LV537_HUMAN Loading...

Immunoglobulin lambda variable 5-37

V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition¹. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens^2,3. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen^4,5.

AlphaFold DB , UniProt , Accession A0A075B6J1, Species HUMAN (Homo sapiens, Human), Gene IGLV5-37, Length 123 aa.

						>LV537_HUMAN|A0A075B6J1|IGLV5-37
MAWTPLLLLLLSHCTGSLSQPVLTQPPSSSASPGESARLTCTLPSDINVGSYNIYWYQQKPGSPPRYLLYYYSDSDKGQGSGVPSRFSGSKDASANTGILLISGLQSEDEADYYCMIWPSNAS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	55.1	Low	60.9	Low	239 Å²	239	127.2 Å²	127.2	100%	1.177	67%	0.669	S	S	*	*				0	50.2	0	-60.6	165	176.4	0	0	110.5
2	A	64.2	Low	61.1	Low	77 Å²	77	122.1 Å²	122.1	64%	0.636	65%	0.652	S	S	*	*			trans	-127.3	10.3	-167.6	0	0	0	0	0	114.1	P5	A2-P5 WeakPolarHBondContact O-CD 3.38Å
3	W	59.5	Low	61.2	Low	214 Å²	214	122.8 Å²	122.8	81%	0.811	65%	0.648	S	S	*	*			trans	-88.6	-8.9	177.6	-71.6	-16.4	0	0	0	113.8	L6 L7	W3-L6 PolarHBondContact O-N 2.94Å; W3-L6 VanDerWaalsContact O-N 3.16Å; W3-L7 PolarHBondContact O-N 3.45Å
4	T	61.2	Low	61.4	Low	92 Å²	92	122 Å²	122	56%	0.564	66%	0.656	S	S	*	*	H	α-helix	trans	-53.7	-48.4	177.3	-14.5	0	0	0	0	113.4	L6 L7 L8	T4-L6 VanDerWaalsContact C-N 3.35Å; T4-L6 PolarHBondContact O-N 3.41Å; T4-L7 PolarHBondContact O-N 2.92Å; T4-L8 WeakPolarHBondContact O-CD1 3.49Å; T4-L8 PolarHBondContact O-N 3.1Å
5	P	59	Low	61.8	Low	80 Å²	80	121.7 Å²	121.7	52%	0.519	66%	0.66	S	S	.	*	H	α-helix	trans	-66.5	-34.3	178	23	-31.5	0	0	0	113	A2 L8 L9	A2-P5 WeakPolarHBondContact O-CD 3.38Å; P5-L8 PolarHBondContact O-N 2.93Å; P5-L9 PolarHBondContact O-N 3.41Å; P5-L9 VanDerWaalsContact O-N 3.09Å
6	L	60.4	Low	62.1	Low	109 Å²	109	118 Å²	118	57%	0.571	66%	0.659	S	S	*	*	H	α-helix	trans	-67.5	-38.4	176.3	-169.8	69.5	0	0	0	111.4	W3 T4 L9 L10	W3-L6 PolarHBondContact O-N 2.94Å; W3-L6 VanDerWaalsContact O-N 3.16Å; T4-L6 VanDerWaalsContact C-N 3.35Å; T4-L6 PolarHBondContact O-N 3.41Å; L6-L9 PolarHBondContact O-N 2.99Å; L6-L10 PolarHBondContact O-N 3.32Å; L6-L10 VanDerWaalsContact O-N 3.1Å
7	L	62.5	Low	62.7	Low	112 Å²	112	117.8 Å²	117.8	59%	0.586	67%	0.668	S	S	*	*	H	α-helix	trans	-64.7	-41.6	176.2	-142.7	80.6	0	0	0	111.3	W3 T4 L10 L11	W3-L7 PolarHBondContact O-N 3.45Å; T4-L7 PolarHBondContact O-N 2.92Å; L7-L10 PolarHBondContact O-N 3.25Å; L7-L11 HydrophobicContact CG-CD1 4.45Å; L7-L11 WeakPolarHBondContact O-CD1 3.27Å; L7-L11 PolarHBondContact O-N 3.07Å
8	L	64.1	Low	63.1	Low	121 Å²	121	120.4 Å²	120.4	63%	0.634	68%	0.678	S	S	*	*	H	α-helix	trans	-63.4	-40.3	176.5	-95.1	132.9	0	0	0	112.7	T4 P5 S12	T4-L8 WeakPolarHBondContact O-CD1 3.49Å; T4-L8 PolarHBondContact O-N 3.1Å; P5-L8 PolarHBondContact O-N 2.93Å; L8-S12 PolarHBondContact O-N 2.98Å; L8-S12 VanDerWaalsContact O-N 3.14Å
9	L	62.2	Low	64	Low	100 Å²	100	119.7 Å²	119.7	52%	0.524	68%	0.682	S	S	.	*	H	α-helix	trans	-62.4	-45.9	173.5	-97.8	136.9	0	0	0	111.6	P5 L6 L11 S12 H13	P5-L9 PolarHBondContact O-N 3.41Å; P5-L9 VanDerWaalsContact O-N 3.09Å; L6-L9 PolarHBondContact O-N 2.99Å; L9-L11 VanDerWaalsContact C-N 3.34Å; L9-L11 PolarHBondContact O-N 2.84Å; L9-S12 WeakPolarHBondContact O-CB 3.26Å; L9-S12 PolarHBondContact O-N 3.34Å; L9-S12 VanDerWaalsContact O-N 3.11Å; L9-S12 PolarHBondContact O-OG 3.2Å; L9-H13 PolarHBondContact O-CD2 2.97Å; L9-H13 PolarHBondContact O-CE1 2.73Å; L9-H13 PolarHBondContact O-NE2 3.37Å
10	L	60	Low	65	Low	124 Å²	124	122.4 Å²	122.4	65%	0.649	69%	0.688	S	S	*	*	H	α-helix	trans	-61.7	-41.2	179.1	-126.4	87.1	0	0	0	112.6	L6 L7 S12 H13	L6-L10 PolarHBondContact O-N 3.32Å; L6-L10 VanDerWaalsContact O-N 3.1Å; L7-L10 PolarHBondContact O-N 3.25Å; L10-S12 VanDerWaalsContact C-N 3.27Å; L10-S12 PolarHBondContact O-N 2.98Å; L10-H13 PolarHBondContact O-N 3.23Å
11	L	61.2	Low	66.2	Low	131 Å²	131	119.2 Å²	119.2	69%	0.686	67%	0.673	S	S	*	*	H	α-helix	trans	-66.3	-28.4	176.5	-88.1	143.2	0	0	0	112.6	L7 L9 H13	L7-L11 HydrophobicContact CG-CD1 4.45Å; L7-L11 WeakPolarHBondContact O-CD1 3.27Å; L7-L11 PolarHBondContact O-N 3.07Å; L9-L11 VanDerWaalsContact C-N 3.34Å; L9-L11 PolarHBondContact O-N 2.84Å; L11-H13 PolarHBondContact O-N 2.85Å
12	S	63.2	Low	68	Low	66 Å²	66	113.3 Å²	113.3	46%	0.462	65%	0.65	S	S	.	*	H	α-helix	trans	-72.2	-14.7	179	78.8	0	0	0	0	114.2	L8 L9 L10	L8-S12 PolarHBondContact O-N 2.98Å; L8-S12 VanDerWaalsContact O-N 3.14Å; L9-S12 WeakPolarHBondContact O-CB 3.26Å; L9-S12 PolarHBondContact O-N 3.34Å; L9-S12 VanDerWaalsContact O-N 3.11Å; L9-S12 PolarHBondContact O-OG 3.2Å; L10-S12 VanDerWaalsContact C-N 3.27Å; L10-S12 PolarHBondContact O-N 2.98Å
13	H	63.1	Low	69.6	Low	131 Å²	131	111.6 Å²	111.6	61%	0.606	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88	-2.2	-172.9	-62.6	-24	0	0	0	114.6	L9 L10 L11	L9-H13 PolarHBondContact O-CD2 2.97Å; L9-H13 PolarHBondContact O-CE1 2.73Å; L9-H13 PolarHBondContact O-NE2 3.37Å; L10-H13 PolarHBondContact O-N 3.23Å; L11-H13 PolarHBondContact O-N 2.85Å
14	C	64.4	Low	71.4	Confident	112 Å²	112	105.8 Å²	105.8	76%	0.757	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	-120.7	27.6	-175.1	-74.4	0	0	0	0	114.5	G16	C14-G16 PolarHBondContact O-N 2.61Å
15	T	67.2	Low	73.2	Confident	118 Å²	118	104.3 Å²	104.3	72%	0.724	61%	0.605	S	S	*	*			trans	-82.2	2.2	178.6	-28.2	0	0	0	0	114.1	S17	T15-S17 PolarHBondContact O-N 3.21Å; T15-S17 VanDerWaalsContact O-N 3.07Å
16	G	66.5	Low	75	Confident	62 Å²	62	103.7 Å²	103.7	64%	0.639	60%	0.601	S	S	*	*			trans	-72.8	98.3	171.1	0	0	0	0	0	110.8	C14 L18	C14-G16 PolarHBondContact O-N 2.61Å; G16-L18 WeakPolarHBondContact O-CD2 3.32Å
17	S	71.7	Confident	76.7	Confident	115 Å²	115	105.1 Å²	105.1	80%	0.804	62%	0.616	S	S	*	*			trans	-84.2	113.3	164.3	-65.3	0	0	0	0	108.7	T15 S19	T15-S17 PolarHBondContact O-N 3.21Å; T15-S17 VanDerWaalsContact O-N 3.07Å; S17-S19 PolarHBondContact O-N 2.75Å
18	L	70.5	Confident	78.3	Confident	164 Å²	164	104.5 Å²	104.5	86%	0.859	62%	0.622	S	S	*	*			trans	-90.1	94.7	176.5	-74.1	-85.4	0	0	0	106.7	G16	G16-L18 WeakPolarHBondContact O-CD2 3.32Å
19	S	79.3	Confident	79.7	Confident	107 Å²	107	101.9 Å²	101.9	75%	0.748	61%	0.614	S	S	*	*	P	Polyproline II helix	trans	-93.2	149.2	173.3	62.8	0	0	0	0	111.2	S17	S17-S19 PolarHBondContact O-N 2.75Å
20	Q	84.5	Confident	81.3	Confident	174 Å²	174	102.8 Å²	102.8	81%	0.813	63%	0.628	S	S	*	*	P	Polyproline II helix	trans	-70.8	141.3	171.2	-68.9	179.8	-48	0	0	110.4
21	P	89.2	Confident	83.1	Confident	55 Å²	55	98.5 Å²	98.5	36%	0.357	61%	0.611	S	S	.	*	P	Polyproline II helix	trans	-64.5	136.7	176.2	26.9	-33.9	0	0	0	110.5	P44 I47 I117	P21-P44 HydrophobicContact CB-CG 3.72Å; P21-I47 HydrophobicContact CB-CD1 3.77Å; P21-I47 HydrophobicContact CG-CD1 3.98Å; P21-I117 HydrophobicContact CG-CD1 3.83Å
22	V	94.2	Very high	84.8	Confident	116 Å²	116	95.3 Å²	95.3	70%	0.703	60%	0.6	S	S	*	*	P	Polyproline II helix	trans	-89.2	122.9	176.9	-178.6	0	0	0	0	109.2
23	L	97.6	Very high	86.4	Confident	41 Å²	41	97.7 Å²	97.7	22%	0.215	61%	0.613	C	S	.	*	P	Polyproline II helix	trans	-90.1	143.3	177.2	-55.1	176	0	0	0	110.3	L43 I117	L23-L43 HydrophobicContact CD2-CB 4.43Å; L23-L43 HydrophobicContact CD2-CD1 4.03Å; L23-L43 HydrophobicContact CD2-CG 3.76Å; L23-I117 HydrophobicContact CD1-CG1 4.25Å; L23-I117 HydrophobicContact CD1-CG2 3.87Å; L23-I117 HydrophobicContact CD2-CD1 3.87Å; L23-I117 HydrophobicContact CD2-CG1 4.15Å; L23-I117 HydrophobicContact CD2-CG2 4.02Å
24	T	98.3	Very high	88.1	Confident	92 Å²	92	94.1 Å²	94.1	56%	0.564	61%	0.612	S	S	*	*	B	Isolated β-bridge	trans	-109.3	126.2	178.6	-57.1	0	0	0	0	110.4	T42	T24-T42 PolarHBondContact N-O 3.19Å; T24-T42 PolarHBondContact O-N 3.2Å
25	Q	98.5	Very high	89.7	Confident	61 Å²	61	93.7 Å²	93.7	29%	0.285	60%	0.598	S	S	.	*			trans	-122.4	147.5	173.2	-66.2	-176	-117.1	0	0	109.8	C41 Y113 C115	Q25-C41 HydrophobicContact CG-CB 4.41Å; Q25-Y113 PolarHBondContact NE2-O 3.14Å; Q25-C115 VanDerWaalsContact OE1-N 3.1Å; Q25-C115 PolarHBondContact OE1-SG 3.1Å; Q25-C115 VanDerWaalsContact OE1-SG 3.34Å
26	P	97.2	Very high	91.2	Very high	67 Å²	67	91.5 Å²	91.5	44%	0.435	59%	0.588	S	S	.	*			trans	-57.7	143.5	168.2	-22.1	33.4	0	0	0	110.8	S28 T40	P26-S28 PolarHBondContact O-N 3.22Å; P26-T40 WeakPolarHBondContact CD-O 3.5Å; P26-T40 WeakPolarHBondContact CD-OG1 3.26Å; P26-T40 WeakPolarHBondContact CG-OG1 3.46Å
27	P	95.1	Very high	92.7	Very high	138 Å²	138	89 Å²	89	90%	0.896	56%	0.561	S	S	*	*	S	Bend	trans	-67.8	-25.1	-177	27.9	-35.7	0	0	0	113
28	S	96	Very high	93.9	Very high	100 Å²	100	89.8 Å²	89.8	70%	0.699	55%	0.547	S	S	*	.			trans	-154.1	159.2	175.3	59.7	0	0	0	0	110.2	P26	P26-S28 PolarHBondContact O-N 3.22Å
29	S	94.4	Very high	95.3	Very high	66 Å²	66	83.1 Å²	83.1	46%	0.462	51%	0.512	S	S	.	.			trans	-145.2	146.3	170.4	-170.1	0	0	0	0	108
30	S	95.8	Very high	96.2	Very high	118 Å²	118	79.2 Å²	79.2	83%	0.825	48%	0.483	S	S	*	.			trans	-141.9	138.2	-178.1	61.7	0	0	0	0	109.9
31	A	96.4	Very high	96.9	Very high	35 Å²	35	70.9 Å²	70.9	29%	0.289	45%	0.445	S	S	.	.			trans	-145.8	159.6	171.6	0	0	0	0	0	109.3	E35 A37 L105	A31-E35 HydrophobicContact CB-CB 4.4Å; A31-A37 HydrophobicContact CB-CB 4.21Å; A31-L105 HydrophobicContact CB-CD2 4.07Å
32	S	97.7	Very high	97.3	Very high	64 Å²	64	70.6 Å²	70.6	45%	0.448	44%	0.442	S	S	.	.			trans	-75.3	152	-178.9	-46.5	0	0	0	0	110.8	G34 E35	S32-G34 PolarHBondContact O-N 3.4Å; S32-E35 VanDerWaalsContact CB-OE2 3.27Å; S32-E35 WeakPolarHBondContact CB-OE2 3.2Å; S32-E35 PolarHBondContact N-OE2 3.12Å; S32-E35 WeakPolarHBondContact O-CB 3.4Å; S32-E35 PolarHBondContact O-N 2.86Å; S32-E35 PolarHBondContact OG-OE2 2.9Å; S32-E35 VanDerWaalsContact OG-OE2 3.1Å
33	P	97.5	Very high	97.5	Very high	116 Å²	116	65.3 Å²	65.3	75%	0.753	41%	0.41	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.1	134.2	171.8	-26.6	35.1	0	0	0	111.7	E35 L105	P33-E35 VanDerWaalsContact C-N 3.27Å; P33-E35 PolarHBondContact O-N 3.23Å; P33-L105 WeakPolarHBondContact CA-O 3.12Å
34	G	98	Very high	97.4	Very high	55 Å²	55	65 Å²	65	57%	0.567	41%	0.41	S	S	*	.	T	Hydrogen-bonded Turn	trans	83.5	-16	-175.8	0	0	0	0	0	115.4	S32 G104 L105	S32-G34 PolarHBondContact O-N 3.4Å; G34-G104 WeakPolarHBondContact O-CA 3.32Å; G34-L105 PolarHBondContact N-O 3.36Å
35	E	98.2	Very high	97.3	Very high	103 Å²	103	66.6 Å²	66.6	48%	0.481	43%	0.425	S	S	.	.	S	Bend	trans	-75.6	175.1	172.9	-66.8	-174.2	144.5	0	0	111.8	A31 S32 P33 G104 L105	A31-E35 HydrophobicContact CB-CB 4.4Å; S32-E35 VanDerWaalsContact CB-OE2 3.27Å; S32-E35 WeakPolarHBondContact CB-OE2 3.2Å; S32-E35 PolarHBondContact N-OE2 3.12Å; S32-E35 WeakPolarHBondContact O-CB 3.4Å; S32-E35 PolarHBondContact O-N 2.86Å; S32-E35 PolarHBondContact OG-OE2 2.9Å; S32-E35 VanDerWaalsContact OG-OE2 3.1Å; P33-E35 VanDerWaalsContact C-N 3.27Å; P33-E35 PolarHBondContact O-N 3.23Å; E35-G104 PolarHBondContact O-N 3.33Å; E35-L105 WeakPolarHBondContact O-CB 3.24Å; E35-L105 PolarHBondContact O-N 3.23Å
36	S	98.1	Very high	97.1	Very high	72 Å²	72	70 Å²	70	50%	0.503	45%	0.445	S	S	.	.			trans	-93.4	125.9	170.3	-60.9	0	0	0	0	110.6	I102	S36-I102 CarbonylContact C-O 3.48Å; S36-I102 WeakPolarHBondContact CA-O 3.38Å
37	A	97.9	Very high	96.9	Very high	10 Å²	10	68.1 Å²	68.1	8%	0.083	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.7	135.6	168.8	0	0	0	0	0	110.3	A31 L101 I102 L105	A31-A37 HydrophobicContact CB-CB 4.21Å; A37-L101 WeakPolarHBondContact O-CA 3.23Å; A37-I102 HydrophobicContact CB-CB 4.36Å; A37-I102 PolarHBondContact N-O 2.84Å; A37-I102 PolarHBondContact O-N 3.31Å; A37-L105 HydrophobicContact CB-CD1 4Å; A37-L105 HydrophobicContact CB-CD2 4.28Å
38	R	98.2	Very high	96.9	Very high	131 Å²	131	65.9 Å²	65.9	49%	0.494	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	120.9	175.9	-177.9	175.7	174.2	-99.3	4.7	109.7	I99 L101	R38-I99 HydrophobicContact CG-CG2 3.94Å; R38-L101 HydrophobicContact CB-CD1 4.46Å
39	L	98.7	Very high	97	Very high	25 Å²	25	61.2 Å²	61.2	13%	0.131	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114	139.6	176.5	-64.5	164.9	0	0	0	109.1	W56 I99 L100 I102 Y113	L39-W56 HydrophobicContact CB-CH2 4.19Å; L39-W56 HydrophobicContact CB-CZ3 4.29Å; L39-I99 WeakPolarHBondContact O-CA 2.98Å; L39-L100 HydrophobicContact CB-CB 4.25Å; L39-L100 HydrophobicContact CD1-CD2 3.99Å; L39-L100 PolarHBondContact N-O 3.09Å; L39-L100 PolarHBondContact O-N 2.78Å; L39-I102 HydrophobicContact CD1-CD1 4.24Å; L39-Y113 HydrophobicContact CD1-CD1 3.9Å; L39-Y113 HydrophobicContact CD1-CD2 3.62Å; L39-Y113 HydrophobicContact CD1-CE1 4.39Å; L39-Y113 HydrophobicContact CD1-CE2 4.16Å; L39-Y113 HydrophobicContact CD1-CG 3.46Å; L39-Y113 VanDerWaalsContact CD1-CG 3.46Å
40	T	98.6	Very high	97.1	Very high	24 Å²	24	59.6 Å²	59.6	15%	0.147	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.1	142.7	-173.6	53.9	0	0	0	0	111.3	P26 T97 G98	P26-T40 WeakPolarHBondContact CD-O 3.5Å; P26-T40 WeakPolarHBondContact CD-OG1 3.26Å; P26-T40 WeakPolarHBondContact CG-OG1 3.46Å; T40-T97 HydrophobicContact CG2-CG2 3.98Å; T40-G98 WeakPolarHBondContact CA-O 3.33Å
41	C	98.7	Very high	97	Very high	0 Å²	0	56.7 Å²	56.7	0%	0	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129	102	176.1	176	0	0	0	0	109.2	Q25 W56 T97 G98 C115	Q25-C41 HydrophobicContact CG-CB 4.41Å; C41-W56 HydrophobicContact CB-CH2 3.71Å; C41-W56 HydrophobicContact CB-CZ2 3.82Å; C41-T97 CarbonylContact O-C 3.53Å; C41-T97 WeakPolarHBondContact O-CA 3.39Å; C41-G98 PolarHBondContact N-O 3.31Å; C41-G98 PolarHBondContact O-N 3.43Å; C41-C115 HydrophobicContact CB-CB 3.37Å; C41-C115 WeakPolarHBondContact CB-SG 3.43Å; C41-C115 WeakPolarHBondContact SG-CB 3Å; C41-C115 CovalentContact SG-SG 2.01Å; C41-C115 PolarHBondContact SG-SG 3.42Å
42	T	98.6	Very high	97	Very high	49 Å²	49	57.2 Å²	57.2	30%	0.301	35%	0.347	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.1	129.5	-176.3	-59.3	0	0	0	0	110.4	T24 T97	T24-T42 PolarHBondContact N-O 3.19Å; T24-T42 PolarHBondContact O-N 3.2Å; T42-T97 PolarHBondContact OG1-OG1 2.96Å
43	L	98	Very high	97	Very high	5 Å²	5	54.8 Å²	54.8	3%	0.026	33%	0.329	C	S	.	.	P	Polyproline II helix	trans	-86.2	151.5	176.3	-78.7	66.7	0	0	0	109.8	L23 I47 V49 Y52 I54 N96 I117	L23-L43 HydrophobicContact CD2-CB 4.43Å; L23-L43 HydrophobicContact CD2-CD1 4.03Å; L23-L43 HydrophobicContact CD2-CG 3.76Å; L43-I47 HydrophobicContact CB-CD1 4.15Å; L43-I47 HydrophobicContact CB-CG1 4Å; L43-I47 HydrophobicContact CD2-CD1 3.83Å; L43-I47 HydrophobicContact CD2-CG1 4.04Å; L43-I47 HydrophobicContact CG-CD1 4.14Å; L43-I47 HydrophobicContact CG-CG1 4.43Å; L43-V49 HydrophobicContact CD1-CB 4.49Å; L43-V49 HydrophobicContact CD1-CG2 4.04Å; L43-V49 HydrophobicContact CD2-CB 3.97Å; L43-V49 HydrophobicContact CD2-CG2 4.11Å; L43-Y52 HydrophobicContact CD2-CD2 4.36Å; L43-I54 HydrophobicContact CD1-CD1 4.25Å; L43-N96 PolarHBondContact N-O 2.98Å; L43-N96 PolarHBondContact O-ND2 2.95Å; L43-I117 HydrophobicContact CD1-CG2 4.05Å; L43-I117 HydrophobicContact CD2-CD1 3.92Å; L43-I117 HydrophobicContact CD2-CG2 4.27Å; L43-I117 HydrophobicContact CG-CD1 4.11Å; L43-I117 HydrophobicContact CG-CG2 4.24Å
44	P	96.5	Very high	97	Very high	34 Å²	34	49.3 Å²	49.3	22%	0.221	29%	0.293	C	S	.	.	P	Polyproline II helix	trans	-64.8	152.5	175.6	31.2	-35.7	0	0	0	110.5	P21 D46 I47 N96	P21-P44 HydrophobicContact CB-CG 3.72Å; P44-D46 VanDerWaalsContact CB-OD1 3.25Å; P44-D46 WeakPolarHBondContact CB-OD1 3.47Å; P44-D46 WeakPolarHBondContact CG-OD1 3.49Å; P44-D46 PolarHBondContact O-N 2.86Å; P44-D46 VanDerWaalsContact O-N 3.16Å; P44-I47 HydrophobicContact CG-CD1 3.99Å; P44-I47 HydrophobicContact CG-CG1 3.96Å; P44-I47 WeakPolarHBondContact O-CG1 3.35Å; P44-I47 PolarHBondContact O-N 3.38Å; P44-N96 PolarHBondContact O-ND2 2.92Å; P44-N96 VanDerWaalsContact O-ND2 3.07Å
45	S	95.8	Very high	97.1	Very high	126 Å²	126	49.1 Å²	49.1	88%	0.881	28%	0.276	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.3	-16.6	-168	54.3	0	0	0	0	114.9	I47	S45-I47 VanDerWaalsContact C-N 3.32Å
46	D	92.9	Very high	97.1	Very high	132 Å²	132	44.2 Å²	44.2	71%	0.706	25%	0.253	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81	-9.8	178.9	62.4	-47	0	0	0	113.4	P44	P44-D46 VanDerWaalsContact CB-OD1 3.25Å; P44-D46 WeakPolarHBondContact CB-OD1 3.47Å; P44-D46 WeakPolarHBondContact CG-OD1 3.49Å; P44-D46 PolarHBondContact O-N 2.86Å; P44-D46 VanDerWaalsContact O-N 3.16Å
47	I	93.4	Very high	97.1	Very high	28 Å²	28	44 Å²	44	14%	0.144	24%	0.242	C	C	.	.	S	Bend	trans	-122.9	152.7	174.5	70.8	176.7	0	0	0	111.6	P21 L43 P44 S45 Y52 N96 I117	P21-I47 HydrophobicContact CB-CD1 3.77Å; P21-I47 HydrophobicContact CG-CD1 3.98Å; L43-I47 HydrophobicContact CB-CD1 4.15Å; L43-I47 HydrophobicContact CB-CG1 4Å; L43-I47 HydrophobicContact CD2-CD1 3.83Å; L43-I47 HydrophobicContact CD2-CG1 4.04Å; L43-I47 HydrophobicContact CG-CD1 4.14Å; L43-I47 HydrophobicContact CG-CG1 4.43Å; P44-I47 HydrophobicContact CG-CD1 3.99Å; P44-I47 HydrophobicContact CG-CG1 3.96Å; P44-I47 WeakPolarHBondContact O-CG1 3.35Å; P44-I47 PolarHBondContact O-N 3.38Å; S45-I47 VanDerWaalsContact C-N 3.32Å; I47-Y52 HydrophobicContact CB-CE2 4Å; I47-Y52 HydrophobicContact CD1-CE2 4.14Å; I47-Y52 HydrophobicContact CG1-CE2 4.43Å; I47-N96 PolarHBondContact O-ND2 3.47Å; I47-N96 PolarHBondContact O-OD1 2.78Å; I47-I117 HydrophobicContact CD1-CD1 3.51Å
48	N	95.6	Very high	97.2	Very high	91 Å²	91	44 Å²	44	49%	0.487	24%	0.24	S	C	.	.			trans	-106.3	122.3	-177.1	-173.7	-72.5	0	0	0	111.5	G50 S51 Y52	N48-G50 PolarHBondContact O-N 2.77Å; N48-G50 VanDerWaalsContact O-N 3.09Å; N48-G50 VanDerWaalsContact OD1-CA 3.24Å; N48-G50 WeakPolarHBondContact OD1-CA 3.49Å; N48-G50 PolarHBondContact OD1-N 2.9Å; N48-S51 PolarHBondContact O-N 2.95Å; N48-Y52 VanDerWaalsContact O-CD2 3.28Å; N48-Y52 WeakPolarHBondContact O-CD2 3.35Å
49	V	97.3	Very high	97.2	Very high	1 Å²	1	40.3 Å²	40.3	1%	0.006	23%	0.229	C	C	.	.	G	3₁₀ helix	trans	-56.9	-24.8	178.9	72.7	0	0	0	0	114.2	L43 S51 Y52 I54 K91 N96	L43-V49 HydrophobicContact CD1-CB 4.49Å; L43-V49 HydrophobicContact CD1-CG2 4.04Å; L43-V49 HydrophobicContact CD2-CB 3.97Å; L43-V49 HydrophobicContact CD2-CG2 4.11Å; V49-S51 PolarHBondContact O-N 2.91Å; V49-Y52 PolarHBondContact O-N 2.91Å; V49-I54 HydrophobicContact CG2-CD1 3.85Å; V49-I54 HydrophobicContact CG2-CG1 4.34Å; V49-K91 HydrophobicContact CG2-CD 4.13Å; V49-K91 HydrophobicContact CG2-CG 4.03Å; V49-K91 WeakPolarHBondContact O-CE 3.22Å; V49-K91 PolarHBondContact O-NZ 2.82Å; V49-N96 WeakPolarHBondContact CB-OD1 3.47Å; V49-N96 PolarHBondContact N-OD1 2.98Å
50	G	96.4	Very high	97.1	Very high	32 Å²	32	43 Å²	43	33%	0.33	24%	0.239	S	C	.	.	G	3₁₀ helix	trans	-63	-28.6	174.2	0	0	0	0	0	113.3	N48 Y72	N48-G50 PolarHBondContact O-N 2.77Å; N48-G50 VanDerWaalsContact O-N 3.09Å; N48-G50 VanDerWaalsContact OD1-CA 3.24Å; N48-G50 WeakPolarHBondContact OD1-CA 3.49Å; N48-G50 PolarHBondContact OD1-N 2.9Å; G50-Y72 WeakPolarHBondContact O-CE2 3.46Å; G50-Y72 PolarHBondContact O-OH 3.41Å
51	S	95.1	Very high	97.1	Very high	57 Å²	57	47.5 Å²	47.5	40%	0.399	27%	0.269	S	S	.	.	G	3₁₀ helix	trans	-88.1	-3.2	-178.4	-57.1	0	0	0	0	114.2	N48 V49 S120	N48-S51 PolarHBondContact O-N 2.95Å; V49-S51 PolarHBondContact O-N 2.91Å; S51-S120 PolarHBondContact O-N 3.06Å; S51-S120 PolarHBondContact O-OG 3.44Å
52	Y	96.2	Very high	97	Very high	46 Å²	46	52 Å²	52	18%	0.18	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.3	143.9	-173.9	-68.7	-100.5	0	0	0	112.6	L43 I47 N48 V49 K91 I117 W118 P119	L43-Y52 HydrophobicContact CD2-CD2 4.36Å; I47-Y52 HydrophobicContact CB-CE2 4Å; I47-Y52 HydrophobicContact CD1-CE2 4.14Å; I47-Y52 HydrophobicContact CG1-CE2 4.43Å; N48-Y52 VanDerWaalsContact O-CD2 3.28Å; N48-Y52 WeakPolarHBondContact O-CD2 3.35Å; V49-Y52 PolarHBondContact O-N 2.91Å; Y52-K91 VanDerWaalsContact O-CE 3.24Å; Y52-K91 WeakPolarHBondContact O-CE 3.48Å; Y52-K91 PolarHBondContact O-NZ 3.07Å; Y52-I117 HydrophobicContact CD1-CB 3.98Å; Y52-I117 HydrophobicContact CD1-CD1 3.73Å; Y52-I117 HydrophobicContact CD1-CG1 4.02Å; Y52-I117 HydrophobicContact CE1-CD1 3.9Å; Y52-I117 HydrophobicContact CE1-CG1 4.44Å; Y52-I117 HydrophobicContact CG-CB 4.36Å; Y52-I117 HydrophobicContact CG-CD1 4.19Å; Y52-W118 CarbonylContact C-O 3.51Å; Y52-W118 VanDerWaalsContact CA-O 3.3Å; Y52-W118 WeakPolarHBondContact CA-O 3.4Å; Y52-P119 HydrophobicContact CD1-CB 4.47Å; Y52-P119 HydrophobicContact CD1-CG 4.21Å; Y52-P119 HydrophobicContact CE1-CB 4.26Å; Y52-P119 HydrophobicContact CE1-CG 3.74Å
53	N	97.3	Very high	96.9	Very high	14 Å²	14	52.3 Å²	52.3	8%	0.075	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.8	137.7	160	-70.3	-87.4	0	0	0	108.9	Y55 Y72 I117 W118 S120	N53-Y55 HydrophobicContact CB-CD2 4.24Å; N53-Y55 HydrophobicContact CB-CE2 3.43Å; N53-Y55 VanDerWaalsContact CB-CE2 3.43Å; N53-Y72 WeakPolarHBondContact OD1-CB 3.2Å; N53-I117 VanDerWaalsContact O-CA 3.27Å; N53-I117 WeakPolarHBondContact O-CA 3.28Å; N53-W118 HydrophobicContact CB-CB 4.45Å; N53-W118 PolarHBondContact N-O 3.27Å; N53-W118 PolarHBondContact O-N 2.85Å; N53-S120 WeakPolarHBondContact ND2-CA 3.43Å
54	I	98.4	Very high	96.9	Very high	0 Å²	0	57.1 Å²	57.1	0%	0	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.2	119.9	173.2	-46.2	-57.1	0	0	0	108.6	L43 V49 Y70 Y71 K91 I117	L43-I54 HydrophobicContact CD1-CD1 4.25Å; V49-I54 HydrophobicContact CG2-CD1 3.85Å; V49-I54 HydrophobicContact CG2-CG1 4.34Å; I54-Y70 CarbonylContact O-C 3.59Å; I54-Y70 WeakPolarHBondContact O-CA 3.3Å; I54-Y71 PolarHBondContact N-O 2.84Å; I54-Y71 PolarHBondContact O-N 3.31Å; I54-K91 HydrophobicContact CG1-CG 4.26Å; I54-I117 HydrophobicContact CD1-CB 4.48Å; I54-I117 HydrophobicContact CD1-CG2 3.51Å
55	Y	98.6	Very high	97	Very high	52 Å²	52	58.9 Å²	58.9	20%	0.204	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	142.6	175.9	-61.2	-101.8	0	0	0	109.3	N53 Y67 L69 Y70 C115 M116 W118	N53-Y55 HydrophobicContact CB-CD2 4.24Å; N53-Y55 HydrophobicContact CB-CE2 3.43Å; N53-Y55 VanDerWaalsContact CB-CE2 3.43Å; Y55-Y67 AromaticContact CD1-CE2 3.8Å; Y55-Y67 HydrophobicContact CD1-CE2 3.8Å; Y55-L69 CarbonylContact C-O 3.57Å; Y55-L69 WeakPolarHBondContact CA-O 3.38Å; Y55-Y70 VanDerWaalsContact CE1-CB 3.49Å; Y55-Y70 HydrophobicContact CE1-CG 4.15Å; Y55-C115 CarbonylContact O-C 3.25Å; Y55-C115 VanDerWaalsContact O-CA 3.22Å; Y55-C115 WeakPolarHBondContact O-CA 3.37Å; Y55-M116 HydrophobicContact CD2-SD 3.82Å; Y55-M116 HydrophobicContact CE2-SD 4.42Å; Y55-M116 HydrophobicContact CG-SD 4.25Å; Y55-M116 PolarHBondContact N-O 2.73Å; Y55-M116 PolarHBondContact O-N 2.93Å; Y55-W118 HydrophobicContact CD2-CB 4.47Å; Y55-W118 HydrophobicContact CE2-CB 3.65Å
56	W	98.9	Very high	97.1	Very high	0 Å²	0	57.9 Å²	57.9	0%	0	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	138.8	176.7	-73.7	100.2	0	0	0	111.1	L39 C41 L68 L69 I99 L100 Y114 C115	L39-W56 HydrophobicContact CB-CH2 4.19Å; L39-W56 HydrophobicContact CB-CZ3 4.29Å; C41-W56 HydrophobicContact CB-CH2 3.71Å; C41-W56 HydrophobicContact CB-CZ2 3.82Å; W56-L68 HydrophobicContact CB-CB 4.42Å; W56-L68 WeakPolarHBondContact O-CB 3.47Å; W56-L68 PolarHBondContact O-N 3.49Å; W56-L69 HydrophobicContact CB-CD1 4.34Å; W56-L69 HydrophobicContact CB-CG 4.36Å; W56-L69 HydrophobicContact CG-CD1 4.38Å; W56-L69 PolarHBondContact N-O 2.94Å; W56-L69 PolarHBondContact O-N 2.87Å; W56-I99 PolarHBondContact NE1-O 2.97Å; W56-L100 HydrophobicContact CB-CD1 4.29Å; W56-L100 HydrophobicContact CB-CD2 4.23Å; W56-L100 HydrophobicContact CD2-CB 3.53Å; W56-L100 HydrophobicContact CD2-CD2 4.06Å; W56-L100 HydrophobicContact CD2-CG 4.29Å; W56-L100 VanDerWaalsContact CE2-CB 3.45Å; W56-L100 HydrophobicContact CE3-CB 3.94Å; W56-L100 HydrophobicContact CE3-CD2 3.98Å; W56-L100 HydrophobicContact CG-CB 3.9Å; W56-L100 HydrophobicContact CG-CD1 4.14Å; W56-L100 HydrophobicContact CG-CD2 4.18Å; W56-L100 HydrophobicContact CG-CG 4.32Å; W56-L100 HydrophobicContact CH2-CB 4.17Å; W56-L100 HydrophobicContact CZ2-CB 3.8Å; W56-L100 HydrophobicContact CZ3-CB 4.24Å; W56-Y114 WeakPolarHBondContact CA-O 3.43Å; W56-C115 HydrophobicContact CD2-CB 4.25Å; W56-C115 HydrophobicContact CE3-CB 4Å; W56-C115 HydrophobicContact CH2-CB 4.03Å; W56-C115 HydrophobicContact CZ2-CB 4.25Å; W56-C115 HydrophobicContact CZ3-CB 3.89Å
57	Y	98.8	Very high	97.3	Very high	66 Å²	66	55.2 Å²	55.2	26%	0.259	32%	0.32	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	145	179.5	-61	-99.7	0	0	0	109.9	R66 Y67 Y113 Y114 M116	Y57-R66 CarbonylContact C-O 3.55Å; Y57-R66 WeakPolarHBondContact CA-O 3.19Å; Y57-Y67 HydrophobicContact CD1-CD2 4.44Å; Y57-Y67 AromaticContact CE1-CD2 3.91Å; Y57-Y67 HydrophobicContact CE1-CD2 3.91Å; Y57-Y67 HydrophobicContact CE1-CG 4.32Å; Y57-Y67 AromaticContact CZ-CD2 3.97Å; Y57-Y113 VanDerWaalsContact O-CA 3.31Å; Y57-Y113 WeakPolarHBondContact O-CA 3.25Å; Y57-Y114 PolarHBondContact N-O 2.93Å; Y57-Y114 PolarHBondContact O-N 3.33Å; Y57-M116 HydrophobicContact CE2-CB 4.14Å
58	Q	98.7	Very high	97.6	Very high	12 Å²	12	54 Å²	54	6%	0.056	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	130.1	174.5	-177.5	-171.9	56.7	0	0	109.2	R66 L68 A111 D112 Y113	Q58-R66 PolarHBondContact N-O 2.77Å; Q58-R66 WeakPolarHBondContact O-CB 3.05Å; Q58-R66 PolarHBondContact O-N 3.42Å; Q58-L68 HydrophobicContact CB-CD1 3.84Å; Q58-L68 HydrophobicContact CB-CD2 3.89Å; Q58-L68 HydrophobicContact CB-CG 3.89Å; Q58-A111 HydrophobicContact CG-CB 3.4Å; Q58-D112 CarbonylContact C-O 3.5Å; Q58-D112 WeakPolarHBondContact CA-O 3.46Å; Q58-Y113 HydrophobicContact CB-CD1 4.22Å; Q58-Y113 HydrophobicContact CB-CE1 3.93Å; Q58-Y113 HydrophobicContact CG-CD1 4.44Å; Q58-Y113 HydrophobicContact CG-CE1 3.86Å; Q58-Y113 PolarHBondContact NE2-OH 3.04Å
59	Q	98.6	Very high	97.8	Very high	53 Å²	53	49.8 Å²	49.8	25%	0.248	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.9	116.9	175.2	-172.2	174.2	16.5	0	0	110.4	S63 P65 A111 D112 Y114	Q59-S63 VanDerWaalsContact CG-O 3.29Å; Q59-S63 WeakPolarHBondContact CG-O 3.25Å; Q59-S63 PolarHBondContact NE2-O 2.83Å; Q59-P65 HydrophobicContact CB-CB 4.48Å; Q59-P65 HydrophobicContact CB-CG 4.39Å; Q59-P65 HydrophobicContact CG-CG 4.32Å; Q59-A111 WeakPolarHBondContact O-CB 3.49Å; Q59-D112 HydrophobicContact CB-CB 4.44Å; Q59-D112 PolarHBondContact N-O 2.81Å; Q59-D112 PolarHBondContact O-N 2.67Å; Q59-Y114 HydrophobicContact CB-CD2 4.36Å; Q59-Y114 HydrophobicContact CB-CE2 3.85Å; Q59-Y114 VanDerWaalsContact OE1-CE2 3.29Å
60	K	97.7	Very high	97.8	Very high	80 Å²	80	52.5 Å²	52.5	35%	0.348	30%	0.301	S	S	.	.			trans	-85.3	153.9	170.7	-68.6	-172.1	176.1	-168	0	110.6	G62 S63 E108 A111	K60-G62 PolarHBondContact O-N 3.35Å; K60-S63 WeakPolarHBondContact O-CB 3.35Å; K60-S63 PolarHBondContact O-N 2.85Å; K60-E108 WeakPolarHBondContact CE-O 3.44Å; K60-E108 PolarHBondContact NZ-O 3.35Å; K60-A111 HydrophobicContact CG-CB 4.14Å
61	P	97	Very high	97.9	Very high	119 Å²	119	52 Å²	52	77%	0.773	29%	0.29	S	S	*	.	T	Hydrogen-bonded Turn	trans	-49.8	129	175	-28.6	35.6	0	0	0	112.2	S63	P61-S63 PolarHBondContact O-N 2.92Å
62	G	97.1	Very high	98	Very high	94 Å²	94	52.9 Å²	52.9	97%	0.969	29%	0.285	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.2	2	-179.7	0	0	0	0	0	115.9	K60	K60-G62 PolarHBondContact O-N 3.35Å
63	S	96.9	Very high	98	Very high	56 Å²	56	52.2 Å²	52.2	39%	0.392	29%	0.287	S	S	.	.	S	Bend	trans	-107.8	155.6	177.8	-60.1	0	0	0	0	111.6	Q59 K60 P61	Q59-S63 VanDerWaalsContact CG-O 3.29Å; Q59-S63 WeakPolarHBondContact CG-O 3.25Å; Q59-S63 PolarHBondContact NE2-O 2.83Å; K60-S63 WeakPolarHBondContact O-CB 3.35Å; K60-S63 PolarHBondContact O-N 2.85Å; P61-S63 PolarHBondContact O-N 2.92Å
64	P	97.8	Very high	98	Very high	106 Å²	106	57 Å²	57	69%	0.688	31%	0.313	S	S	*	.	P	Polyproline II helix	trans	-70.1	158.6	168.5	30.5	-35	0	0	0	111.2	R66	P64-R66 PolarHBondContact O-N 2.85Å
65	P	98.2	Very high	97.9	Very high	71 Å²	71	62.6 Å²	62.6	46%	0.461	35%	0.352	S	S	.	.	P	Polyproline II helix	trans	-58.2	128	171.1	-23.9	34.1	0	0	0	112	Q59	Q59-P65 HydrophobicContact CB-CB 4.48Å; Q59-P65 HydrophobicContact CB-CG 4.39Å; Q59-P65 HydrophobicContact CG-CG 4.32Å
66	R	98.2	Very high	97.8	Very high	106 Å²	106	63 Å²	63	40%	0.4	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.6	127.4	174.6	177.8	-174.5	177.4	-170.6	1.5	109.5	Y57 Q58 P64 L68 S81 G82	Y57-R66 CarbonylContact C-O 3.55Å; Y57-R66 WeakPolarHBondContact CA-O 3.19Å; Q58-R66 PolarHBondContact N-O 2.77Å; Q58-R66 WeakPolarHBondContact O-CB 3.05Å; Q58-R66 PolarHBondContact O-N 3.42Å; P64-R66 PolarHBondContact O-N 2.85Å; R66-L68 PolarHBondContact O-N 3.33Å; R66-S81 PolarHBondContact NH2-O 2.8Å; R66-G82 PolarHBondContact NH2-O 2.65Å
67	Y	98.5	Very high	97.7	Very high	76 Å²	76	68.1 Å²	68.1	30%	0.298	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.2	128.9	171.1	172.7	-111.8	0	0	0	111.6	Y55 Y57 L69 Y70	Y55-Y67 AromaticContact CD1-CE2 3.8Å; Y55-Y67 HydrophobicContact CD1-CE2 3.8Å; Y57-Y67 HydrophobicContact CD1-CD2 4.44Å; Y57-Y67 AromaticContact CE1-CD2 3.91Å; Y57-Y67 HydrophobicContact CE1-CD2 3.91Å; Y57-Y67 HydrophobicContact CE1-CG 4.32Å; Y57-Y67 AromaticContact CZ-CD2 3.97Å; Y67-L69 VanDerWaalsContact CE2-O 3.27Å; Y67-L69 WeakPolarHBondContact CE2-O 3.18Å; Y67-L69 VanDerWaalsContact CZ-C 3.49Å; Y67-L69 WeakPolarHBondContact OH-CA 3.43Å; Y67-Y70 WeakPolarHBondContact OH-CD1 3.37Å; Y67-Y70 PolarHBondContact OH-N 2.94Å
68	L	98.8	Very high	97.6	Very high	1 Å²	1	66.1 Å²	66.1	1%	0.005	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.1	-57.9	177.5	-66.9	-175.5	0	0	0	112.7	W56 Q58 R66 G80 V83 F87 L100 Y113	W56-L68 HydrophobicContact CB-CB 4.42Å; W56-L68 WeakPolarHBondContact O-CB 3.47Å; W56-L68 PolarHBondContact O-N 3.49Å; Q58-L68 HydrophobicContact CB-CD1 3.84Å; Q58-L68 HydrophobicContact CB-CD2 3.89Å; Q58-L68 HydrophobicContact CB-CG 3.89Å; R66-L68 PolarHBondContact O-N 3.33Å; L68-G80 PolarHBondContact O-N 2.93Å; L68-V83 HydrophobicContact CB-CG1 4.44Å; L68-V83 HydrophobicContact CD2-CG1 4.1Å; L68-V83 HydrophobicContact CD2-CG2 4Å; L68-V83 WeakPolarHBondContact O-CG2 3.42Å; L68-F87 HydrophobicContact CD1-CD1 3.76Å; L68-F87 HydrophobicContact CD1-CE1 3.86Å; L68-L100 HydrophobicContact CD1-CD2 4.07Å; L68-Y113 HydrophobicContact CD1-CD1 4.02Å; L68-Y113 HydrophobicContact CD1-CE1 3.74Å
69	L	98.8	Very high	97.6	Very high	4 Å²	4	70.8 Å²	70.8	2%	0.021	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-165.6	164.8	-173.6	60.8	85.3	0	0	0	111.4	Y55 W56 Y67 G78 Q79 F87 L100	Y55-L69 CarbonylContact C-O 3.57Å; Y55-L69 WeakPolarHBondContact CA-O 3.38Å; W56-L69 HydrophobicContact CB-CD1 4.34Å; W56-L69 HydrophobicContact CB-CG 4.36Å; W56-L69 HydrophobicContact CG-CD1 4.38Å; W56-L69 PolarHBondContact N-O 2.94Å; W56-L69 PolarHBondContact O-N 2.87Å; Y67-L69 VanDerWaalsContact CE2-O 3.27Å; Y67-L69 WeakPolarHBondContact CE2-O 3.18Å; Y67-L69 VanDerWaalsContact CZ-C 3.49Å; Y67-L69 WeakPolarHBondContact OH-CA 3.43Å; L69-G78 CarbonylContact C-O 3.57Å; L69-G78 WeakPolarHBondContact CA-O 3.43Å; L69-G78 WeakPolarHBondContact CB-O 3.35Å; L69-Q79 HydrophobicContact CB-CG 4.28Å; L69-F87 HydrophobicContact CD2-CB 4.15Å; L69-L100 HydrophobicContact CD2-CD1 3.76Å; L69-L100 HydrophobicContact CG-CD1 4.28Å
70	Y	98.4	Very high	97.5	Very high	57 Å²	57	68.8 Å²	68.8	22%	0.224	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	150.1	163.2	85.7	-90.5	0	0	0	110	I54 Y55 Y67 D76 K77 G78	I54-Y70 CarbonylContact O-C 3.59Å; I54-Y70 WeakPolarHBondContact O-CA 3.3Å; Y55-Y70 VanDerWaalsContact CE1-CB 3.49Å; Y55-Y70 HydrophobicContact CE1-CG 4.15Å; Y67-Y70 WeakPolarHBondContact OH-CD1 3.37Å; Y67-Y70 PolarHBondContact OH-N 2.94Å; Y70-D76 VanDerWaalsContact CE2-OD1 3.23Å; Y70-D76 WeakPolarHBondContact CE2-OD1 3.31Å; Y70-D76 PolarHBondContact OH-OD1 2.98Å; Y70-K77 WeakPolarHBondContact O-CA 3.5Å; Y70-K77 WeakPolarHBondContact O-CB 3.29Å; Y70-G78 VanDerWaalsContact CE1-N 3.26Å; Y70-G78 PolarHBondContact N-O 2.87Å; Y70-G78 PolarHBondContact O-N 2.82Å; Y70-G78 VanDerWaalsContact O-N 3.1Å
71	Y	98.6	Very high	97.5	Very high	22 Å²	22	70.9 Å²	70.9	9%	0.086	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.1	122.1	175	-177.1	-86.6	0	0	0	110.8	I54 K77 G89 K91	I54-Y71 PolarHBondContact N-O 2.84Å; I54-Y71 PolarHBondContact O-N 3.31Å; Y71-K77 HydrophobicContact CD2-CB 3.97Å; Y71-K77 HydrophobicContact CD2-CD 3.91Å; Y71-K77 HydrophobicContact CE2-CD 4.02Å; Y71-G89 VanDerWaalsContact CD2-C 3.49Å; Y71-G89 WeakPolarHBondContact CD2-O 3.37Å; Y71-G89 VanDerWaalsContact CE2-O 3.25Å; Y71-G89 WeakPolarHBondContact CE2-O 3.38Å; Y71-K91 HydrophobicContact CD1-CD 4.12Å; Y71-K91 HydrophobicContact CD1-CG 3.81Å; Y71-K91 HydrophobicContact CE1-CB 4.28Å; Y71-K91 HydrophobicContact CE1-CD 4.03Å; Y71-K91 HydrophobicContact CE1-CG 3.82Å
72	Y	97.5	Very high	97.5	Very high	75 Å²	75	68.2 Å²	68.2	29%	0.294	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	-52.2	166	179.8	-107.2	0	0	0	111.1	G50 N53 D76 K91 S120	G50-Y72 WeakPolarHBondContact O-CE2 3.46Å; G50-Y72 PolarHBondContact O-OH 3.41Å; N53-Y72 WeakPolarHBondContact OD1-CB 3.2Å; Y72-D76 WeakPolarHBondContact CB-O 3.49Å; Y72-D76 HydrophobicContact CD1-CB 4.15Å; Y72-D76 PolarHBondContact N-O 3.1Å; Y72-K91 VanDerWaalsContact O-CE 3.23Å; Y72-K91 WeakPolarHBondContact O-CE 3.48Å; Y72-K91 PolarHBondContact O-NZ 2.68Å; Y72-S120 WeakPolarHBondContact CE2-OG 3.5Å
73	S	96.4	Very high	97.6	Very high	32 Å²	32	64.5 Å²	64.5	22%	0.224	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.2	176.4	177.2	70.8	0	0	0	0	109.8	S75 D76	S73-S75 PolarHBondContact O-N 3.32Å; S73-S75 PolarHBondContact OG-N 3.07Å; S73-S75 PolarHBondContact OG-OG 2.96Å; S73-S75 VanDerWaalsContact OG-OG 3.06Å; S73-D76 PolarHBondContact N-O 2.82Å; S73-D76 VanDerWaalsContact N-O 3.07Å; S73-D76 CarbonylContact O-C 3.57Å; S73-D76 VanDerWaalsContact O-C 3.25Å; S73-D76 PolarHBondContact O-N 3.17Å; S73-D76 PolarHBondContact OG-N 3.21Å
74	D	95.8	Very high	97.6	Very high	115 Å²	115	64 Å²	64	62%	0.615	37%	0.367	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.1	-26.7	175.8	-81.3	-46.4	0	0	0	114.1	K77	D74-K77 WeakPolarHBondContact O-CE 3.46Å; D74-K77 IonicContact OD1-NZ 3.63Å; D74-K77 PolarHBondContact OD1-NZ 2.81Å
75	S	96.1	Very high	97.6	Very high	118 Å²	118	64.2 Å²	64.2	83%	0.825	37%	0.371	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.5	-12.9	175.3	62.7	0	0	0	0	113.4	S73	S73-S75 PolarHBondContact O-N 3.32Å; S73-S75 PolarHBondContact OG-N 3.07Å; S73-S75 PolarHBondContact OG-OG 2.96Å; S73-S75 VanDerWaalsContact OG-OG 3.06Å
76	D	96.5	Very high	97.6	Very high	60 Å²	60	63 Å²	63	32%	0.321	36%	0.358	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.3	89.2	-177.9	-174	8.8	0	0	0	110.5	Y70 Y72 S73	Y70-D76 VanDerWaalsContact CE2-OD1 3.23Å; Y70-D76 WeakPolarHBondContact CE2-OD1 3.31Å; Y70-D76 PolarHBondContact OH-OD1 2.98Å; Y72-D76 WeakPolarHBondContact CB-O 3.49Å; Y72-D76 HydrophobicContact CD1-CB 4.15Å; Y72-D76 PolarHBondContact N-O 3.1Å; S73-D76 PolarHBondContact N-O 2.82Å; S73-D76 VanDerWaalsContact N-O 3.07Å; S73-D76 CarbonylContact O-C 3.57Å; S73-D76 VanDerWaalsContact O-C 3.25Å; S73-D76 PolarHBondContact O-N 3.17Å; S73-D76 PolarHBondContact OG-N 3.21Å
77	K	97.2	Very high	97.6	Very high	108 Å²	108	58.1 Å²	58.1	47%	0.47	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.2	155.6	179.3	61.4	-172.7	174.6	-168.3	0	109.5	Y70 Y71 D74	Y70-K77 WeakPolarHBondContact O-CA 3.5Å; Y70-K77 WeakPolarHBondContact O-CB 3.29Å; Y71-K77 HydrophobicContact CD2-CB 3.97Å; Y71-K77 HydrophobicContact CD2-CD 3.91Å; Y71-K77 HydrophobicContact CE2-CD 4.02Å; D74-K77 WeakPolarHBondContact O-CE 3.46Å; D74-K77 IonicContact OD1-NZ 3.63Å; D74-K77 PolarHBondContact OD1-NZ 2.81Å
78	G	97	Very high	97.6	Very high	23 Å²	23	56.9 Å²	56.9	24%	0.237	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.2	151.1	179.3	0	0	0	0	0	112.2	L69 Y70	L69-G78 CarbonylContact C-O 3.57Å; L69-G78 WeakPolarHBondContact CA-O 3.43Å; L69-G78 WeakPolarHBondContact CB-O 3.35Å; Y70-G78 VanDerWaalsContact CE1-N 3.26Å; Y70-G78 PolarHBondContact N-O 2.87Å; Y70-G78 PolarHBondContact O-N 2.82Å; Y70-G78 VanDerWaalsContact O-N 3.1Å
79	Q	97.8	Very high	97.6	Very high	111 Å²	111	57.4 Å²	57.4	52%	0.519	35%	0.347	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.3	144.7	176.6	-75.8	160.2	-52.5	0	0	110.2	L69 F87	L69-Q79 HydrophobicContact CB-CG 4.28Å; Q79-F87 PolarHBondContact NE2-O 3.34Å
80	G	97.8	Very high	97.6	Very high	11 Å²	11	59.2 Å²	59.2	11%	0.113	36%	0.36	C	S	.	.			trans	-67.9	158	171.8	0	0	0	0	0	111.6	L68 G82 V83	L68-G80 PolarHBondContact O-N 2.93Å; G80-G82 PolarHBondContact O-N 3.03Å; G80-V83 WeakPolarHBondContact O-CB 3.46Å; G80-V83 WeakPolarHBondContact O-CG2 3.41Å; G80-V83 PolarHBondContact O-N 2.95Å
81	S	97.3	Very high	97.6	Very high	123 Å²	123	58.5 Å²	58.5	86%	0.86	36%	0.358	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.5	132.9	179.5	-172.8	0	0	0	0	111.8	R66 V83	R66-S81 PolarHBondContact NH2-O 2.8Å; S81-V83 PolarHBondContact O-N 2.83Å
82	G	97.2	Very high	97.6	Very high	64 Å²	64	59.8 Å²	59.8	66%	0.66	37%	0.366	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.1	16.4	-179.5	0	0	0	0	0	114.6	R66 G80	R66-G82 PolarHBondContact NH2-O 2.65Å; G80-G82 PolarHBondContact O-N 3.03Å
83	V	98.2	Very high	97.6	Very high	16 Å²	16	59.9 Å²	59.9	10%	0.097	38%	0.383	C	S	.	.			trans	-81.7	124	174.1	176.3	0	0	0	0	108	L68 G80 S81 F87	L68-V83 HydrophobicContact CB-CG1 4.44Å; L68-V83 HydrophobicContact CD2-CG1 4.1Å; L68-V83 HydrophobicContact CD2-CG2 4Å; L68-V83 WeakPolarHBondContact O-CG2 3.42Å; G80-V83 WeakPolarHBondContact O-CB 3.46Å; G80-V83 WeakPolarHBondContact O-CG2 3.41Å; G80-V83 PolarHBondContact O-N 2.95Å; S81-V83 PolarHBondContact O-N 2.83Å; V83-F87 HydrophobicContact CG1-CB 4Å; V83-F87 HydrophobicContact CG1-CD2 4.12Å; V83-F87 HydrophobicContact CG1-CG 4.15Å
84	P	97.8	Very high	97.6	Very high	44 Å²	44	63.9 Å²	63.9	29%	0.286	41%	0.411	S	S	.	.			trans	-63.1	146.9	-178.1	-24.1	35.3	0	0	0	112.3	R86 F87	P84-R86 HydrophobicContact CB-CG 4.13Å; P84-R86 VanDerWaalsContact CB-NH1 3.32Å; P84-R86 PolarHBondContact O-N 2.82Å; P84-F87 HydrophobicContact CB-CD2 4.28Å; P84-F87 HydrophobicContact CG-CD2 4.44Å; P84-F87 HydrophobicContact CG-CE2 4.29Å; P84-F87 PolarHBondContact O-N 3.04Å; P84-F87 VanDerWaalsContact O-N 3.12Å
85	S	97.5	Very high	97.7	Very high	111 Å²	111	60.6 Å²	60.6	78%	0.776	40%	0.4	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.2	-14	-180	55.2	0	0	0	0	114.3	F87	S85-F87 PolarHBondContact O-N 2.01Å
86	R	98.2	Very high	97.8	Very high	47 Å²	47	56.2 Å²	56.2	18%	0.177	37%	0.367	C	S	.	.	T	Hydrogen-bonded Turn	trans	-66	-21	176.1	84.4	-177.4	162.6	-106.7	5.3	113.6	P84 I102 S103 D109	P84-R86 HydrophobicContact CB-CG 4.13Å; P84-R86 VanDerWaalsContact CB-NH1 3.32Å; P84-R86 PolarHBondContact O-N 2.82Å; R86-I102 HydrophobicContact CG-CG2 4.2Å; R86-I102 WeakPolarHBondContact O-CA 3.19Å; R86-S103 WeakPolarHBondContact CA-OG 3.44Å; R86-S103 VanDerWaalsContact CB-O 3.24Å; R86-S103 WeakPolarHBondContact CB-O 3.38Å; R86-S103 WeakPolarHBondContact CD-O 3.24Å; R86-S103 WeakPolarHBondContact CG-O 3.41Å; R86-S103 PolarHBondContact O-N 3.02Å; R86-S103 PolarHBondContact O-OG 3.07Å; R86-S103 VanDerWaalsContact O-OG 3.07Å; R86-D109 IonicContact CZ-OD1 2.73Å; R86-D109 IonicContact CZ-OD2 3.52Å; R86-D109 IonicContact NE-OD1 2.85Å; R86-D109 PolarHBondContact NE-OD1 3.42Å; R86-D109 IonicContact NE-OD2 3.47Å; R86-D109 PolarHBondContact NE-OD2 3.41Å; R86-D109 IonicContact NH2-OD1 3.37Å; R86-D109 PolarHBondContact NH2-OD1 3.11Å; R86-D109 IonicContact NH2-OD2 2.97Å
87	F	98.8	Very high	98	Very high	3 Å²	3	53.7 Å²	53.7	1%	0.013	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.1	127.4	172.6	-68.1	-97.6	0	0	0	110.2	L68 L69 Q79 V83 P84 S85 L100 L101 I102 D109 Y113	L68-F87 HydrophobicContact CD1-CD1 3.76Å; L68-F87 HydrophobicContact CD1-CE1 3.86Å; L69-F87 HydrophobicContact CD2-CB 4.15Å; Q79-F87 PolarHBondContact NE2-O 3.34Å; V83-F87 HydrophobicContact CG1-CB 4Å; V83-F87 HydrophobicContact CG1-CD2 4.12Å; V83-F87 HydrophobicContact CG1-CG 4.15Å; P84-F87 HydrophobicContact CB-CD2 4.28Å; P84-F87 HydrophobicContact CG-CD2 4.44Å; P84-F87 HydrophobicContact CG-CE2 4.29Å; P84-F87 PolarHBondContact O-N 3.04Å; P84-F87 VanDerWaalsContact O-N 3.12Å; S85-F87 PolarHBondContact O-N 2.01Å; F87-L100 HydrophobicContact CD1-CD1 4.3Å; F87-L101 WeakPolarHBondContact CA-O 3.27Å; F87-I102 HydrophobicContact CD1-CB 4.47Å; F87-I102 HydrophobicContact CD1-CD1 4.07Å; F87-I102 HydrophobicContact CD1-CG1 3.7Å; F87-I102 HydrophobicContact CD1-CG2 4.21Å; F87-I102 HydrophobicContact CE1-CB 4.42Å; F87-I102 HydrophobicContact CE1-CD1 3.54Å; F87-I102 HydrophobicContact CE1-CG1 3.67Å; F87-I102 HydrophobicContact CE1-CG2 3.92Å; F87-I102 HydrophobicContact CE2-CG2 4.31Å; F87-I102 HydrophobicContact CZ-CD1 4.34Å; F87-I102 HydrophobicContact CZ-CG2 3.97Å; F87-D109 HydrophobicContact CZ-CB 4.4Å; F87-D109 VanDerWaalsContact CZ-OD1 3.26Å; F87-D109 WeakPolarHBondContact CZ-OD1 3.3Å; F87-Y113 AromaticContact CE1-CE1 3.96Å; F87-Y113 HydrophobicContact CE1-CE1 3.96Å
88	S	98.5	Very high	98	Very high	49 Å²	49	48.5 Å²	48.5	34%	0.343	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.2	144.6	178	57.3	0	0	0	0	111.6	L101	S88-L101 PolarHBondContact N-O 2.84Å; S88-L101 PolarHBondContact O-N 2.85Å; S88-L101 PolarHBondContact OG-O 3.06Å
89	G	98.6	Very high	98.1	Very high	13 Å²	13	48 Å²	48	13%	0.134	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.8	152	174.6	0	0	0	0	0	111.6	Y71 I99	Y71-G89 VanDerWaalsContact CD2-C 3.49Å; Y71-G89 WeakPolarHBondContact CD2-O 3.37Å; Y71-G89 VanDerWaalsContact CE2-O 3.25Å; Y71-G89 WeakPolarHBondContact CE2-O 3.38Å; G89-I99 CarbonylContact C-O 3.46Å; G89-I99 VanDerWaalsContact CA-O 3.3Å; G89-I99 WeakPolarHBondContact CA-O 3.23Å
90	S	98.6	Very high	98.2	Very high	41 Å²	41	42.8 Å²	42.8	29%	0.287	30%	0.299	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.8	-178.4	167.3	65.9	0	0	0	0	111	I99	S90-I99 PolarHBondContact N-O 2.63Å; S90-I99 PolarHBondContact O-N 3.33Å; S90-I99 WeakPolarHBondContact OG-CB 3.32Å
91	K	98.3	Very high	98.2	Very high	43 Å²	43	45.2 Å²	45.2	19%	0.187	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.2	147.1	175.8	-68.1	169.1	-179.7	-179.9	0	110.2	V49 Y52 I54 Y71 Y72 T97	V49-K91 HydrophobicContact CG2-CD 4.13Å; V49-K91 HydrophobicContact CG2-CG 4.03Å; V49-K91 WeakPolarHBondContact O-CE 3.22Å; V49-K91 PolarHBondContact O-NZ 2.82Å; Y52-K91 VanDerWaalsContact O-CE 3.24Å; Y52-K91 WeakPolarHBondContact O-CE 3.48Å; Y52-K91 PolarHBondContact O-NZ 3.07Å; I54-K91 HydrophobicContact CG1-CG 4.26Å; Y71-K91 HydrophobicContact CD1-CD 4.12Å; Y71-K91 HydrophobicContact CD1-CG 3.81Å; Y71-K91 HydrophobicContact CE1-CB 4.28Å; Y71-K91 HydrophobicContact CE1-CD 4.03Å; Y71-K91 HydrophobicContact CE1-CG 3.82Å; Y72-K91 VanDerWaalsContact O-CE 3.23Å; Y72-K91 WeakPolarHBondContact O-CE 3.48Å; Y72-K91 PolarHBondContact O-NZ 2.68Å; K91-T97 CarbonylContact C-O 3.54Å; K91-T97 WeakPolarHBondContact CA-O 3.49Å
92	D	98.4	Very high	98.3	Very high	48 Å²	48	39.4 Å²	39.4	26%	0.257	27%	0.268	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	103.3	163.7	-175.8	-21.6	0	0	0	108.1	S94 A95 N96 T97 I99	D92-S94 VanDerWaalsContact C-N 3.27Å; D92-S94 PolarHBondContact O-N 3.49Å; D92-S94 WeakPolarHBondContact OD1-CB 2.93Å; D92-S94 PolarHBondContact OD1-N 3.37Å; D92-S94 PolarHBondContact OD1-OG 3.03Å; D92-A95 HydrophobicContact CB-CB 4.09Å; D92-A95 PolarHBondContact O-N 3.03Å; D92-A95 PolarHBondContact OD1-N 2.78Å; D92-N96 PolarHBondContact O-N 3.47Å; D92-T97 PolarHBondContact N-O 2.94Å; D92-T97 PolarHBondContact O-N 3.36Å; D92-I99 HydrophobicContact CB-CD1 3.99Å
93	A	97.1	Very high	98.3	Very high	78 Å²	78	38.7 Å²	38.7	65%	0.645	25%	0.253	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.1	-29.7	-178.8	0	0	0	0	0	112.4	N96	A93-N96 PolarHBondContact O-N 3.44Å
94	S	97.7	Very high	98.3	Very high	115 Å²	115	39.6 Å²	39.6	80%	0.804	27%	0.266	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.1	-35.3	-179.7	72.2	0	0	0	0	112	D92	D92-S94 VanDerWaalsContact C-N 3.27Å; D92-S94 PolarHBondContact O-N 3.49Å; D92-S94 WeakPolarHBondContact OD1-CB 2.93Å; D92-S94 PolarHBondContact OD1-N 3.37Å; D92-S94 PolarHBondContact OD1-OG 3.03Å
95	A	98.2	Very high	98.3	Very high	47 Å²	47	39 Å²	39	39%	0.388	26%	0.26	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.1	-5.5	175.4	0	0	0	0	0	113.8	D92 T97	D92-A95 HydrophobicContact CB-CB 4.09Å; D92-A95 PolarHBondContact O-N 3.03Å; D92-A95 PolarHBondContact OD1-N 2.78Å; A95-T97 VanDerWaalsContact C-N 3.34Å; A95-T97 PolarHBondContact O-N 3.5Å; A95-T97 PolarHBondContact O-OG1 3.33Å; A95-T97 VanDerWaalsContact O-OG1 3.04Å
96	N	98.3	Very high	98.4	Very high	25 Å²	25	37.9 Å²	37.9	13%	0.134	24%	0.242	C	C	.	.	T	Hydrogen-bonded Turn	trans	55	45.8	-172.7	-157.9	38.1	0	0	0	113	L43 P44 I47 V49 D92 A93	L43-N96 PolarHBondContact N-O 2.98Å; L43-N96 PolarHBondContact O-ND2 2.95Å; P44-N96 PolarHBondContact O-ND2 2.92Å; P44-N96 VanDerWaalsContact O-ND2 3.07Å; I47-N96 PolarHBondContact O-ND2 3.47Å; I47-N96 PolarHBondContact O-OD1 2.78Å; V49-N96 WeakPolarHBondContact CB-OD1 3.47Å; V49-N96 PolarHBondContact N-OD1 2.98Å; D92-N96 PolarHBondContact O-N 3.47Å; A93-N96 PolarHBondContact O-N 3.44Å
97	T	98.7	Very high	98.3	Very high	7 Å²	7	39.9 Å²	39.9	4%	0.043	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.1	134.5	-166.3	-62.3	0	0	0	0	112	T40 C41 T42 K91 D92 A95 I99	T40-T97 HydrophobicContact CG2-CG2 3.98Å; C41-T97 CarbonylContact O-C 3.53Å; C41-T97 WeakPolarHBondContact O-CA 3.39Å; T42-T97 PolarHBondContact OG1-OG1 2.96Å; K91-T97 CarbonylContact C-O 3.54Å; K91-T97 WeakPolarHBondContact CA-O 3.49Å; D92-T97 PolarHBondContact N-O 2.94Å; D92-T97 PolarHBondContact O-N 3.36Å; A95-T97 VanDerWaalsContact C-N 3.34Å; A95-T97 PolarHBondContact O-N 3.5Å; A95-T97 PolarHBondContact O-OG1 3.33Å; A95-T97 VanDerWaalsContact O-OG1 3.04Å; T97-I99 HydrophobicContact CG2-CG1 4.26Å
98	G	98.7	Very high	98.2	Very high	0 Å²	0	44.3 Å²	44.3	0%	0	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.1	143.9	162.1	0	0	0	0	0	111.1	T40 C41	T40-G98 WeakPolarHBondContact CA-O 3.33Å; C41-G98 PolarHBondContact N-O 3.31Å; C41-G98 PolarHBondContact O-N 3.43Å
99	I	98.8	Very high	98.2	Very high	13 Å²	13	42.3 Å²	42.3	7%	0.067	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.2	136.8	-174.6	-61	168.9	0	0	0	109.5	R38 L39 W56 G89 S90 D92 T97	R38-I99 HydrophobicContact CG-CG2 3.94Å; L39-I99 WeakPolarHBondContact O-CA 2.98Å; W56-I99 PolarHBondContact NE1-O 2.97Å; G89-I99 CarbonylContact C-O 3.46Å; G89-I99 VanDerWaalsContact CA-O 3.3Å; G89-I99 WeakPolarHBondContact CA-O 3.23Å; S90-I99 PolarHBondContact N-O 2.63Å; S90-I99 PolarHBondContact O-N 3.33Å; S90-I99 WeakPolarHBondContact OG-CB 3.32Å; D92-I99 HydrophobicContact CB-CD1 3.99Å; T97-I99 HydrophobicContact CG2-CG1 4.26Å
100	L	98.9	Very high	98.1	Very high	0 Å²	0	49.5 Å²	49.5	0%	0	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	126.2	161.5	177.2	68.3	0	0	0	108.2	L39 W56 L68 L69 F87 I102 Y113	L39-L100 HydrophobicContact CB-CB 4.25Å; L39-L100 HydrophobicContact CD1-CD2 3.99Å; L39-L100 PolarHBondContact N-O 3.09Å; L39-L100 PolarHBondContact O-N 2.78Å; W56-L100 HydrophobicContact CB-CD1 4.29Å; W56-L100 HydrophobicContact CB-CD2 4.23Å; W56-L100 HydrophobicContact CD2-CB 3.53Å; W56-L100 HydrophobicContact CD2-CD2 4.06Å; W56-L100 HydrophobicContact CD2-CG 4.29Å; W56-L100 VanDerWaalsContact CE2-CB 3.45Å; W56-L100 HydrophobicContact CE3-CB 3.94Å; W56-L100 HydrophobicContact CE3-CD2 3.98Å; W56-L100 HydrophobicContact CG-CB 3.9Å; W56-L100 HydrophobicContact CG-CD1 4.14Å; W56-L100 HydrophobicContact CG-CD2 4.18Å; W56-L100 HydrophobicContact CG-CG 4.32Å; W56-L100 HydrophobicContact CH2-CB 4.17Å; W56-L100 HydrophobicContact CZ2-CB 3.8Å; W56-L100 HydrophobicContact CZ3-CB 4.24Å; L68-L100 HydrophobicContact CD1-CD2 4.07Å; L69-L100 HydrophobicContact CD2-CD1 3.76Å; L69-L100 HydrophobicContact CG-CD1 4.28Å; F87-L100 HydrophobicContact CD1-CD1 4.3Å; L100-I102 HydrophobicContact CD2-CD1 4.44Å; L100-I102 HydrophobicContact CD2-CG1 4.41Å; L100-I102 HydrophobicContact CG-CG1 4.24Å; L100-Y113 HydrophobicContact CD2-CD1 3.58Å; L100-Y113 HydrophobicContact CD2-CE1 3.91Å; L100-Y113 HydrophobicContact CD2-CG 4.47Å
101	L	98.6	Very high	98.1	Very high	62 Å²	62	48.7 Å²	48.7	33%	0.325	30%	0.296	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	125.1	174.1	-176.1	72.9	0	0	0	108.7	A37 R38 F87 S88	A37-L101 WeakPolarHBondContact O-CA 3.23Å; R38-L101 HydrophobicContact CB-CD1 4.46Å; F87-L101 WeakPolarHBondContact CA-O 3.27Å; S88-L101 PolarHBondContact N-O 2.84Å; S88-L101 PolarHBondContact O-N 2.85Å; S88-L101 PolarHBondContact OG-O 3.06Å
102	I	98.6	Very high	98.1	Very high	2 Å²	2	51 Å²	51	1%	0.01	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	105.7	174.8	-46.2	174.2	0	0	0	106.5	S36 A37 L39 R86 F87 L100 L105 Y113	S36-I102 CarbonylContact C-O 3.48Å; S36-I102 WeakPolarHBondContact CA-O 3.38Å; A37-I102 HydrophobicContact CB-CB 4.36Å; A37-I102 PolarHBondContact N-O 2.84Å; A37-I102 PolarHBondContact O-N 3.31Å; L39-I102 HydrophobicContact CD1-CD1 4.24Å; R86-I102 HydrophobicContact CG-CG2 4.2Å; R86-I102 WeakPolarHBondContact O-CA 3.19Å; F87-I102 HydrophobicContact CD1-CB 4.47Å; F87-I102 HydrophobicContact CD1-CD1 4.07Å; F87-I102 HydrophobicContact CD1-CG1 3.7Å; F87-I102 HydrophobicContact CD1-CG2 4.21Å; F87-I102 HydrophobicContact CE1-CB 4.42Å; F87-I102 HydrophobicContact CE1-CD1 3.54Å; F87-I102 HydrophobicContact CE1-CG1 3.67Å; F87-I102 HydrophobicContact CE1-CG2 3.92Å; F87-I102 HydrophobicContact CE2-CG2 4.31Å; F87-I102 HydrophobicContact CZ-CD1 4.34Å; F87-I102 HydrophobicContact CZ-CG2 3.97Å; L100-I102 HydrophobicContact CD2-CD1 4.44Å; L100-I102 HydrophobicContact CD2-CG1 4.41Å; L100-I102 HydrophobicContact CG-CG1 4.24Å; I102-L105 HydrophobicContact CB-CD1 4.23Å; I102-L105 HydrophobicContact CD1-CD1 4.41Å; I102-L105 HydrophobicContact CG2-CD1 3.88Å; I102-Y113 HydrophobicContact CD1-CE1 3.86Å; I102-Y113 HydrophobicContact CD1-CE2 4.33Å; I102-Y113 WeakPolarHBondContact CD1-OH 3.39Å
103	S	98.4	Very high	98.1	Very high	49 Å²	49	50 Å²	50	34%	0.343	30%	0.303	S	S	.	.	S	Bend	trans	-84	149.2	175.8	55.4	0	0	0	0	110.8	R86 L105	R86-S103 WeakPolarHBondContact CA-OG 3.44Å; R86-S103 VanDerWaalsContact CB-O 3.24Å; R86-S103 WeakPolarHBondContact CB-O 3.38Å; R86-S103 WeakPolarHBondContact CD-O 3.24Å; R86-S103 WeakPolarHBondContact CG-O 3.41Å; R86-S103 PolarHBondContact O-N 3.02Å; R86-S103 PolarHBondContact O-OG 3.07Å; R86-S103 VanDerWaalsContact O-OG 3.07Å; S103-L105 PolarHBondContact O-N 3.16Å
104	G	98.3	Very high	98.2	Very high	35 Å²	35	51 Å²	51	36%	0.361	29%	0.291	S	S	.	.	S	Bend	trans	57.8	51.7	175.8	0	0	0	0	0	112.7	G34 E35 Q106	G34-G104 WeakPolarHBondContact O-CA 3.32Å; E35-G104 PolarHBondContact O-N 3.33Å; G104-Q106 WeakPolarHBondContact O-CG 3.27Å; G104-Q106 PolarHBondContact O-N 3.2Å
105	L	98.2	Very high	98.2	Very high	30 Å²	30	46.2 Å²	46.2	16%	0.157	26%	0.257	C	S	.	.			trans	-52.3	131	-171.6	-168.2	70.5	0	0	0	112	A31 P33 G34 E35 A37 I102 S103 D109	A31-L105 HydrophobicContact CB-CD2 4.07Å; P33-L105 WeakPolarHBondContact CA-O 3.12Å; G34-L105 PolarHBondContact N-O 3.36Å; E35-L105 WeakPolarHBondContact O-CB 3.24Å; E35-L105 PolarHBondContact O-N 3.23Å; A37-L105 HydrophobicContact CB-CD1 4Å; A37-L105 HydrophobicContact CB-CD2 4.28Å; I102-L105 HydrophobicContact CB-CD1 4.23Å; I102-L105 HydrophobicContact CD1-CD1 4.41Å; I102-L105 HydrophobicContact CG2-CD1 3.88Å; S103-L105 PolarHBondContact O-N 3.16Å; L105-D109 HydrophobicContact CD1-CB 3.65Å; L105-D109 HydrophobicContact CG-CB 4.47Å
106	Q	98.3	Very high	98.2	Very high	88 Å²	88	47.4 Å²	47.4	41%	0.411	26%	0.255	S	S	.	.			trans	-112.1	161.1	179.5	-52.1	-171.1	-42.6	0	0	111.2	G104 E108 D109	G104-Q106 WeakPolarHBondContact O-CG 3.27Å; G104-Q106 PolarHBondContact O-N 3.2Å; Q106-E108 VanDerWaalsContact CB-OE2 3.26Å; Q106-E108 WeakPolarHBondContact CB-OE2 3.24Å; Q106-E108 PolarHBondContact O-N 3.47Å; Q106-D109 PolarHBondContact N-OD2 3.4Å; Q106-D109 WeakPolarHBondContact O-CB 3.44Å; Q106-D109 PolarHBondContact O-N 3.07Å
107	S	96.3	Very high	98.1	Very high	89 Å²	89	47 Å²	47	62%	0.622	25%	0.253	S	S	*	.	G	3₁₀ helix	trans	-56.6	-32.7	175	33.7	0	0	0	0	112.5	D109 E110	S107-D109 PolarHBondContact O-N 3.38Å; S107-E110 PolarHBondContact O-N 3.38Å
108	E	96.5	Very high	97.9	Very high	96 Å²	96	52.7 Å²	52.7	45%	0.449	27%	0.274	S	S	.	.	G	3₁₀ helix	trans	-73.5	-10	180	-55.8	68.8	-135.9	0	0	112.8	K60 Q106 E110	K60-E108 WeakPolarHBondContact CE-O 3.44Å; K60-E108 PolarHBondContact NZ-O 3.35Å; Q106-E108 VanDerWaalsContact CB-OE2 3.26Å; Q106-E108 WeakPolarHBondContact CB-OE2 3.24Å; Q106-E108 PolarHBondContact O-N 3.47Å; E108-E110 VanDerWaalsContact C-N 3.33Å
109	D	97.9	Very high	97.6	Very high	7 Å²	7	55 Å²	55	4%	0.037	29%	0.289	C	S	.	.	G	3₁₀ helix	trans	-85.6	-6.8	177.8	-58.6	-31.4	0	0	0	112.1	R86 F87 L105 Q106 S107 A111 Y113	R86-D109 IonicContact CZ-OD1 2.73Å; R86-D109 IonicContact CZ-OD2 3.52Å; R86-D109 IonicContact NE-OD1 2.85Å; R86-D109 PolarHBondContact NE-OD1 3.42Å; R86-D109 IonicContact NE-OD2 3.47Å; R86-D109 PolarHBondContact NE-OD2 3.41Å; R86-D109 IonicContact NH2-OD1 3.37Å; R86-D109 PolarHBondContact NH2-OD1 3.11Å; R86-D109 IonicContact NH2-OD2 2.97Å; F87-D109 HydrophobicContact CZ-CB 4.4Å; F87-D109 VanDerWaalsContact CZ-OD1 3.26Å; F87-D109 WeakPolarHBondContact CZ-OD1 3.3Å; L105-D109 HydrophobicContact CD1-CB 3.65Å; L105-D109 HydrophobicContact CG-CB 4.47Å; Q106-D109 PolarHBondContact N-OD2 3.4Å; Q106-D109 WeakPolarHBondContact O-CB 3.44Å; Q106-D109 PolarHBondContact O-N 3.07Å; S107-D109 PolarHBondContact O-N 3.38Å; D109-A111 PolarHBondContact O-N 3.37Å; D109-Y113 WeakPolarHBondContact O-CE2 3.28Å; D109-Y113 PolarHBondContact O-OH 3.36Å
110	E	97.8	Very high	96.8	Very high	164 Å²	164	55.8 Å²	55.8	77%	0.766	30%	0.296	S	S	*	.			trans	-67.1	113.5	173	-171.4	171.6	-174.1	0	0	110.6	S107 E108	S107-E110 PolarHBondContact O-N 3.38Å; E108-E110 VanDerWaalsContact C-N 3.33Å
111	A	98.1	Very high	95.6	Very high	25 Å²	25	62.4 Å²	62.4	21%	0.207	33%	0.331	C	S	.	.	S	Bend	trans	-171.5	167.1	-172.1	0	0	0	0	0	110.4	Q58 Q59 K60 D109 Y113	Q58-A111 HydrophobicContact CG-CB 3.4Å; Q59-A111 WeakPolarHBondContact O-CB 3.49Å; K60-A111 HydrophobicContact CG-CB 4.14Å; D109-A111 PolarHBondContact O-N 3.37Å; A111-Y113 HydrophobicContact CB-CE2 3.97Å; A111-Y113 VanDerWaalsContact O-CD2 3.28Å; A111-Y113 WeakPolarHBondContact O-CD2 3.44Å; A111-Y113 WeakPolarHBondContact O-CE2 3.47Å
112	D	98.4	Very high	93.7	Very high	92 Å²	92	62 Å²	62	49%	0.492	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.9	143	162	-65.2	-48.9	0	0	0	109.9	Q58 Q59 Y114	Q58-D112 CarbonylContact C-O 3.5Å; Q58-D112 WeakPolarHBondContact CA-O 3.46Å; Q59-D112 HydrophobicContact CB-CB 4.44Å; Q59-D112 PolarHBondContact N-O 2.81Å; Q59-D112 PolarHBondContact O-N 2.67Å; D112-Y114 HydrophobicContact CB-CE2 3.79Å
113	Y	98.7	Very high	91.3	Very high	27 Å²	27	70.2 Å²	70.2	11%	0.106	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.6	132.2	-180	-70.8	-95.4	0	0	0	110.8	Q25 L39 Y57 Q58 L68 F87 L100 I102 D109 A111	Q25-Y113 PolarHBondContact NE2-O 3.14Å; L39-Y113 HydrophobicContact CD1-CD1 3.9Å; L39-Y113 HydrophobicContact CD1-CD2 3.62Å; L39-Y113 HydrophobicContact CD1-CE1 4.39Å; L39-Y113 HydrophobicContact CD1-CE2 4.16Å; L39-Y113 HydrophobicContact CD1-CG 3.46Å; L39-Y113 VanDerWaalsContact CD1-CG 3.46Å; Y57-Y113 VanDerWaalsContact O-CA 3.31Å; Y57-Y113 WeakPolarHBondContact O-CA 3.25Å; Q58-Y113 HydrophobicContact CB-CD1 4.22Å; Q58-Y113 HydrophobicContact CB-CE1 3.93Å; Q58-Y113 HydrophobicContact CG-CD1 4.44Å; Q58-Y113 HydrophobicContact CG-CE1 3.86Å; Q58-Y113 PolarHBondContact NE2-OH 3.04Å; L68-Y113 HydrophobicContact CD1-CD1 4.02Å; L68-Y113 HydrophobicContact CD1-CE1 3.74Å; F87-Y113 AromaticContact CE1-CE1 3.96Å; F87-Y113 HydrophobicContact CE1-CE1 3.96Å; L100-Y113 HydrophobicContact CD2-CD1 3.58Å; L100-Y113 HydrophobicContact CD2-CE1 3.91Å; L100-Y113 HydrophobicContact CD2-CG 4.47Å; I102-Y113 HydrophobicContact CD1-CE1 3.86Å; I102-Y113 HydrophobicContact CD1-CE2 4.33Å; I102-Y113 WeakPolarHBondContact CD1-OH 3.39Å; D109-Y113 WeakPolarHBondContact O-CE2 3.28Å; D109-Y113 PolarHBondContact O-OH 3.36Å; A111-Y113 HydrophobicContact CB-CE2 3.97Å; A111-Y113 VanDerWaalsContact O-CD2 3.28Å; A111-Y113 WeakPolarHBondContact O-CD2 3.44Å; A111-Y113 WeakPolarHBondContact O-CE2 3.47Å
114	Y	98.4	Very high	91	Very high	98 Å²	98	71.3 Å²	71.3	38%	0.384	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	137.9	-178.2	-57.1	-77	0	0	0	110.7	W56 Y57 Q59 D112	W56-Y114 WeakPolarHBondContact CA-O 3.43Å; Y57-Y114 PolarHBondContact N-O 2.93Å; Y57-Y114 PolarHBondContact O-N 3.33Å; Q59-Y114 HydrophobicContact CB-CD2 4.36Å; Q59-Y114 HydrophobicContact CB-CE2 3.85Å; Q59-Y114 VanDerWaalsContact OE1-CE2 3.29Å; D112-Y114 HydrophobicContact CB-CE2 3.79Å
115	C	98.4	Very high	90.6	Very high	15 Å²	15	73.2 Å²	73.2	10%	0.101	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	153.4	169.5	64.7	0	0	0	0	111.7	Q25 C41 Y55 W56	Q25-C115 VanDerWaalsContact OE1-N 3.1Å; Q25-C115 PolarHBondContact OE1-SG 3.1Å; Q25-C115 VanDerWaalsContact OE1-SG 3.34Å; C41-C115 HydrophobicContact CB-CB 3.37Å; C41-C115 WeakPolarHBondContact CB-SG 3.43Å; C41-C115 WeakPolarHBondContact SG-CB 3Å; C41-C115 CovalentContact SG-SG 2.01Å; C41-C115 PolarHBondContact SG-SG 3.42Å; Y55-C115 CarbonylContact O-C 3.25Å; Y55-C115 VanDerWaalsContact O-CA 3.22Å; Y55-C115 WeakPolarHBondContact O-CA 3.37Å; W56-C115 HydrophobicContact CD2-CB 4.25Å; W56-C115 HydrophobicContact CE3-CB 4Å; W56-C115 HydrophobicContact CH2-CB 4.03Å; W56-C115 HydrophobicContact CZ2-CB 4.25Å; W56-C115 HydrophobicContact CZ3-CB 3.89Å
116	M	97.2	Very high	90.2	Very high	71 Å²	71	75.6 Å²	75.6	35%	0.35	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.8	149.5	170	178.1	-102.6	-173.1	0	0	108.9	Y55 Y57 W118	Y55-M116 HydrophobicContact CD2-SD 3.82Å; Y55-M116 HydrophobicContact CE2-SD 4.42Å; Y55-M116 HydrophobicContact CG-SD 4.25Å; Y55-M116 PolarHBondContact N-O 2.73Å; Y55-M116 PolarHBondContact O-N 2.93Å; Y57-M116 HydrophobicContact CE2-CB 4.14Å; M116-W118 HydrophobicContact CE-CE3 3.6Å; M116-W118 HydrophobicContact CE-CZ3 4.19Å
117	I	97.1	Very high	89.7	Confident	18 Å²	18	74.8 Å²	74.8	9%	0.092	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118	144.6	178.7	64.6	167.7	0	0	0	111.6	P21 L23 L43 I47 Y52 N53 I54	P21-I117 HydrophobicContact CG-CD1 3.83Å; L23-I117 HydrophobicContact CD1-CG1 4.25Å; L23-I117 HydrophobicContact CD1-CG2 3.87Å; L23-I117 HydrophobicContact CD2-CD1 3.87Å; L23-I117 HydrophobicContact CD2-CG1 4.15Å; L23-I117 HydrophobicContact CD2-CG2 4.02Å; L43-I117 HydrophobicContact CD1-CG2 4.05Å; L43-I117 HydrophobicContact CD2-CD1 3.92Å; L43-I117 HydrophobicContact CD2-CG2 4.27Å; L43-I117 HydrophobicContact CG-CD1 4.11Å; L43-I117 HydrophobicContact CG-CG2 4.24Å; I47-I117 HydrophobicContact CD1-CD1 3.51Å; Y52-I117 HydrophobicContact CD1-CB 3.98Å; Y52-I117 HydrophobicContact CD1-CD1 3.73Å; Y52-I117 HydrophobicContact CD1-CG1 4.02Å; Y52-I117 HydrophobicContact CE1-CD1 3.9Å; Y52-I117 HydrophobicContact CE1-CG1 4.44Å; Y52-I117 HydrophobicContact CG-CB 4.36Å; Y52-I117 HydrophobicContact CG-CD1 4.19Å; N53-I117 VanDerWaalsContact O-CA 3.27Å; N53-I117 WeakPolarHBondContact O-CA 3.28Å; I54-I117 HydrophobicContact CD1-CB 4.48Å; I54-I117 HydrophobicContact CD1-CG2 3.51Å
118	W	95.2	Very high	89.3	Confident	126 Å²	126	73.9 Å²	73.9	48%	0.477	40%	0.399	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.9	133.3	173.5	-165.9	-101.1	0	0	0	111.3	Y52 N53 Y55 M116 S120	Y52-W118 CarbonylContact C-O 3.51Å; Y52-W118 VanDerWaalsContact CA-O 3.3Å; Y52-W118 WeakPolarHBondContact CA-O 3.4Å; N53-W118 HydrophobicContact CB-CB 4.45Å; N53-W118 PolarHBondContact N-O 3.27Å; N53-W118 PolarHBondContact O-N 2.85Å; Y55-W118 HydrophobicContact CD2-CB 4.47Å; Y55-W118 HydrophobicContact CE2-CB 3.65Å; M116-W118 HydrophobicContact CE-CE3 3.6Å; M116-W118 HydrophobicContact CE-CZ3 4.19Å; W118-S120 PolarHBondContact O-N 3.3Å
119	P	91.8	Very high	88.8	Confident	49 Å²	49	72.5 Å²	72.5	32%	0.318	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-58	131.2	176.8	-18.5	28.8	0	0	0	110.9	Y52 N121 A122	Y52-P119 HydrophobicContact CD1-CB 4.47Å; Y52-P119 HydrophobicContact CD1-CG 4.21Å; Y52-P119 HydrophobicContact CE1-CB 4.26Å; Y52-P119 HydrophobicContact CE1-CG 3.74Å; P119-N121 VanDerWaalsContact C-N 3.26Å; P119-N121 PolarHBondContact O-N 3.09Å; P119-A122 HydrophobicContact CB-CB 3.98Å; P119-A122 HydrophobicContact CG-CB 4.35Å; P119-A122 PolarHBondContact O-N 3.4Å
120	S	81.7	Confident	88.2	Confident	29 Å²	29	77.1 Å²	77.1	20%	0.203	42%	0.421	C	S	.	.	T	Hydrogen-bonded Turn	trans	-63.7	-30.4	-179.4	48.9	0	0	0	0	113.7	S51 N53 Y72 W118 A122	S51-S120 PolarHBondContact O-N 3.06Å; S51-S120 PolarHBondContact O-OG 3.44Å; N53-S120 WeakPolarHBondContact ND2-CA 3.43Å; Y72-S120 WeakPolarHBondContact CE2-OG 3.5Å; W118-S120 PolarHBondContact O-N 3.3Å; S120-A122 VanDerWaalsContact C-N 3.3Å; S120-A122 PolarHBondContact O-N 2.91Å
121	N	73.7	Confident	87.4	Confident	139 Å²	139	70.5 Å²	70.5	74%	0.743	39%	0.394	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85	-0.1	-177.3	-34.1	-23.4	0	0	0	113.5	P119 S123	P119-N121 VanDerWaalsContact C-N 3.26Å; P119-N121 PolarHBondContact O-N 3.09Å; N121-S123 VanDerWaalsContact C-N 3.26Å; N121-S123 PolarHBondContact O-N 3.16Å
122	A	59	Low	86.5	Confident	52 Å²	52	74.3 Å²	74.3	43%	0.43	41%	0.41	S	S	.	.			trans	-90.8	25.5	-172.1	0	0	0	0	0	113.5	P119 S120	P119-A122 HydrophobicContact CB-CB 3.98Å; P119-A122 HydrophobicContact CG-CB 4.35Å; P119-A122 PolarHBondContact O-N 3.4Å; S120-A122 VanDerWaalsContact C-N 3.3Å; S120-A122 PolarHBondContact O-N 2.91Å
123	S	48.6	Very low	85.4	Confident	175 Å²	175	72.6 Å²	72.6	100%	1.224	40%	0.403	S	S	*	.			trans	-78.5	0	171.7	64	0	0	0	0	112.2	N121	N121-S123 VanDerWaalsContact C-N 3.26Å; N121-S123 PolarHBondContact O-N 3.16Å

Retrieved 123 of 123 residues in 99.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).