77 WeakPolarHBondContact O-CE 3.28Å; D74-K77 IonicContact OD1-NZ 2.93Å; D74-K77 PolarHBondContact OD1-NZ 2.83Å
75	S	97.2	Very high	97.3	Very high	120 Å²	120	66.8 Å²	66.8	84%	0.839	38%	0.381	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.8	-13.4	174.6	54.3	0	0	0	0	113.5	S73	S73-S75 VanDerWaalsContact C-N 3.27Å; S73-S75 PolarHBondContact O-N 2.89Å; S73-S75 PolarHBondContact OG-OG 3.05Å; S73-S75 VanDerWaalsContact OG-OG 3.11Å
76	D	97.7	Very high	97.2	Very high	68 Å²	68	67.4 Å²	67.4	36%	0.364	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.9	83.6	-174.9	-172.4	-8.8	0	0	0	110.9	R53 Y72 S73	R53-D76 IonicContact CZ-OD1 3.22Å; R53-D76 IonicContact CZ-OD2 3.77Å; R53-D76 PolarHBondContact NH1-O 2.87Å; R53-D76 IonicContact NH1-OD1 2.78Å; R53-D76 PolarHBondContact NH1-OD1 3.49Å; R53-D76 IonicContact NH1-OD2 3.99Å; R53-D76 IonicContact NH2-OD1 2.78Å; R53-D76 PolarHBondContact NH2-OD1 2.59Å; R53-D76 IonicContact NH2-OD2 2.71Å; R53-D76 PolarHBondContact NH2-OD2 2.9Å; Y72-D76 WeakPolarHBondContact CB-O 3.3Å; Y72-D76 HydrophobicContact CD1-CB 4.33Å; Y72-D76 PolarHBondContact N-O 3.38Å; S73-D76 PolarHBondContact N-O 2.82Å; S73-D76 VanDerWaalsContact N-O 3.14Å; S73-D76 CarbonylContact O-C 3.22Å; S73-D76 VanDerWaalsContact O-C 3.22Å; S73-D76 PolarHBondContact O-N 2.79Å; S73-D76 VanDerWaalsContact O-N 3.15Å; S73-D76 VanDerWaalsContact O-O 3.08Å; S73-D76 WeakPolarHBondContact OG-CB 3.49Å; S73-D76 PolarHBondContact OG-N 2.81Å
77	K	97.4	Very high	97.3	Very high	99 Å²	99	62 Å²	62	43%	0.43	35%	0.352	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.5	152.4	179	59.8	-169.7	173.3	-166.3	0	110.3	N70 Y71 D74	N70-K77 WeakPolarHBondContact O-CA 3.22Å; N70-K77 WeakPolarHBondContact O-CB 3.03Å; Y71-K77 HydrophobicContact CD2-CB 3.94Å; Y71-K77 HydrophobicContact CD2-CD 3.91Å; Y71-K77 HydrophobicContact CE2-CD 3.93Å; D74-K77 VanDerWaalsContact O-CE 3.22Å; D74-K77 WeakPolarHBondContact O-CE 3.28Å; D74-K77 IonicContact OD1-NZ 2.93Å; D74-K77 PolarHBondContact OD1-NZ 2.83Å
78	H	97.9	Very high	97.3	Very high	107 Å²	107	61.7 Å²	61.7	50%	0.495	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.6	141.8	-178.9	178.2	74.7	0	0	0	111.6	Y67 L69 N70	Y67-H78 AromaticContact CE1-CD2 3.77Å; Y67-H78 PolarHBondContact OH-CD2 3.12Å; Y67-H78 PolarHBondContact OH-O 3.46Å; L69-H78 CarbonylContact C-O 3.53Å; L69-H78 VanDerWaalsContact CA-O 3.27Å; L69-H78 WeakPolarHBondContact CA-O 3.25Å; L69-H78 VanDerWaalsContact CB-O 3.31Å; L69-H78 WeakPolarHBondContact CB-O 3.22Å; N70-H78 PolarHBondContact N-O 3.3Å; N70-H78 PolarHBondContact O-N 3.01Å; N70-H78 PolarHBondContact OD1-N 3.43Å
79	Q	97.7	Very high	97.2	Very high	70 Å²	70	62 Å²	62	33%	0.327	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	133.8	176.2	-90.5	38.9	-107.8	0	0	108.8	L69	L69-Q79 VanDerWaalsContact CD2-OE1 3.28Å
80	G	97.6	Very high	97.2	Very high	8 Å²	8	63.2 Å²	63.2	8%	0.082	37%	0.373	C	S	.	.			trans	-61	152.7	174.5	0	0	0	0	0	112.2	L68 G82 V83	L68-G80 PolarHBondContact O-N 2.65Å; G80-G82 PolarHBondContact O-N 3.16Å; G80-V83 VanDerWaalsContact O-CB 3.26Å; G80-V83 WeakPolarHBondContact O-CB 3.39Å; G80-V83 VanDerWaalsContact O-CG2 3.32Å; G80-V83 WeakPolarHBondContact O-CG2 3.45Å; G80-V83 PolarHBondContact O-N 3.06Å; G80-V83 VanDerWaalsContact O-N 3.09Å
81	S	97	Very high	97.2	Very high	116 Å²	116	64.3 Å²	64.3	81%	0.811	38%	0.376	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.7	132.6	177.4	-177	0	0	0	0	111.3	R66 V83	R66-S81 PolarHBondContact NH2-O 3.5Å; S81-V83 PolarHBondContact O-N 2.81Å
82	G	96.7	Very high	97.1	Very high	64 Å²	64	65.6 Å²	65.6	66%	0.66	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.8	19	-178.9	0	0	0	0	0	114.7	R66 G80	R66-G82 PolarHBondContact NH2-O 3.31Å; G80-G82 PolarHBondContact O-N 3.16Å
83	V	96.6	Very high	96.9	Very high	20 Å²	20	64.8 Å²	64.8	12%	0.121	40%	0.398	C	S	.	.			trans	-83.7	123.2	172.3	173.4	0	0	0	0	109.1	L68 G80 S81 F87	L68-V83 HydrophobicContact CD1-CB 4.4Å; L68-V83 HydrophobicContact CD1-CG1 3.49Å; L68-V83 VanDerWaalsContact CD1-CG1 3.49Å; L68-V83 HydrophobicContact CD1-CG2 4Å; L68-V83 HydrophobicContact CG-CG1 4.03Å; L68-V83 WeakPolarHBondContact O-CG2 3.4Å; G80-V83 VanDerWaalsContact O-CB 3.26Å; G80-V83 WeakPolarHBondContact O-CB 3.39Å; G80-V83 VanDerWaalsContact O-CG2 3.32Å; G80-V83 WeakPolarHBondContact O-CG2 3.45Å; G80-V83 PolarHBondContact O-N 3.06Å; G80-V83 VanDerWaalsContact O-N 3.09Å; S81-V83 PolarHBondContact O-N 2.81Å; V83-F87 HydrophobicContact CG1-CB 4.13Å; V83-F87 HydrophobicContact CG1-CD2 3.84Å; V83-F87 HydrophobicContact CG1-CG 4.31Å
84	P	96.3	Very high	96.8	Very high	58 Å²	58	68.2 Å²	68.2	38%	0.377	42%	0.422	S	S	.	.			trans	-63.4	147.2	-178.8	-26.5	37.7	0	0	0	112.9	R86 F87	P84-R86 HydrophobicContact CB-CG 4.25Å; P84-R86 PolarHBondContact O-N 3.27Å; P84-F87 HydrophobicContact CB-CD2 4.45Å; P84-F87 HydrophobicContact CG-CE2 4.47Å; P84-F87 WeakPolarHBondContact O-CD2 3.38Å; P84-F87 PolarHBondContact O-N 2.92Å; P84-F87 VanDerWaalsContact O-N 3.16Å
85	S	95.7	Very high	96.8	Very high	122 Å²	122	66 Å²	66	85%	0.853	41%	0.413	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.1	-13.4	179.8	55	0	0	0	0	114.6	F87	S85-F87 PolarHBondContact O-N 2.76Å
86	R	96.7	Very high	96.7	Very high	94 Å²	94	61.8 Å²	61.8	36%	0.355	38%	0.381	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.7	-22.3	175.8	79.7	176.5	177.6	-92.8	2.1	113.8	P84 I102 S103	P84-R86 HydrophobicContact CB-CG 4.25Å; P84-R86 PolarHBondContact O-N 3.27Å; R86-I102 HydrophobicContact CG-CG2 4.25Å; R86-I102 WeakPolarHBondContact O-CA 3.16Å; R86-S103 VanDerWaalsContact CA-OG 3.28Å; R86-S103 WeakPolarHBondContact CA-OG 3.4Å; R86-S103 VanDerWaalsContact CB-O 3.31Å; R86-S103 WeakPolarHBondContact CB-O 3.46Å; R86-S103 WeakPolarHBondContact CB-OG 3.4Å; R86-S103 WeakPolarHBondContact CD-O 3.34Å; R86-S103 PolarHBondContact O-N 2.92Å; R86-S103 PolarHBondContact O-OG 3.17Å
87	F	97.7	Very high	96.7	Very high	9 Å²	9	58.6 Å²	58.6	4%	0.039	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.1	127.2	176.9	-63	-78.5	0	0	0	110.2	L68 L69 V83 P84 S85 L100 F101 I102	L68-F87 HydrophobicContact CD1-CD1 4.21Å; L68-F87 HydrophobicContact CD1-CD2 3.92Å; L68-F87 HydrophobicContact CD1-CE1 4.38Å; L68-F87 HydrophobicContact CD1-CE2 4.1Å; L68-F87 HydrophobicContact CD1-CG 3.97Å; L68-F87 HydrophobicContact CD1-CZ 4.32Å; L68-F87 HydrophobicContact CD2-CB 4.28Å; L68-F87 HydrophobicContact CD2-CD1 3.64Å; L68-F87 HydrophobicContact CD2-CE1 4.08Å; L68-F87 HydrophobicContact CD2-CG 3.99Å; L68-F87 HydrophobicContact CG-CB 4.41Å; L68-F87 HydrophobicContact CG-CD1 4.37Å; L68-F87 HydrophobicContact CG-CG 4.25Å; L69-F87 HydrophobicContact CD2-CB 3.95Å; V83-F87 HydrophobicContact CG1-CB 4.13Å; V83-F87 HydrophobicContact CG1-CD2 3.84Å; V83-F87 HydrophobicContact CG1-CG 4.31Å; P84-F87 HydrophobicContact CB-CD2 4.45Å; P84-F87 HydrophobicContact CG-CE2 4.47Å; P84-F87 WeakPolarHBondContact O-CD2 3.38Å; P84-F87 PolarHBondContact O-N 2.92Å; P84-F87 VanDerWaalsContact O-N 3.16Å; S85-F87 PolarHBondContact O-N 2.76Å; F87-L100 HydrophobicContact CD1-CD1 4.44Å; F87-F101 WeakPolarHBondContact CA-O 3.34Å; F87-I102 HydrophobicContact CD1-CB 4.41Å; F87-I102 HydrophobicContact CD1-CD1 4.29Å; F87-I102 HydrophobicContact CD1-CG1 3.79Å; F87-I102 HydrophobicContact CD1-CG2 4.11Å; F87-I102 HydrophobicContact CE1-CB 4.38Å; F87-I102 HydrophobicContact CE1-CD1 3.84Å; F87-I102 HydrophobicContact CE1-CG1 3.8Å; F87-I102 HydrophobicContact CE1-CG2 3.78Å; F87-I102 HydrophobicContact CZ-CG2 4.34Å
88	S	97.4	Very high	96.6	Very high	55 Å²	55	53.9 Å²	53.9	39%	0.385	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.4	146.1	172.3	58	0	0	0	0	111.4	L100 F101	S88-L100 WeakPolarHBondContact O-CA 3.12Å; S88-F101 PolarHBondContact N-O 3.36Å; S88-F101 PolarHBondContact O-N 3.18Å
89	G	97.7	Very high	96.6	Very high	11 Å²	11	49.2 Å²	49.2	11%	0.113	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.8	152	177.4	0	0	0	0	0	111.9	Y71 I99	Y71-G89 WeakPolarHBondContact CD2-O 3.48Å; Y71-G89 VanDerWaalsContact CE2-O 3.22Å; Y71-G89 WeakPolarHBondContact CE2-O 3.32Å; G89-I99 CarbonylContact C-O 3.54Å; G89-I99 VanDerWaalsContact CA-O 3.28Å; G89-I99 WeakPolarHBondContact CA-O 3.33Å
90	S	97.7	Very high	96.7	Very high	27 Å²	27	46.3 Å²	46.3	19%	0.189	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.9	-176.5	163.8	78.5	0	0	0	0	110.9	I99 F101	S90-I99 PolarHBondContact N-O 2.91Å; S90-I99 PolarHBondContact O-N 3.09Å; S90-F101 WeakPolarHBondContact OG-CE2 3.14Å
91	K	97.2	Very high	96.7	Very high	41 Å²	41	49.6 Å²	49.6	18%	0.178	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.6	148	173.1	-66.6	167.1	176.9	-179	0	109.8	V49 Y52 I54 Y71 Y72 A97	V49-K91 HydrophobicContact CG2-CB 4.25Å; V49-K91 HydrophobicContact CG2-CD 4.1Å; V49-K91 HydrophobicContact CG2-CG 3.9Å; V49-K91 WeakPolarHBondContact O-CE 3.28Å; V49-K91 PolarHBondContact O-NZ 3.3Å; Y52-K91 WeakPolarHBondContact O-CE 3.33Å; Y52-K91 PolarHBondContact O-NZ 3Å; I54-K91 HydrophobicContact CG1-CG 4.19Å; Y71-K91 HydrophobicContact CD1-CD 3.93Å; Y71-K91 HydrophobicContact CD1-CG 3.73Å; Y71-K91 HydrophobicContact CE1-CB 4.25Å; Y71-K91 HydrophobicContact CE1-CD 4Å; Y71-K91 HydrophobicContact CE1-CG 3.88Å; Y71-K91 WeakPolarHBondContact O-CE 3.5Å; Y72-K91 WeakPolarHBondContact O-CE 3.42Å; Y72-K91 PolarHBondContact O-NZ 2.8Å; K91-A97 CarbonylContact C-O 3.53Å; K91-A97 VanDerWaalsContact CA-O 3.32Å; K91-A97 WeakPolarHBondContact CA-O 3.46Å
92	D	96.1	Very high	96.7	Very high	45 Å²	45	45.1 Å²	45.1	24%	0.241	29%	0.288	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.9	105.7	168.7	-175	-15.8	0	0	0	108.4	S94 T95 N96 A97 I99	D92-S94 VanDerWaalsContact C-N 3.28Å; D92-S94 PolarHBondContact O-N 2.98Å; D92-S94 WeakPolarHBondContact OD1-CA 3.31Å; D92-S94 WeakPolarHBondContact OD1-CB 3.36Å; D92-S94 PolarHBondContact OD1-N 3.41Å; D92-S94 PolarHBondContact OD1-OG 3.12Å; D92-T95 PolarHBondContact OD1-N 3.49Å; D92-N96 WeakPolarHBondContact O-CA 3.38Å; D92-N96 PolarHBondContact O-N 3.05Å; D92-A97 PolarHBondContact N-O 2.87Å; D92-A97 PolarHBondContact O-N 2.97Å; D92-I99 HydrophobicContact CB-CD1 3.87Å
93	A	94.5	Very high	96.7	Very high	82 Å²	82	44.8 Å²	44.8	68%	0.678	28%	0.275	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.5	-28.1	179.5	0	0	0	0	0	112.4	T95 N96	A93-T95 VanDerWaalsContact C-N 3.33Å; A93-T95 PolarHBondContact O-N 3.35Å; A93-N96 PolarHBondContact O-N 3.22Å
94	S	94.5	Very high	96.6	Very high	104 Å²	104	46.1 Å²	46.1	73%	0.727	29%	0.293	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.7	-34	-179	75.2	0	0	0	0	111.9	D92	D92-S94 VanDerWaalsContact C-N 3.28Å; D92-S94 PolarHBondContact O-N 2.98Å; D92-S94 WeakPolarHBondContact OD1-CA 3.31Å; D92-S94 WeakPolarHBondContact OD1-CB 3.36Å; D92-S94 PolarHBondContact OD1-N 3.41Å; D92-S94 PolarHBondContact OD1-OG 3.12Å
95	T	94.7	Very high	96.2	Very high	67 Å²	67	48.5 Å²	48.5	41%	0.411	30%	0.302	S	S	.	.	T	Hydrogen-bonded Turn	trans	-103	7.6	175.4	67.1	0	0	0	0	113.3	T42 D92 A93 A97	T42-T95 WeakPolarHBondContact CG2-O 3.41Å; D92-T95 PolarHBondContact OD1-N 3.49Å; A93-T95 VanDerWaalsContact C-N 3.33Å; A93-T95 PolarHBondContact O-N 3.35Å; T95-A97 VanDerWaalsContact C-N 3.28Å; T95-A97 PolarHBondContact O-N 3.44Å; T95-A97 WeakPolarHBondContact OG1-CB 3.45Å
96	N	95.8	Very high	96.2	Very high	31 Å²	31	44.9 Å²	44.9	17%	0.166	27%	0.274	C	S	.	.	T	Hydrogen-bonded Turn	trans	50	43.7	-176	-160.4	39.7	0	0	0	113.9	L43 I47 V49 D92 A93	L43-N96 WeakPolarHBondContact CB-ND2 3.22Å; L43-N96 PolarHBondContact N-O 2.71Å; L43-N96 PolarHBondContact O-ND2 3.34Å; I47-N96 PolarHBondContact O-ND2 3.23Å; I47-N96 PolarHBondContact O-OD1 3.26Å; V49-N96 PolarHBondContact N-OD1 3.11Å; D92-N96 WeakPolarHBondContact O-CA 3.38Å; D92-N96 PolarHBondContact O-N 3.05Å; A93-N96 PolarHBondContact O-N 3.22Å
97	A	96.8	Very high	96.2	Very high	0 Å²	0	42.3 Å²	42.3	0%	0	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.7	141.9	-168.3	0	0	0	0	0	114.2	T40 C41 K91 D92 T95	T40-A97 HydrophobicContact CG2-CB 3.62Å; C41-A97 CarbonylContact O-C 3.52Å; C41-A97 VanDerWaalsContact O-CA 3.28Å; C41-A97 WeakPolarHBondContact O-CA 3.47Å; K91-A97 CarbonylContact C-O 3.53Å; K91-A97 VanDerWaalsContact CA-O 3.32Å; K91-A97 WeakPolarHBondContact CA-O 3.46Å; D92-A97 PolarHBondContact N-O 2.87Å; D92-A97 PolarHBondContact O-N 2.97Å; T95-A97 VanDerWaalsContact C-N 3.28Å; T95-A97 PolarHBondContact O-N 3.44Å; T95-A97 WeakPolarHBondContact OG1-CB 3.45Å
98	G	97.4	Very high	96.1	Very high	0 Å²	0	44.1 Å²	44.1	0%	0	28%	0.283	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.2	143.9	161	0	0	0	0	0	110.3	C41	C41-G98 PolarHBondContact N-O 2.92Å; C41-G98 PolarHBondContact O-N 3.24Å
99	I	97.9	Very high	96.1	Very high	10 Å²	10	43.5 Å²	43.5	5%	0.051	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	137.6	-179.1	-56.7	169.4	0	0	0	109.6	R38 L39 W56 G89 S90 D92 F101	R38-I99 HydrophobicContact CG-CG2 3.76Å; L39-I99 WeakPolarHBondContact O-CA 3.29Å; W56-I99 VanDerWaalsContact CZ2-C 3.45Å; G89-I99 CarbonylContact C-O 3.54Å; G89-I99 VanDerWaalsContact CA-O 3.28Å; G89-I99 WeakPolarHBondContact CA-O 3.33Å; S90-I99 PolarHBondContact N-O 2.91Å; S90-I99 PolarHBondContact O-N 3.09Å; D92-I99 HydrophobicContact CB-CD1 3.87Å; I99-F101 HydrophobicContact CB-CE2 4.26Å; I99-F101 HydrophobicContact CG2-CD1 4.38Å; I99-F101 HydrophobicContact CG2-CD2 3.95Å; I99-F101 HydrophobicContact CG2-CE1 3.97Å; I99-F101 HydrophobicContact CG2-CE2 3.5Å; I99-F101 HydrophobicContact CG2-CG 4.37Å; I99-F101 HydrophobicContact CG2-CZ 3.52Å
100	L	98	Very high	96	Very high	8 Å²	8	45.5 Å²	45.5	4%	0.042	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	123.4	167	176.4	67.7	0	0	0	109	R38 L39 W56 L68 L69 F87 S88 I102	R38-L100 WeakPolarHBondContact CA-O 3.34Å; L39-L100 HydrophobicContact CB-CB 4.3Å; L39-L100 HydrophobicContact CD1-CD2 4.18Å; L39-L100 PolarHBondContact N-O 3.01Å; L39-L100 PolarHBondContact O-N 3.29Å; W56-L100 HydrophobicContact CB-CD1 4.49Å; W56-L100 HydrophobicContact CB-CD2 4.47Å; W56-L100 HydrophobicContact CD2-CB 3.58Å; W56-L100 HydrophobicContact CD2-CD1 4.36Å; W56-L100 HydrophobicContact CD2-CD2 3.94Å; W56-L100 HydrophobicContact CD2-CG 4.18Å; W56-L100 HydrophobicContact CE3-CB 3.72Å; W56-L100 HydrophobicContact CE3-CD2 3.63Å; W56-L100 HydrophobicContact CE3-CG 4.25Å; W56-L100 HydrophobicContact CG-CB 4.25Å; W56-L100 HydrophobicContact CG-CD1 4.18Å; W56-L100 HydrophobicContact CG-CD2 4.31Å; W56-L100 HydrophobicContact CG-CG 4.5Å; W56-L100 HydrophobicContact CH2-CB 3.72Å; W56-L100 HydrophobicContact CZ2-CB 3.6Å; W56-L100 HydrophobicContact CZ3-CB 3.78Å; W56-L100 HydrophobicContact CZ3-CD2 4.15Å; L68-L100 HydrophobicContact CD2-CD1 3.99Å; L68-L100 HydrophobicContact CD2-CD2 3.95Å; L69-L100 HydrophobicContact CD2-CD1 3.77Å; L69-L100 HydrophobicContact CG-CD1 4.38Å; F87-L100 HydrophobicContact CD1-CD1 4.44Å; S88-L100 WeakPolarHBondContact O-CA 3.12Å; L100-I102 HydrophobicContact CG-CG1 4.32Å
101	F	97.9	Very high	95.8	Very high	78 Å²	78	46.7 Å²	46.7	34%	0.342	29%	0.294	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.3	138.3	171.3	-61.8	-80.8	0	0	0	110.2	A37 R38 F87 S88 S90 I99	A37-F101 WeakPolarHBondContact O-CA 3.32Å; R38-F101 HydrophobicContact CB-CD1 4.23Å; R38-F101 HydrophobicContact CB-CE1 4.27Å; R38-F101 HydrophobicContact CG-CD1 4.26Å; R38-F101 HydrophobicContact CG-CE1 3.93Å; F87-F101 WeakPolarHBondContact CA-O 3.34Å; S88-F101 PolarHBondContact N-O 3.36Å; S88-F101 PolarHBondContact O-N 3.18Å; S90-F101 WeakPolarHBondContact OG-CE2 3.14Å; I99-F101 HydrophobicContact CB-CE2 4.26Å; I99-F101 HydrophobicContact CG2-CD1 4.38Å; I99-F101 HydrophobicContact CG2-CD2 3.95Å; I99-F101 HydrophobicContact CG2-CE1 3.97Å; I99-F101 HydrophobicContact CG2-CE2 3.5Å; I99-F101 HydrophobicContact CG2-CG 4.37Å; I99-F101 HydrophobicContact CG2-CZ 3.52Å
102	I	97.4	Very high	95.8	Very high	22 Å²	22	47.1 Å²	47.1	11%	0.113	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.5	111.3	173.8	-45.8	175.8	0	0	0	106.4	S36 A37 L39 R86 F87 L100 L105	S36-I102 CarbonylContact C-O 3.48Å; S36-I102 WeakPolarHBondContact CA-O 3.46Å; A37-I102 HydrophobicContact CB-CB 4.3Å; A37-I102 PolarHBondContact N-O 3.14Å; A37-I102 PolarHBondContact O-N 3.43Å; L39-I102 HydrophobicContact CD1-CD1 4.24Å; R86-I102 HydrophobicContact CG-CG2 4.25Å; R86-I102 WeakPolarHBondContact O-CA 3.16Å; F87-I102 HydrophobicContact CD1-CB 4.41Å; F87-I102 HydrophobicContact CD1-CD1 4.29Å; F87-I102 HydrophobicContact CD1-CG1 3.79Å; F87-I102 HydrophobicContact CD1-CG2 4.11Å; F87-I102 HydrophobicContact CE1-CB 4.38Å; F87-I102 HydrophobicContact CE1-CD1 3.84Å; F87-I102 HydrophobicContact CE1-CG1 3.8Å; F87-I102 HydrophobicContact CE1-CG2 3.78Å; F87-I102 HydrophobicContact CZ-CG2 4.34Å; L100-I102 HydrophobicContact CG-CG1 4.32Å; I102-L105 HydrophobicContact CB-CD2 4.5Å; I102-L105 HydrophobicContact CG2-CD2 3.84Å; I102-L105 HydrophobicContact CG2-CG 4.45Å
103	S	97	Very high	95.7	Very high	57 Å²	57	47.3 Å²	47.3	40%	0.399	31%	0.307	S	S	.	.			trans	-90.3	149.3	175.7	49	0	0	0	0	111.6	R86	R86-S103 VanDerWaalsContact CA-OG 3.28Å; R86-S103 WeakPolarHBondContact CA-OG 3.4Å; R86-S103 VanDerWaalsContact CB-O 3.31Å; R86-S103 WeakPolarHBondContact CB-O 3.46Å; R86-S103 WeakPolarHBondContact CB-OG 3.4Å; R86-S103 WeakPolarHBondContact CD-O 3.34Å; R86-S103 PolarHBondContact O-N 2.92Å; R86-S103 PolarHBondContact O-OG 3.17Å
104	G	94.4	Very high	95.8	Very high	48 Å²	48	44.4 Å²	44.4	50%	0.495	28%	0.276	S	S	.	.			trans	55.5	63.9	172.6	0	0	0	0	0	113.9	A35	A35-G104 PolarHBondContact O-N 3.48Å
105	L	88.2	Confident	95.9	Very high	108 Å²	108	39 Å²	39	57%	0.565	24%	0.235	S	C	*	.			trans	-62.1	0	175.5	-78.5	172.7	0	0	0	114	A31 G34 A35 A37 I102	A31-L105 HydrophobicContact CB-CD1 3.43Å; A31-L105 VanDerWaalsContact CB-CD1 3.43Å; G34-L105 PolarHBondContact N-O 3.48Å; A35-L105 PolarHBondContact O-N 3.14Å; A37-L105 HydrophobicContact CB-CD1 3.69Å; A37-L105 HydrophobicContact CB-CG 4.47Å; I102-L105 HydrophobicContact CB-CD2 4.5Å; I102-L105 HydrophobicContact CG2-CD2 3.84Å; I102-L105 HydrophobicContact CG2-CG 4.45Å

Retrieved 105 of 105 residues in 53.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).