LV403_HUMAN Loading...

Immunoglobulin lambda variable 4-3

V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition¹. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens^2,3. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen^4,5.

AlphaFold DB , UniProt , Accession A0A075B6K6, Species HUMAN (Homo sapiens, Human), Gene IGLV4-3, Length 122 aa.

						>LV403_HUMAN|A0A075B6K6|IGLV4-3
MAWVSFYLLPFIFSTGLCALPVLTQPPSASALLGASIKLTCTLSSEHSTYTIEWYQQRPGRSPQYIMKVKSDGSHSKGDGIPDRFMGSSSGADRYLTFSNLQSDDEAEYHCGESHTIDGQVG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.8	Low	59	Low	250 Å²	250	158.1 Å²	158.1	100%	1.232	80%	0.796	S	S	*	*				0	89.1	0	-65.2	-84.8	-163.9	0	0	107.2
2	A	52.9	Low	59.7	Low	100 Å²	100	156.4 Å²	156.4	83%	0.826	79%	0.788	S	S	*	*			trans	-116.2	108.9	177.7	0	0	0	0	0	107.2
3	W	50.8	Low	60	Low	235 Å²	235	157.3 Å²	157.3	89%	0.89	78%	0.784	S	S	*	*			trans	-84.4	113.3	177.2	-176	-2.6	0	0	0	108.1	S5	W3-S5 PolarHBondContact O-N 3.24Å
4	V	60.3	Low	60.2	Low	103 Å²	103	154 Å²	154	62%	0.624	78%	0.784	S	S	*	*			trans	-77.3	105.3	169.6	-178.7	0	0	0	0	107.8	F6	V4-F6 HydrophobicContact CG1-CD2 4.04Å; V4-F6 HydrophobicContact CG1-CE2 3.98Å; V4-F6 PolarHBondContact O-N 2.91Å
5	S	59.3	Low	60.5	Low	73 Å²	73	151.3 Å²	151.3	51%	0.51	78%	0.778	S	S	.	*			trans	-70.9	107.2	167.7	-79	0	0	0	0	109.2	W3 Y7	W3-S5 PolarHBondContact O-N 3.24Å; S5-Y7 PolarHBondContact O-N 3.23Å
6	F	62	Low	60.5	Low	181 Å²	181	146.3 Å²	146.3	79%	0.794	78%	0.775	S	S	*	*			trans	-76.6	102.2	168	-91.1	-95.3	0	0	0	109	V4 L8	V4-F6 HydrophobicContact CG1-CD2 4.04Å; V4-F6 HydrophobicContact CG1-CE2 3.98Å; V4-F6 PolarHBondContact O-N 2.91Å; F6-L8 PolarHBondContact O-N 3.37Å
7	Y	61	Low	60.8	Low	204 Å²	204	146.8 Å²	146.8	80%	0.8	78%	0.777	S	S	*	*			trans	-77.1	103.7	164.4	-67.9	-80.9	0	0	0	108.1	S5 L9	S5-Y7 PolarHBondContact O-N 3.23Å; Y7-L9 PolarHBondContact O-N 2.86Å; Y7-L9 VanDerWaalsContact O-N 3.07Å
8	L	60.1	Low	61.1	Low	163 Å²	163	145.5 Å²	145.5	85%	0.853	78%	0.78	S	S	*	*			trans	-67.1	102.2	165.2	-72.5	168.1	0	0	0	107.5	F6 P10	F6-L8 PolarHBondContact O-N 3.37Å; L8-P10 WeakPolarHBondContact O-CD 3.5Å
9	L	63.2	Low	62	Low	149 Å²	149	141.7 Å²	141.7	78%	0.78	77%	0.771	S	S	*	*			trans	-66.4	120.9	164.8	-100.9	119.6	0	0	0	107.5	Y7 F11	Y7-L9 PolarHBondContact O-N 2.86Å; Y7-L9 VanDerWaalsContact O-N 3.07Å; L9-F11 PolarHBondContact O-N 3.01Å
10	P	64.1	Low	63.2	Low	100 Å²	100	142 Å²	142	65%	0.649	77%	0.771	S	S	*	*			trans	-67.5	112.1	170.5	28.7	-28.1	0	0	0	106.1	L8 I12	L8-P10 WeakPolarHBondContact O-CD 3.5Å; P10-I12 HydrophobicContact CB-CG1 4.5Å; P10-I12 PolarHBondContact O-N 3.37Å
11	F	63.9	Low	64.5	Low	181 Å²	181	136.9 Å²	136.9	79%	0.794	75%	0.745	S	S	*	*			trans	-65.8	90.6	166.2	-110.5	-92.8	0	0	0	106.8	L9 F13	L9-F11 PolarHBondContact O-N 3.01Å; F11-F13 VanDerWaalsContact C-N 3.26Å; F11-F13 HydrophobicContact CB-CD2 4.35Å; F11-F13 HydrophobicContact CB-CE2 4.37Å; F11-F13 HydrophobicContact CD1-CD2 4.5Å; F11-F13 HydrophobicContact CD1-CE2 4.08Å; F11-F13 PolarHBondContact O-N 3.43Å
12	I	67	Low	66.5	Low	138 Å²	138	129.2 Å²	129.2	71%	0.708	71%	0.712	S	S	*	*			trans	-70.9	92	170.7	-58.7	174.8	0	0	0	105.7	P10 S14	P10-I12 HydrophobicContact CB-CG1 4.5Å; P10-I12 PolarHBondContact O-N 3.37Å; I12-S14 VanDerWaalsContact C-N 3.31Å; I12-S14 PolarHBondContact O-N 2.92Å
13	F	63.8	Low	68.6	Low	168 Å²	168	126.9 Å²	126.9	74%	0.737	69%	0.686	S	S	*	*			trans	-67.3	96	162.4	-88.5	-92	0	0	0	107.1	F11 T15	F11-F13 VanDerWaalsContact C-N 3.26Å; F11-F13 HydrophobicContact CB-CD2 4.35Å; F11-F13 HydrophobicContact CB-CE2 4.37Å; F11-F13 HydrophobicContact CD1-CD2 4.5Å; F11-F13 HydrophobicContact CD1-CE2 4.08Å; F11-F13 PolarHBondContact O-N 3.43Å; F13-T15 VanDerWaalsContact C-N 3.27Å; F13-T15 PolarHBondContact O-N 3.45Å
14	S	62.5	Low	70.8	Confident	111 Å²	111	119.8 Å²	119.8	78%	0.776	67%	0.668	S	S	*	*			trans	-67.7	95.4	159.5	-96.3	0	0	0	0	106.9	I12 G16	I12-S14 VanDerWaalsContact C-N 3.31Å; I12-S14 PolarHBondContact O-N 2.92Å; S14-G16 VanDerWaalsContact C-N 3.27Å; S14-G16 PolarHBondContact O-N 3.16Å
15	T	64.7	Low	72.6	Confident	114 Å²	114	117.8 Å²	117.8	70%	0.699	65%	0.652	S	S	*	*			trans	-63.7	100.1	157.6	50	0	0	0	0	105.8	F13 L17	F13-T15 VanDerWaalsContact C-N 3.27Å; F13-T15 PolarHBondContact O-N 3.45Å; T15-L17 VanDerWaalsContact C-N 3.33Å; T15-L17 PolarHBondContact O-N 3.1Å
16	G	60.9	Low	74.5	Confident	71 Å²	71	117.9 Å²	117.9	73%	0.732	65%	0.651	S	S	*	*			trans	-59.3	99.7	171.1	0	0	0	0	0	108.1	S14 C18	S14-G16 VanDerWaalsContact C-N 3.27Å; S14-G16 PolarHBondContact O-N 3.16Å; G16-C18 PolarHBondContact O-N 3.02Å; G16-C18 VanDerWaalsContact O-N 3.15Å
17	L	65.6	Low	76.1	Confident	155 Å²	155	115.8 Å²	115.8	81%	0.812	66%	0.656	S	S	*	*			trans	-67.8	108.9	168.1	-121.5	77	0	0	0	105.7	T15 A19	T15-L17 VanDerWaalsContact C-N 3.33Å; T15-L17 PolarHBondContact O-N 3.1Å; L17-A19 PolarHBondContact O-N 2.96Å; L17-A19 VanDerWaalsContact O-N 3.1Å
18	C	66.5	Low	77.8	Confident	123 Å²	123	110.6 Å²	110.6	83%	0.831	65%	0.649	S	S	*	*	P	Polyproline II helix	trans	-54.6	119.4	164.9	-66.8	0	0	0	0	107.3	G16 L20	G16-C18 PolarHBondContact O-N 3.02Å; G16-C18 VanDerWaalsContact O-N 3.15Å; C18-L20 PolarHBondContact O-N 3.21Å
19	A	78.1	Confident	79.6	Confident	73 Å²	73	105.3 Å²	105.3	60%	0.603	63%	0.629	S	S	*	*	P	Polyproline II helix	trans	-67.2	134.5	177.4	0	0	0	0	0	108.6	L17 H47	L17-A19 PolarHBondContact O-N 2.96Å; L17-A19 VanDerWaalsContact O-N 3.1Å; A19-H47 PolarHBondContact O-CE1 3.31Å; A19-H47 PolarHBondContact O-NE2 3.36Å
20	L	85.3	Confident	81.1	Confident	147 Å²	147	103.7 Å²	103.7	77%	0.77	63%	0.63	S	S	*	*	P	Polyproline II helix	trans	-67.8	152.1	170.3	-69	172.8	0	0	0	109.8	C18 V22	C18-L20 PolarHBondContact O-N 3.21Å; L20-V22 PolarHBondContact O-N 2.66Å
21	P	90.5	Very high	82.6	Confident	35 Å²	35	101 Å²	101	23%	0.227	62%	0.617	C	S	.	*	P	Polyproline II helix	trans	-60	129.3	172.8	25.2	-33	0	0	0	110.1	H47 Y50	P21-H47 WeakPolarHBondContact CA-ND1 3.09Å; P21-H47 HydrophobicContact CB-CB 4.15Å; P21-Y50 HydrophobicContact CB-CD2 4.21Å; P21-Y50 HydrophobicContact CB-CE2 4.26Å; P21-Y50 HydrophobicContact CG-CD2 4.46Å; P21-Y50 HydrophobicContact CG-CE2 4.23Å
22	V	94.7	Very high	84.2	Confident	90 Å²	90	99.2 Å²	99.2	55%	0.545	62%	0.615	S	S	.	*	P	Polyproline II helix	trans	-102.6	129.3	172.6	-179.5	0	0	0	0	108.1	L20 L43 S44	L20-V22 PolarHBondContact O-N 2.66Å; V22-L43 CarbonylContact O-C 3.51Å; V22-L43 WeakPolarHBondContact O-CA 3.22Å; V22-S44 PolarHBondContact N-OG 3.46Å; V22-S44 PolarHBondContact O-N 3.24Å
23	L	96.6	Very high	85.6	Confident	51 Å²	51	98.7 Å²	98.7	27%	0.267	61%	0.612	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-110.9	131.7	176.4	-55.8	-179.4	0	0	0	109.5	T42 L43 I52 C111	L23-T42 WeakPolarHBondContact CA-O 3.23Å; L23-L43 HydrophobicContact CD2-CB 4.4Å; L23-L43 HydrophobicContact CD2-CD2 4.18Å; L23-L43 HydrophobicContact CD2-CG 3.71Å; L23-I52 HydrophobicContact CD1-CD1 4.03Å; L23-I52 HydrophobicContact CD2-CD1 3.58Å; L23-I52 HydrophobicContact CG-CD1 4.49Å; L23-C111 WeakPolarHBondContact CD1-O 3.47Å
24	T	97.6	Very high	87.2	Confident	85 Å²	85	92.6 Å²	92.6	52%	0.521	60%	0.597	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-123.2	131.1	177.6	-55.2	0	0	0	0	110.2	C41 T42	T24-C41 WeakPolarHBondContact O-CA 3.2Å; T24-T42 PolarHBondContact N-O 3.23Å; T24-T42 PolarHBondContact O-N 3.26Å
25	Q	98.1	Very high	88.9	Confident	62 Å²	62	89.1 Å²	89.1	29%	0.29	58%	0.575	S	S	.	*			trans	-124.1	147.4	174.2	-66.9	-179.5	-110.6	0	0	109.9	C41 Y109 C111	Q25-C41 HydrophobicContact CG-CB 4.24Å; Q25-Y109 PolarHBondContact NE2-O 2.86Å; Q25-C111 VanDerWaalsContact CG-SG 3.53Å; Q25-C111 PolarHBondContact OE1-SG 3.29Å
26	P	97.9	Very high	90.5	Very high	75 Å²	75	87.6 Å²	87.6	49%	0.487	57%	0.569	S	S	.	*			trans	-56.9	144.1	164.7	-21.9	33.5	0	0	0	110.5	S28 T40	P26-S28 PolarHBondContact O-N 3.02Å; P26-T40 VanDerWaalsContact CD-O 3.29Å; P26-T40 WeakPolarHBondContact CD-O 3.29Å
27	P	97.1	Very high	92.2	Very high	137 Å²	137	85.3 Å²	85.3	89%	0.89	54%	0.54	S	S	*	.	S	Bend	trans	-67.6	-23.1	-176.8	27.8	-35.8	0	0	0	113
28	S	96.8	Very high	93.7	Very high	95 Å²	95	83.4 Å²	83.4	66%	0.664	53%	0.525	S	S	*	.			trans	-157.6	159.2	177	61.1	0	0	0	0	111.2	P26	P26-S28 PolarHBondContact O-N 3.02Å
29	A	96	Very high	95.3	Very high	51 Å²	51	78.6 Å²	78.6	42%	0.421	49%	0.491	S	S	.	.			trans	-143.9	148.6	169.2	0	0	0	0	0	108.4	I37 L39	A29-I37 HydrophobicContact CB-CD1 3.82Å; A29-I37 HydrophobicContact CB-CG1 4.45Å; A29-L39 HydrophobicContact CB-CD2 3.52Å
30	S	95.9	Very high	96.2	Very high	116 Å²	116	76.6 Å²	76.6	81%	0.811	47%	0.471	S	S	*	.			trans	-148.3	145.6	-178.1	-52.6	0	0	0	0	110.5
31	A	96.3	Very high	96.8	Very high	44 Å²	44	69.6 Å²	69.6	36%	0.364	44%	0.435	S	S	.	.			trans	-152.8	165.9	175.4	0	0	0	0	0	109.9	A35 I37 L101	A31-A35 HydrophobicContact CB-CB 4.34Å; A31-I37 HydrophobicContact CB-CB 3.89Å; A31-I37 HydrophobicContact CB-CD1 4.05Å; A31-I37 HydrophobicContact CB-CG1 4.26Å; A31-L101 HydrophobicContact CB-CD2 4.01Å
32	L	96.9	Very high	97.2	Very high	143 Å²	143	70.3 Å²	70.3	75%	0.749	44%	0.438	S	S	*	.			trans	-72.6	150.1	175.5	-64.7	171.9	0	0	0	110.8	G34 A35	L32-G34 PolarHBondContact O-N 2.97Å; L32-A35 HydrophobicContact CB-CB 4.4Å; L32-A35 WeakPolarHBondContact O-CB 3.31Å; L32-A35 PolarHBondContact O-N 3.03Å
33	L	96.9	Very high	97.3	Very high	126 Å²	126	66.2 Å²	66.2	66%	0.66	41%	0.413	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.1	136.8	170.4	-64.2	178.6	0	0	0	110.2	A35 L101	L33-A35 PolarHBondContact O-N 3.02Å; L33-L101 WeakPolarHBondContact CA-O 3.34Å
34	G	97.1	Very high	97.2	Very high	41 Å²	41	65.4 Å²	65.4	42%	0.423	41%	0.412	S	S	.	.	T	Hydrogen-bonded Turn	trans	81.6	-13.4	-174.4	0	0	0	0	0	115.3	L32 N100 L101	L32-G34 PolarHBondContact O-N 2.97Å; G34-N100 WeakPolarHBondContact CA-OD1 3.44Å; G34-L101 PolarHBondContact N-O 2.86Å
35	A	97.7	Very high	96.9	Very high	37 Å²	37	65.7 Å²	65.7	31%	0.306	42%	0.418	S	S	.	.	S	Bend	trans	-75.3	172.7	174.1	0	0	0	0	0	111.7	A31 L32 L33 N100 L101	A31-A35 HydrophobicContact CB-CB 4.34Å; L32-A35 HydrophobicContact CB-CB 4.4Å; L32-A35 WeakPolarHBondContact O-CB 3.31Å; L32-A35 PolarHBondContact O-N 3.03Å; L33-A35 PolarHBondContact O-N 3.02Å; A35-N100 PolarHBondContact O-N 3.12Å; A35-L101 WeakPolarHBondContact O-CB 3.44Å; A35-L101 PolarHBondContact O-N 2.9Å
36	S	97.1	Very high	96.6	Very high	82 Å²	82	70.7 Å²	70.7	57%	0.573	44%	0.441	S	S	*	.			trans	-97.4	140	167.7	-58.6	0	0	0	0	110.1	F98	S36-F98 WeakPolarHBondContact CA-O 3.16Å
37	I	97.7	Very high	96.4	Very high	24 Å²	24	68.1 Å²	68.1	12%	0.123	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.7	147.3	174.3	-174.3	175	0	0	0	109.8	A29 A31 L39 T97 F98 L101	A29-I37 HydrophobicContact CB-CD1 3.82Å; A29-I37 HydrophobicContact CB-CG1 4.45Å; A31-I37 HydrophobicContact CB-CB 3.89Å; A31-I37 HydrophobicContact CB-CD1 4.05Å; A31-I37 HydrophobicContact CB-CG1 4.26Å; I37-L39 HydrophobicContact CD1-CD2 4.48Å; I37-T97 WeakPolarHBondContact O-CA 3.47Å; I37-F98 HydrophobicContact CB-CD2 4.31Å; I37-F98 HydrophobicContact CG2-CD2 3.25Å; I37-F98 HydrophobicContact CG2-CE2 3.64Å; I37-F98 HydrophobicContact CG2-CG 4.28Å; I37-F98 PolarHBondContact N-O 3Å; I37-F98 VanDerWaalsContact O-CD2 3.23Å; I37-F98 WeakPolarHBondContact O-CD2 3.32Å; I37-F98 PolarHBondContact O-N 3.13Å; I37-L101 HydrophobicContact CG2-CD1 3.8Å; I37-L101 HydrophobicContact CG2-CD2 4.14Å; I37-L101 HydrophobicContact CG2-CG 4.41Å
38	K	97.8	Very high	96.2	Very high	115 Å²	115	63.6 Å²	63.6	50%	0.5	39%	0.394	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	114.8	-178.3	-176.4	177.7	69.9	167	0	109.2	Y95 L96	K38-Y95 HydrophobicContact CD-CD1 3.88Å; K38-Y95 HydrophobicContact CD-CG 3.91Å; K38-Y95 HydrophobicContact CG-CD1 4.11Å; K38-Y95 HydrophobicContact CG-CG 4.25Å; K38-L96 CarbonylContact C-O 3.57Å; K38-L96 WeakPolarHBondContact CA-O 3.34Å
39	L	98.4	Very high	96	Very high	22 Å²	22	63.5 Å²	63.5	12%	0.115	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.3	149.9	169.8	-51.6	-173.2	0	0	0	109.8	A29 I37 W54 Y95 L96 F98 Y109	A29-L39 HydrophobicContact CB-CD2 3.52Å; I37-L39 HydrophobicContact CD1-CD2 4.48Å; L39-W54 HydrophobicContact CB-CH2 3.82Å; L39-W54 HydrophobicContact CB-CZ3 4.01Å; L39-W54 HydrophobicContact CD1-CZ3 4.26Å; L39-Y95 WeakPolarHBondContact O-CA 3.01Å; L39-L96 HydrophobicContact CB-CB 4.39Å; L39-L96 PolarHBondContact N-O 3.25Å; L39-L96 PolarHBondContact O-N 2.95Å; L39-F98 HydrophobicContact CD1-CE2 4.13Å; L39-F98 HydrophobicContact CD1-CZ 3.61Å; L39-F98 HydrophobicContact CD2-CE2 4.33Å; L39-F98 HydrophobicContact CG-CE2 3.71Å; L39-F98 HydrophobicContact CG-CZ 3.71Å; L39-Y109 VanDerWaalsContact CD1-CB 3.41Å; L39-Y109 HydrophobicContact CD1-CD1 3.98Å; L39-Y109 HydrophobicContact CD1-CD2 3.79Å; L39-Y109 HydrophobicContact CD1-CG 3.45Å; L39-Y109 VanDerWaalsContact CD1-CG 3.45Å
40	T	98.3	Very high	96	Very high	31 Å²	31	65 Å²	65	19%	0.19	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.1	136.3	-179.3	-54.4	0	0	0	0	109.8	P26 D93 Y95	P26-T40 VanDerWaalsContact CD-O 3.29Å; P26-T40 WeakPolarHBondContact CD-O 3.29Å; T40-D93 HydrophobicContact CG2-CB 4.25Å; T40-Y95 HydrophobicContact CG2-CD1 3.89Å; T40-Y95 HydrophobicContact CG2-CE1 3.55Å; T40-Y95 WeakPolarHBondContact OG1-CD1 3.28Å; T40-Y95 WeakPolarHBondContact OG1-CE1 3.33Å
41	C	98.2	Very high	96	Very high	0 Å²	0	61.2 Å²	61.2	0%	0	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	116.8	167	178	0	0	0	0	108	T24 Q25 W54 D93 R94 C111	T24-C41 WeakPolarHBondContact O-CA 3.2Å; Q25-C41 HydrophobicContact CG-CB 4.24Å; C41-W54 HydrophobicContact CB-CH2 3.75Å; C41-W54 HydrophobicContact CB-CZ2 3.67Å; C41-D93 WeakPolarHBondContact O-CA 2.99Å; C41-R94 PolarHBondContact N-O 3.2Å; C41-R94 PolarHBondContact O-N 2.86Å; C41-C111 HydrophobicContact CB-CB 3.48Å; C41-C111 VanDerWaalsContact CB-CB 3.48Å; C41-C111 WeakPolarHBondContact CB-SG 3.46Å; C41-C111 WeakPolarHBondContact SG-CB 3.36Å; C41-C111 CovalentContact SG-SG 2.03Å; C41-C111 PolarHBondContact SG-SG 3.49Å
42	T	97.9	Very high	96	Very high	50 Å²	50	59.1 Å²	59.1	31%	0.307	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.5	121.5	-178.3	-58.4	0	0	0	0	109.5	L23 T24 D93	L23-T42 WeakPolarHBondContact CA-O 3.23Å; T24-T42 PolarHBondContact N-O 3.23Å; T24-T42 PolarHBondContact O-N 3.26Å; T42-D93 WeakPolarHBondContact CB-OD1 3.49Å; T42-D93 WeakPolarHBondContact CG2-OD1 2.99Å; T42-D93 PolarHBondContact OG1-OD1 2.9Å
43	L	96.7	Very high	96.1	Very high	4 Å²	4	52.8 Å²	52.8	2%	0.021	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81	150.6	172	-62.4	93	0	0	0	110.2	V22 L23 H47 I52 A92 R94	V22-L43 CarbonylContact O-C 3.51Å; V22-L43 WeakPolarHBondContact O-CA 3.22Å; L23-L43 HydrophobicContact CD2-CB 4.4Å; L23-L43 HydrophobicContact CD2-CD2 4.18Å; L23-L43 HydrophobicContact CD2-CG 3.71Å; L43-H47 VanDerWaalsContact CD2-O 3.27Å; L43-H47 WeakPolarHBondContact CD2-O 3.43Å; L43-I52 HydrophobicContact CD1-CD1 4.17Å; L43-I52 HydrophobicContact CD1-CG1 3.74Å; L43-I52 HydrophobicContact CD2-CD1 3.84Å; L43-I52 HydrophobicContact CD2-CG1 4.1Å; L43-I52 HydrophobicContact CG-CD1 4.05Å; L43-I52 HydrophobicContact CG-CG1 4.18Å; L43-A92 HydrophobicContact CB-CB 4.5Å; L43-A92 WeakPolarHBondContact CB-O 3.36Å; L43-A92 WeakPolarHBondContact CD1-O 3.48Å; L43-A92 PolarHBondContact N-O 2.65Å; L43-A92 WeakPolarHBondContact O-CB 3.3Å; L43-R94 HydrophobicContact CD1-CG 3.67Å
44	S	94.7	Very high	96.1	Very high	33 Å²	33	46.8 Å²	46.8	23%	0.231	28%	0.275	C	S	.	.	P	Polyproline II helix	trans	-54	138.9	161.3	53.4	0	0	0	0	110.6	V22 E46 H47	V22-S44 PolarHBondContact N-OG 3.46Å; V22-S44 PolarHBondContact O-N 3.24Å; S44-E46 VanDerWaalsContact C-N 3.27Å; S44-E46 PolarHBondContact O-N 3.43Å; S44-E46 VanDerWaalsContact O-N 3.13Å; S44-H47 WeakPolarHBondContact O-CA 3.36Å; S44-H47 PolarHBondContact O-N 2.98Å; S44-H47 PolarHBondContact OG-ND1 3.42Å
45	S	92	Very high	96.1	Very high	92 Å²	92	47.7 Å²	47.7	64%	0.643	27%	0.266	S	S	*	.	G	3₁₀ helix	trans	-52.2	-40	-172.3	-54.9	0	0	0	0	114.7	H47 S48	S45-H47 PolarHBondContact O-N 3.37Å; S45-H47 VanDerWaalsContact O-N 3.12Å; S45-S48 VanDerWaalsContact O-CB 3.3Å; S45-S48 WeakPolarHBondContact O-CB 2.82Å; S45-S48 PolarHBondContact O-N 3.49Å; S45-S48 VanDerWaalsContact O-N 3.13Å; S45-S48 PolarHBondContact O-OG 2.74Å
46	E	91.5	Very high	96.1	Very high	167 Å²	167	46.3 Å²	46.3	78%	0.78	25%	0.253	S	S	*	.	G	3₁₀ helix	trans	-60.2	-21.2	178.3	-57	-54.5	137.5	0	0	113.2	S44	S44-E46 VanDerWaalsContact C-N 3.27Å; S44-E46 PolarHBondContact O-N 3.43Å; S44-E46 VanDerWaalsContact O-N 3.13Å
47	H	92.2	Very high	96.1	Very high	21 Å²	21	45.2 Å²	45.2	10%	0.097	24%	0.239	C	C	.	.	G	3₁₀ helix	trans	-113	16.2	-176.9	-57.3	106.8	0	0	0	112.5	A19 P21 L43 S44 S45 T49 Y50	A19-H47 PolarHBondContact O-CE1 3.31Å; A19-H47 PolarHBondContact O-NE2 3.36Å; P21-H47 WeakPolarHBondContact CA-ND1 3.09Å; P21-H47 HydrophobicContact CB-CB 4.15Å; L43-H47 VanDerWaalsContact CD2-O 3.27Å; L43-H47 WeakPolarHBondContact CD2-O 3.43Å; S44-H47 WeakPolarHBondContact O-CA 3.36Å; S44-H47 PolarHBondContact O-N 2.98Å; S44-H47 PolarHBondContact OG-ND1 3.42Å; S45-H47 PolarHBondContact O-N 3.37Å; S45-H47 VanDerWaalsContact O-N 3.12Å; H47-T49 PolarHBondContact O-N 2.79Å; H47-Y50 HydrophobicContact CB-CD1 4.44Å; H47-Y50 HydrophobicContact CB-CD2 3.77Å; H47-Y50 HydrophobicContact CB-CE2 4.02Å; H47-Y50 HydrophobicContact CB-CG 4.05Å; H47-Y50 AromaticContact CD2-CE2 3.35Å; H47-Y50 WeakPolarHBondContact CD2-CE2 3.47Å; H47-Y50 AromaticContact CD2-CZ 3.39Å; H47-Y50 PolarHBondContact CD2-OH 2.67Å; H47-Y50 AromaticContact CG-CE2 3.91Å; H47-Y50 WeakPolarHBondContact O-CB 3.4Å; H47-Y50 PolarHBondContact O-N 2.81Å
48	S	93.3	Very high	95.9	Very high	42 Å²	42	47.3 Å²	47.3	29%	0.294	25%	0.245	S	C	.	.	T	Hydrogen-bonded Turn	trans	-59	-13.4	-176.4	56.7	0	0	0	0	115	S45 R94	S45-S48 VanDerWaalsContact O-CB 3.3Å; S45-S48 WeakPolarHBondContact O-CB 2.82Å; S45-S48 PolarHBondContact O-N 3.49Å; S45-S48 VanDerWaalsContact O-N 3.13Å; S45-S48 PolarHBondContact O-OG 2.74Å; S48-R94 PolarHBondContact O-NH2 2.7Å
49	T	93.9	Very high	95.7	Very high	93 Å²	93	47.8 Å²	47.8	57%	0.571	26%	0.26	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.6	-11.2	176.6	58.3	0	0	0	0	113.8	H47 S71	H47-T49 PolarHBondContact O-N 2.79Å; T49-S71 WeakPolarHBondContact O-CB 3.23Å; T49-S71 PolarHBondContact O-OG 3.03Å
50	Y	94.6	Very high	95.6	Very high	83 Å²	83	51.2 Å²	51.2	33%	0.325	30%	0.3	S	S	.	.			trans	-69.3	153.6	-171.2	-74.1	9.7	0	0	0	112.8	P21 H47 R94 E113	P21-Y50 HydrophobicContact CB-CD2 4.21Å; P21-Y50 HydrophobicContact CB-CE2 4.26Å; P21-Y50 HydrophobicContact CG-CD2 4.46Å; P21-Y50 HydrophobicContact CG-CE2 4.23Å; H47-Y50 HydrophobicContact CB-CD1 4.44Å; H47-Y50 HydrophobicContact CB-CD2 3.77Å; H47-Y50 HydrophobicContact CB-CE2 4.02Å; H47-Y50 HydrophobicContact CB-CG 4.05Å; H47-Y50 AromaticContact CD2-CE2 3.35Å; H47-Y50 WeakPolarHBondContact CD2-CE2 3.47Å; H47-Y50 AromaticContact CD2-CZ 3.39Å; H47-Y50 PolarHBondContact CD2-OH 2.67Å; H47-Y50 AromaticContact CG-CE2 3.91Å; H47-Y50 WeakPolarHBondContact O-CB 3.4Å; H47-Y50 PolarHBondContact O-N 2.81Å; Y50-R94 PolarHBondContact O-NE 3.5Å; Y50-R94 PolarHBondContact O-NH2 2.94Å; Y50-E113 HydrophobicContact CD2-CG 3.69Å; Y50-E113 HydrophobicContact CE2-CG 4.42Å; Y50-E113 HydrophobicContact CG-CG 4.37Å
51	T	96.1	Very high	95.4	Very high	36 Å²	36	57.6 Å²	57.6	22%	0.221	32%	0.321	C	S	.	.			trans	-86.9	135.7	175.1	-62.3	0	0	0	0	109	K68 K70 S114	T51-K68 HydrophobicContact CG2-CB 4.02Å; T51-K70 HydrophobicContact CG2-CG 4.24Å; T51-S114 PolarHBondContact O-N 2.95Å
52	I	97.3	Very high	95.2	Very high	0 Å²	0	62.2 Å²	62.2	0%	0	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	142.1	175.9	-68.6	-59.9	0	0	0	110.1	L23 L43 K68 V69 R94 C111 G112	L23-I52 HydrophobicContact CD1-CD1 4.03Å; L23-I52 HydrophobicContact CD2-CD1 3.58Å; L23-I52 HydrophobicContact CG-CD1 4.49Å; L43-I52 HydrophobicContact CD1-CD1 4.17Å; L43-I52 HydrophobicContact CD1-CG1 3.74Å; L43-I52 HydrophobicContact CD2-CD1 3.84Å; L43-I52 HydrophobicContact CD2-CG1 4.1Å; L43-I52 HydrophobicContact CG-CD1 4.05Å; L43-I52 HydrophobicContact CG-CG1 4.18Å; I52-K68 CarbonylContact O-C 3.54Å; I52-K68 VanDerWaalsContact O-CA 3.29Å; I52-K68 WeakPolarHBondContact O-CA 3.3Å; I52-V69 PolarHBondContact N-O 3.08Å; I52-V69 PolarHBondContact O-N 2.82Å; I52-R94 HydrophobicContact CB-CB 4.02Å; I52-R94 HydrophobicContact CB-CG 3.78Å; I52-R94 HydrophobicContact CG1-CB 4.09Å; I52-R94 HydrophobicContact CG1-CG 3.53Å; I52-R94 HydrophobicContact CG2-CB 4.31Å; I52-C111 HydrophobicContact CG2-CB 3.63Å; I52-G112 CarbonylContact C-O 3.58Å; I52-G112 VanDerWaalsContact CA-O 3.3Å; I52-G112 WeakPolarHBondContact CA-O 3.45Å; I52-G112 WeakPolarHBondContact CD1-O 3.43Å
53	E	97.9	Very high	95.1	Very high	10 Å²	10	63.1 Å²	63.1	5%	0.047	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108	140.8	170.5	-66.6	175.9	176.5	0	0	110	Y55 Y65 M67 K68 C111 G112 S114	E53-Y55 HydrophobicContact CB-CD2 4.37Å; E53-Y55 HydrophobicContact CB-CE2 3.55Å; E53-Y55 PolarHBondContact OE2-OH 3.16Å; E53-Y65 HydrophobicContact CB-CE2 4.06Å; E53-Y65 HydrophobicContact CG-CE2 3.93Å; E53-M67 CarbonylContact C-O 3.51Å; E53-M67 WeakPolarHBondContact CA-O 3.4Å; E53-K68 HydrophobicContact CG-CB 4.06Å; E53-C111 CarbonylContact O-C 3.57Å; E53-C111 VanDerWaalsContact O-CA 3.28Å; E53-C111 WeakPolarHBondContact O-CA 3.35Å; E53-G112 PolarHBondContact N-O 2.91Å; E53-G112 PolarHBondContact O-N 3.1Å; E53-S114 VanDerWaalsContact OE1-CB 3.29Å; E53-S114 WeakPolarHBondContact OE1-CB 3.42Å; E53-S114 PolarHBondContact OE1-OG 2.97Å
54	W	98.2	Very high	95.1	Very high	0 Å²	0	67.1 Å²	67.1	0%	0	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.3	136.3	176.6	-73.6	94.4	0	0	0	110.2	L39 C41 I66 M67 L96 C111	L39-W54 HydrophobicContact CB-CH2 3.82Å; L39-W54 HydrophobicContact CB-CZ3 4.01Å; L39-W54 HydrophobicContact CD1-CZ3 4.26Å; C41-W54 HydrophobicContact CB-CH2 3.75Å; C41-W54 HydrophobicContact CB-CZ2 3.67Å; W54-I66 HydrophobicContact CB-CB 4.16Å; W54-I66 HydrophobicContact CB-CD1 4.31Å; W54-I66 WeakPolarHBondContact O-CB 3.48Å; W54-I66 PolarHBondContact O-N 2.92Å; W54-M67 HydrophobicContact CB-CG 4.31Å; W54-M67 PolarHBondContact N-O 3.35Å; W54-L96 HydrophobicContact CB-CD2 4.06Å; W54-L96 HydrophobicContact CD2-CB 3.68Å; W54-L96 HydrophobicContact CD2-CD2 3.92Å; W54-L96 HydrophobicContact CD2-CG 4.38Å; W54-L96 HydrophobicContact CE3-CB 4.11Å; W54-L96 HydrophobicContact CE3-CD2 3.93Å; W54-L96 HydrophobicContact CG-CB 4.06Å; W54-L96 HydrophobicContact CG-CD1 4.49Å; W54-L96 HydrophobicContact CG-CD2 3.99Å; W54-L96 HydrophobicContact CG-CG 4.43Å; W54-L96 HydrophobicContact CH2-CB 4.31Å; W54-L96 HydrophobicContact CZ2-CB 3.91Å; W54-L96 HydrophobicContact CZ3-CB 4.4Å; W54-C111 HydrophobicContact CD2-CB 4.38Å; W54-C111 HydrophobicContact CE3-CB 4.22Å; W54-C111 HydrophobicContact CH2-CB 4.32Å; W54-C111 HydrophobicContact CZ2-CB 4.46Å; W54-C111 HydrophobicContact CZ3-CB 4.19Å
55	Y	97.5	Very high	95.2	Very high	59 Å²	59	68.9 Å²	68.9	23%	0.231	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	138.4	178.9	-65.7	-92.2	0	0	0	110.2	E53 P63 Q64 Y65 Y109 H110	E53-Y55 HydrophobicContact CB-CD2 4.37Å; E53-Y55 HydrophobicContact CB-CE2 3.55Å; E53-Y55 PolarHBondContact OE2-OH 3.16Å; Y55-P63 HydrophobicContact CD1-CB 4.33Å; Y55-Q64 CarbonylContact C-O 3.57Å; Y55-Q64 VanDerWaalsContact CA-O 3.26Å; Y55-Q64 WeakPolarHBondContact CA-O 3.2Å; Y55-Y65 AromaticContact CE1-CD2 3.98Å; Y55-Y65 HydrophobicContact CE1-CD2 3.98Å; Y55-Y65 AromaticContact CZ-CD2 3.97Å; Y55-Y109 VanDerWaalsContact O-CA 3.32Å; Y55-Y109 WeakPolarHBondContact O-CA 3.39Å; Y55-H110 PolarHBondContact N-O 2.82Å; Y55-H110 PolarHBondContact O-N 2.87Å
56	Q	96.9	Very high	95.4	Very high	9 Å²	9	64.6 Å²	64.6	4%	0.042	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.2	129.1	171.8	-167.5	-177.7	46.5	0	0	109.2	P63 Q64 I66 A107 Y109	Q56-P63 CarbonylContact O-C 3.6Å; Q56-P63 WeakPolarHBondContact O-CA 3.42Å; Q56-Q64 PolarHBondContact N-O 3.02Å; Q56-Q64 PolarHBondContact O-N 3.1Å; Q56-I66 HydrophobicContact CB-CD1 3.76Å; Q56-I66 HydrophobicContact CB-CG1 3.92Å; Q56-A107 HydrophobicContact CG-CB 3.45Å; Q56-A107 VanDerWaalsContact CG-CB 3.45Å; Q56-Y109 HydrophobicContact CB-CD1 4.46Å; Q56-Y109 HydrophobicContact CB-CE1 4.18Å; Q56-Y109 HydrophobicContact CG-CD1 4.44Å; Q56-Y109 HydrophobicContact CG-CE1 3.9Å; Q56-Y109 PolarHBondContact NE2-OH 3.38Å
57	Q	96.2	Very high	95.7	Very high	58 Å²	58	56.6 Å²	56.6	27%	0.271	31%	0.313	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	112.9	173.6	-174.2	174	13.3	0	0	110.4	R61 P63 A107 E108 H110	Q57-R61 PolarHBondContact NE2-O 2.87Å; Q57-P63 HydrophobicContact CB-CG 4.49Å; Q57-P63 HydrophobicContact CG-CG 4.44Å; Q57-A107 WeakPolarHBondContact O-CB 3.47Å; Q57-E108 HydrophobicContact CB-CB 4.28Å; Q57-E108 PolarHBondContact N-O 3.34Å; Q57-E108 PolarHBondContact O-N 2.84Å; Q57-H110 PolarHBondContact OE1-NE2 3.41Å
58	R	94.8	Very high	96	Very high	69 Å²	69	58.7 Å²	58.7	26%	0.26	32%	0.322	S	S	.	.			trans	-87.7	154.4	172.8	-68.6	-177.8	177.7	119.6	-7.8	110.4	G60 R61 D104 A107	R58-G60 PolarHBondContact O-N 2.62Å; R58-R61 HydrophobicContact CB-CB 4.37Å; R58-R61 HydrophobicContact CB-CG 4.41Å; R58-R61 PolarHBondContact O-N 3.41Å; R58-D104 PolarHBondContact NE-O 3.46Å; R58-D104 PolarHBondContact NH2-O 3.45Å; R58-A107 HydrophobicContact CG-CB 4.1Å
59	P	94.2	Very high	96.2	Very high	124 Å²	124	56.7 Å²	56.7	81%	0.805	31%	0.308	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51	125.3	177.6	-27.8	35.3	0	0	0	112.3	R61	P59-R61 VanDerWaalsContact C-N 3.27Å; P59-R61 PolarHBondContact O-N 2.89Å
60	G	94.5	Very high	96.4	Very high	94 Å²	94	56.6 Å²	56.6	97%	0.969	30%	0.3	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.5	10.6	179.4	0	0	0	0	0	115.7	R58	R58-G60 PolarHBondContact O-N 2.62Å
61	R	94.5	Very high	96.5	Very high	165 Å²	165	55.1 Å²	55.1	62%	0.623	30%	0.302	S	S	*	.	S	Bend	trans	-114.9	155.3	175.9	-63.4	-166.9	173.7	-172.4	-0.1	111.6	Q57 R58 P59	Q57-R61 PolarHBondContact NE2-O 2.87Å; R58-R61 HydrophobicContact CB-CB 4.37Å; R58-R61 HydrophobicContact CB-CG 4.41Å; R58-R61 PolarHBondContact O-N 3.41Å; P59-R61 VanDerWaalsContact C-N 3.27Å; P59-R61 PolarHBondContact O-N 2.89Å
62	S	94.7	Very high	96.5	Very high	97 Å²	97	59.1 Å²	59.1	68%	0.678	32%	0.322	S	S	*	.			trans	-67.4	152.7	168.2	55.9	0	0	0	0	110.5	Q64	S62-Q64 PolarHBondContact O-N 2.77Å
63	P	95.6	Very high	96.5	Very high	69 Å²	69	60.1 Å²	60.1	45%	0.448	33%	0.332	S	S	.	.			trans	-53.5	133.2	170.2	-25.4	34.7	0	0	0	111.7	Y55 Q56 Q57	Y55-P63 HydrophobicContact CD1-CB 4.33Å; Q56-P63 CarbonylContact O-C 3.6Å; Q56-P63 WeakPolarHBondContact O-CA 3.42Å; Q57-P63 HydrophobicContact CB-CG 4.49Å; Q57-P63 HydrophobicContact CG-CG 4.44Å
64	Q	96.1	Very high	96.4	Very high	88 Å²	88	62 Å²	62	41%	0.411	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.5	130.3	174.5	179.7	177.7	20.4	0	0	109.1	Y55 Q56 S62 I66	Y55-Q64 CarbonylContact C-O 3.57Å; Y55-Q64 VanDerWaalsContact CA-O 3.26Å; Y55-Q64 WeakPolarHBondContact CA-O 3.2Å; Q56-Q64 PolarHBondContact N-O 3.02Å; Q56-Q64 PolarHBondContact O-N 3.1Å; S62-Q64 PolarHBondContact O-N 2.77Å; Q64-I66 PolarHBondContact O-N 2.92Å
65	Y	97.1	Very high	96.4	Very high	71 Å²	71	65.2 Å²	65.2	28%	0.278	36%	0.361	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.8	131.8	173.8	177.7	-98.8	0	0	0	111.6	E53 Y55 M67 K68	E53-Y65 HydrophobicContact CB-CE2 4.06Å; E53-Y65 HydrophobicContact CG-CE2 3.93Å; Y55-Y65 AromaticContact CE1-CD2 3.98Å; Y55-Y65 HydrophobicContact CE1-CD2 3.98Å; Y55-Y65 AromaticContact CZ-CD2 3.97Å; Y65-M67 VanDerWaalsContact CZ-C 3.47Å; Y65-M67 VanDerWaalsContact OH-C 3.29Å; Y65-K68 WeakPolarHBondContact OH-CB 3.46Å; Y65-K68 WeakPolarHBondContact OH-CG 3.46Å; Y65-K68 PolarHBondContact OH-N 2.79Å
66	I	97.5	Very high	96.4	Very high	1 Å²	1	64.6 Å²	64.6	1%	0.005	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	-58.3	176.3	-54.8	178	0	0	0	110.3	W54 Q56 Q64 K77 G78 I81 F85 L96 Y109	W54-I66 HydrophobicContact CB-CB 4.16Å; W54-I66 HydrophobicContact CB-CD1 4.31Å; W54-I66 WeakPolarHBondContact O-CB 3.48Å; W54-I66 PolarHBondContact O-N 2.92Å; Q56-I66 HydrophobicContact CB-CD1 3.76Å; Q56-I66 HydrophobicContact CB-CG1 3.92Å; Q64-I66 PolarHBondContact O-N 2.92Å; I66-K77 CarbonylContact O-C 3.48Å; I66-K77 WeakPolarHBondContact O-CA 3.43Å; I66-G78 PolarHBondContact O-N 2.71Å; I66-I81 HydrophobicContact CB-CD1 4.49Å; I66-I81 HydrophobicContact CG2-CD1 4.38Å; I66-I81 HydrophobicContact CG2-CG2 3.87Å; I66-I81 WeakPolarHBondContact O-CG1 3.42Å; I66-F85 HydrophobicContact CD1-CE1 4.31Å; I66-F85 HydrophobicContact CG2-CD1 3.58Å; I66-F85 HydrophobicContact CG2-CE1 4.06Å; I66-F85 HydrophobicContact CG2-CG 4.45Å; I66-L96 HydrophobicContact CD1-CD2 3.78Å; I66-L96 HydrophobicContact CG2-CD1 4.27Å; I66-Y109 HydrophobicContact CD1-CD1 3.59Å; I66-Y109 HydrophobicContact CD1-CE1 3.54Å
67	M	97.6	Very high	96.4	Very high	0 Å²	0	67.3 Å²	67.3	0%	0	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-170.1	160.8	-174	63.8	-164.9	-52.2	0	0	112.6	E53 W54 Y65 V69 H75 S76 K77 L96	E53-M67 CarbonylContact C-O 3.51Å; E53-M67 WeakPolarHBondContact CA-O 3.4Å; W54-M67 HydrophobicContact CB-CG 4.31Å; W54-M67 PolarHBondContact N-O 3.35Å; Y65-M67 VanDerWaalsContact CZ-C 3.47Å; Y65-M67 VanDerWaalsContact OH-C 3.29Å; M67-V69 HydrophobicContact CE-CG2 4.36Å; M67-V69 HydrophobicContact CG-CG2 4.18Å; M67-H75 HydrophobicContact CE-CB 3.54Å; M67-H75 WeakPolarHBondContact CE-CD2 3.17Å; M67-S76 WeakPolarHBondContact CA-O 3.17Å; M67-S76 WeakPolarHBondContact CB-O 3.18Å; M67-K77 HydrophobicContact CE-CG 4.36Å; M67-L96 HydrophobicContact CG-CD1 4.05Å; M67-L96 HydrophobicContact SD-CD1 3.2Å; M67-L96 WeakPolarHBondContact SD-CD1 3.45Å
68	K	97.4	Very high	96.4	Very high	64 Å²	64	65.3 Å²	65.3	28%	0.278	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.1	142.6	164.9	63	-175.9	178.8	-172.4	0	110.7	T51 I52 E53 Y65 H75 S76	T51-K68 HydrophobicContact CG2-CB 4.02Å; I52-K68 CarbonylContact O-C 3.54Å; I52-K68 VanDerWaalsContact O-CA 3.29Å; I52-K68 WeakPolarHBondContact O-CA 3.3Å; E53-K68 HydrophobicContact CG-CB 4.06Å; Y65-K68 WeakPolarHBondContact OH-CB 3.46Å; Y65-K68 WeakPolarHBondContact OH-CG 3.46Å; Y65-K68 PolarHBondContact OH-N 2.79Å; K68-H75 WeakPolarHBondContact O-CA 3.47Å; K68-H75 WeakPolarHBondContact O-CB 2.96Å; K68-S76 WeakPolarHBondContact CE-OG 3.34Å; K68-S76 WeakPolarHBondContact CG-OG 3.46Å; K68-S76 PolarHBondContact N-O 3.35Å; K68-S76 PolarHBondContact O-N 2.97Å; K68-S76 VanDerWaalsContact O-N 3.1Å
69	V	98	Very high	96.4	Very high	0 Å²	0	69.7 Å²	69.7	0%	0	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.6	119.2	179.1	-171.3	0	0	0	0	108.9	I52 M67 H75 S88	I52-V69 PolarHBondContact N-O 3.08Å; I52-V69 PolarHBondContact O-N 2.82Å; M67-V69 HydrophobicContact CE-CG2 4.36Å; M67-V69 HydrophobicContact CG-CG2 4.18Å; V69-H75 HydrophobicContact CG2-CB 4.16Å; V69-S88 WeakPolarHBondContact CG1-O 3.29Å
70	K	97.4	Very high	96.5	Very high	91 Å²	91	67.6 Å²	67.6	40%	0.396	40%	0.401	S	S	.	.			trans	-85	167.3	178.9	-60.9	-168.5	-169.3	172.6	0	111.4	T51 D72 G73 S74 S89	T51-K70 HydrophobicContact CG2-CG 4.24Å; K70-D72 VanDerWaalsContact C-N 3.27Å; K70-D72 WeakPolarHBondContact CB-OD1 3.33Å; K70-D72 PolarHBondContact O-N 3.33Å; K70-G73 PolarHBondContact O-N 3.47Å; K70-S74 WeakPolarHBondContact CD-OG 3.11Å; K70-S74 PolarHBondContact N-O 3.19Å; K70-S89 WeakPolarHBondContact O-CB 3.35Å
71	S	96.7	Very high	96.5	Very high	53 Å²	53	64.1 Å²	64.1	37%	0.371	36%	0.36	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.1	-32.2	177.2	42.9	0	0	0	0	114.4	T49 G73 S89 R94	T49-S71 WeakPolarHBondContact O-CB 3.23Å; T49-S71 PolarHBondContact O-OG 3.03Å; S71-G73 PolarHBondContact O-N 2.82Å; S71-S89 WeakPolarHBondContact O-CB 3.29Å; S71-S89 PolarHBondContact O-OG 2.82Å; S71-R94 VanDerWaalsContact CA-CZ 3.47Å; S71-R94 VanDerWaalsContact CA-NH2 3.32Å; S71-R94 VanDerWaalsContact CB-NH2 3.3Å
72	D	96.7	Very high	96.6	Very high	120 Å²	120	58.6 Å²	58.6	64%	0.642	35%	0.346	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.8	-2.7	174.7	67	3.4	0	0	0	114.1	K70 S74	K70-D72 VanDerWaalsContact C-N 3.27Å; K70-D72 WeakPolarHBondContact CB-OD1 3.33Å; K70-D72 PolarHBondContact O-N 3.33Å; D72-S74 VanDerWaalsContact C-N 3.31Å; D72-S74 VanDerWaalsContact OD1-CB 3.23Å; D72-S74 WeakPolarHBondContact OD1-CB 3.15Å; D72-S74 PolarHBondContact OD1-N 2.82Å; D72-S74 PolarHBondContact OD1-OG 2.92Å; D72-S74 PolarHBondContact OD2-OG 3.08Å
73	G	96.6	Very high	96.7	Very high	20 Å²	20	60.3 Å²	60.3	21%	0.206	35%	0.347	C	S	.	.	S	Bend	trans	85.6	-5.5	-178.6	0	0	0	0	0	114.7	K70 S71	K70-G73 PolarHBondContact O-N 3.47Å; S71-G73 PolarHBondContact O-N 2.82Å
74	S	97.4	Very high	96.7	Very high	49 Å²	49	59 Å²	59	34%	0.343	33%	0.333	S	S	.	.			trans	-65.7	147.6	170.6	69.6	0	0	0	0	110.7	K70 D72	K70-S74 WeakPolarHBondContact CD-OG 3.11Å; K70-S74 PolarHBondContact N-O 3.19Å; D72-S74 VanDerWaalsContact C-N 3.31Å; D72-S74 VanDerWaalsContact OD1-CB 3.23Å; D72-S74 WeakPolarHBondContact OD1-CB 3.15Å; D72-S74 PolarHBondContact OD1-N 2.82Å; D72-S74 PolarHBondContact OD1-OG 2.92Å; D72-S74 PolarHBondContact OD2-OG 3.08Å
75	H	97	Very high	96.8	Very high	68 Å²	68	55 Å²	55	32%	0.315	31%	0.314	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.4	159.5	-176.5	64	-99.2	0	0	0	112.6	M67 K68 V69 G87	M67-H75 HydrophobicContact CE-CB 3.54Å; M67-H75 WeakPolarHBondContact CE-CD2 3.17Å; K68-H75 WeakPolarHBondContact O-CA 3.47Å; K68-H75 WeakPolarHBondContact O-CB 2.96Å; V69-H75 HydrophobicContact CG2-CB 4.16Å; H75-G87 PolarHBondContact CE1-N 2.94Å; H75-G87 PolarHBondContact CE1-O 2.78Å; H75-G87 PolarHBondContact ND1-N 3.06Å; H75-G87 PolarHBondContact ND1-O 2.85Å
76	S	97	Very high	96.8	Very high	47 Å²	47	56.5 Å²	56.5	33%	0.329	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.3	135.7	168.4	65.3	0	0	0	0	110.4	M67 K68	M67-S76 WeakPolarHBondContact CA-O 3.17Å; M67-S76 WeakPolarHBondContact CB-O 3.18Å; K68-S76 WeakPolarHBondContact CE-OG 3.34Å; K68-S76 WeakPolarHBondContact CG-OG 3.46Å; K68-S76 PolarHBondContact N-O 3.35Å; K68-S76 PolarHBondContact O-N 2.97Å; K68-S76 VanDerWaalsContact O-N 3.1Å
77	K	96.9	Very high	96.8	Very high	66 Å²	66	56.8 Å²	56.8	29%	0.287	33%	0.328	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.9	151.3	179.1	-66.6	166.9	179.9	147	0	110.9	I66 M67 I81 D83 F85	I66-K77 CarbonylContact O-C 3.48Å; I66-K77 WeakPolarHBondContact O-CA 3.43Å; M67-K77 HydrophobicContact CE-CG 4.36Å; K77-I81 HydrophobicContact CB-CB 4.2Å; K77-I81 HydrophobicContact CB-CG2 4.37Å; K77-I81 HydrophobicContact CD-CG2 4.48Å; K77-I81 HydrophobicContact CG-CG2 4.29Å; K77-D83 PolarHBondContact NZ-O 2.74Å; K77-D83 IonicContact NZ-OD1 3.39Å; K77-D83 PolarHBondContact NZ-OD1 3.34Å; K77-F85 WeakPolarHBondContact CE-O 3.49Å; K77-F85 PolarHBondContact NZ-O 3.2Å
78	G	96.5	Very high	96.9	Very high	15 Å²	15	58.9 Å²	58.9	16%	0.155	34%	0.343	C	S	.	.	P	Polyproline II helix	trans	-72.6	168.8	164.1	0	0	0	0	0	111.9	I66 G80 I81	I66-G78 PolarHBondContact O-N 2.71Å; G78-G80 PolarHBondContact O-N 2.88Å; G78-I81 WeakPolarHBondContact O-CB 3.26Å; G78-I81 WeakPolarHBondContact O-CG1 3.38Å; G78-I81 PolarHBondContact O-N 2.91Å
79	D	95.6	Very high	96.9	Very high	162 Å²	162	57.2 Å²	57.2	87%	0.866	34%	0.34	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.3	135	-179.5	-65.7	-28	0	0	0	111.8	I81	D79-I81 PolarHBondContact O-N 3.25Å
80	G	95.4	Very high	96.9	Very high	80 Å²	80	60.7 Å²	60.7	83%	0.825	36%	0.364	S	S	*	.	T	Hydrogen-bonded Turn	trans	75.7	2.6	178.6	0	0	0	0	0	115.2	G78 P82	G78-G80 PolarHBondContact O-N 2.88Å; G80-P82 WeakPolarHBondContact O-CD 3.39Å
81	I	95.8	Very high	96.8	Very high	21 Å²	21	59 Å²	59	11%	0.108	37%	0.372	C	S	.	.			trans	-76.1	122.5	177.4	-60.4	-62.7	0	0	0	109.9	I66 K77 G78 D79 F85	I66-I81 HydrophobicContact CB-CD1 4.49Å; I66-I81 HydrophobicContact CG2-CD1 4.38Å; I66-I81 HydrophobicContact CG2-CG2 3.87Å; I66-I81 WeakPolarHBondContact O-CG1 3.42Å; K77-I81 HydrophobicContact CB-CB 4.2Å; K77-I81 HydrophobicContact CB-CG2 4.37Å; K77-I81 HydrophobicContact CD-CG2 4.48Å; K77-I81 HydrophobicContact CG-CG2 4.29Å; G78-I81 WeakPolarHBondContact O-CB 3.26Å; G78-I81 WeakPolarHBondContact O-CG1 3.38Å; G78-I81 PolarHBondContact O-N 2.91Å; D79-I81 PolarHBondContact O-N 3.25Å; I81-F85 HydrophobicContact CG2-CB 3.94Å; I81-F85 HydrophobicContact CG2-CD1 4.21Å; I81-F85 HydrophobicContact CG2-CD2 4.23Å; I81-F85 HydrophobicContact CG2-CG 3.89Å
82	P	95.9	Very high	96.8	Very high	49 Å²	49	57.6 Å²	57.6	32%	0.318	36%	0.364	S	S	.	.			trans	-63.7	151.2	-174.7	-25.4	36.4	0	0	0	113.7	G80 R84 F85	G80-P82 WeakPolarHBondContact O-CD 3.39Å; P82-R84 HydrophobicContact CB-CG 4.22Å; P82-R84 VanDerWaalsContact CB-NH1 3.26Å; P82-R84 VanDerWaalsContact CG-NH1 3.3Å; P82-R84 PolarHBondContact O-N 3.34Å; P82-F85 HydrophobicContact CB-CD2 4.28Å; P82-F85 HydrophobicContact CB-CE2 4.47Å; P82-F85 HydrophobicContact CG-CE2 4.32Å; P82-F85 WeakPolarHBondContact O-CD2 3.21Å; P82-F85 PolarHBondContact O-N 2.97Å; P82-F85 VanDerWaalsContact O-N 3.1Å
83	D	96	Very high	96.9	Very high	133 Å²	133	53.7 Å²	53.7	71%	0.711	34%	0.343	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63	-18.9	-177.3	-81.3	-34.8	0	0	0	115.3	K77 F85	K77-D83 PolarHBondContact NZ-O 2.74Å; K77-D83 IonicContact NZ-OD1 3.39Å; K77-D83 PolarHBondContact NZ-OD1 3.34Å; D83-F85 PolarHBondContact O-N 2.7Å; D83-F85 VanDerWaalsContact O-N 3.16Å
84	R	97.2	Very high	96.9	Very high	40 Å²	40	52.7 Å²	52.7	15%	0.151	33%	0.333	C	S	.	.	T	Hydrogen-bonded Turn	trans	-60.8	-21.1	175.9	79.5	178	172.2	-89.4	1.6	113.5	P82 F98 S99 D105	P82-R84 HydrophobicContact CB-CG 4.22Å; P82-R84 VanDerWaalsContact CB-NH1 3.26Å; P82-R84 VanDerWaalsContact CG-NH1 3.3Å; P82-R84 PolarHBondContact O-N 3.34Å; R84-F98 WeakPolarHBondContact O-CA 3.49Å; R84-S99 WeakPolarHBondContact CA-OG 3.29Å; R84-S99 VanDerWaalsContact CB-O 3.29Å; R84-S99 WeakPolarHBondContact CB-O 3.32Å; R84-S99 WeakPolarHBondContact CD-O 3.28Å; R84-S99 PolarHBondContact O-N 2.98Å; R84-S99 PolarHBondContact O-OG 3.13Å; R84-D105 IonicContact CZ-OD1 3.49Å; R84-D105 IonicContact CZ-OD2 2.92Å; R84-D105 IonicContact NE-OD1 3.02Å; R84-D105 IonicContact NE-OD2 2.66Å; R84-D105 PolarHBondContact NE-OD2 2.76Å; R84-D105 VanDerWaalsContact NH2-CG 3.31Å; R84-D105 IonicContact NH2-OD1 3.21Å; R84-D105 PolarHBondContact NH2-OD1 2.84Å; R84-D105 IonicContact NH2-OD2 3.56Å; R84-D105 PolarHBondContact NH2-OD2 2.81Å
85	F	97.2	Very high	97	Very high	4 Å²	4	51.7 Å²	51.7	2%	0.018	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.5	133.2	176.6	-70.8	-117.8	0	0	0	110.3	I66 K77 I81 P82 D83 L96 T97 F98 Y109	I66-F85 HydrophobicContact CD1-CE1 4.31Å; I66-F85 HydrophobicContact CG2-CD1 3.58Å; I66-F85 HydrophobicContact CG2-CE1 4.06Å; I66-F85 HydrophobicContact CG2-CG 4.45Å; K77-F85 WeakPolarHBondContact CE-O 3.49Å; K77-F85 PolarHBondContact NZ-O 3.2Å; I81-F85 HydrophobicContact CG2-CB 3.94Å; I81-F85 HydrophobicContact CG2-CD1 4.21Å; I81-F85 HydrophobicContact CG2-CD2 4.23Å; I81-F85 HydrophobicContact CG2-CG 3.89Å; P82-F85 HydrophobicContact CB-CD2 4.28Å; P82-F85 HydrophobicContact CB-CE2 4.47Å; P82-F85 HydrophobicContact CG-CE2 4.32Å; P82-F85 WeakPolarHBondContact O-CD2 3.21Å; P82-F85 PolarHBondContact O-N 2.97Å; P82-F85 VanDerWaalsContact O-N 3.1Å; D83-F85 PolarHBondContact O-N 2.7Å; D83-F85 VanDerWaalsContact O-N 3.16Å; F85-L96 HydrophobicContact CD1-CD1 4.2Å; F85-T97 CarbonylContact C-O 3.48Å; F85-T97 WeakPolarHBondContact CA-O 3.49Å; F85-F98 AromaticContact CD1-CD1 3.41Å; F85-F98 HydrophobicContact CD1-CD1 3.41Å; F85-F98 VanDerWaalsContact CD1-CD1 3.41Å; F85-F98 AromaticContact CD1-CE1 3.79Å; F85-F98 HydrophobicContact CD1-CE1 3.79Å; F85-F98 HydrophobicContact CD2-CD1 4.44Å; F85-F98 AromaticContact CE1-CD1 3.28Å; F85-F98 HydrophobicContact CE1-CD1 3.28Å; F85-F98 AromaticContact CE1-CE1 3.5Å; F85-F98 HydrophobicContact CE1-CE1 3.5Å; F85-F98 VanDerWaalsContact CE1-CE1 3.5Å; F85-F98 HydrophobicContact CE2-CD1 4.31Å; F85-F98 HydrophobicContact CG-CD1 4.01Å; F85-F98 AromaticContact CZ-CD1 3.74Å; F85-F98 HydrophobicContact CZ-CD1 3.74Å; F85-F98 HydrophobicContact CZ-CE1 4.25Å; F85-Y109 HydrophobicContact CE1-CE1 4.46Å
86	M	97.6	Very high	97.1	Very high	103 Å²	103	48.5 Å²	48.5	51%	0.507	31%	0.307	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142	139.5	-179.1	-67.7	-170.9	70	0	0	111.3	T97	M86-T97 PolarHBondContact N-O 2.64Å; M86-T97 PolarHBondContact O-N 3.39Å
87	G	97.9	Very high	97.1	Very high	7 Å²	7	48 Å²	48	7%	0.072	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	143.9	173.6	0	0	0	0	0	111.1	H75 Y95	H75-G87 PolarHBondContact CE1-N 2.94Å; H75-G87 PolarHBondContact CE1-O 2.78Å; H75-G87 PolarHBondContact ND1-N 3.06Å; H75-G87 PolarHBondContact ND1-O 2.85Å; G87-Y95 WeakPolarHBondContact CA-O 3.43Å
88	S	98.2	Very high	97	Very high	45 Å²	45	45 Å²	45	32%	0.315	29%	0.289	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.7	167.1	169.1	63.8	0	0	0	0	110.8	V69 Y95	V69-S88 WeakPolarHBondContact CG1-O 3.29Å; S88-Y95 PolarHBondContact N-O 2.79Å; S88-Y95 VanDerWaalsContact N-O 3.08Å; S88-Y95 PolarHBondContact O-N 2.95Å; S88-Y95 WeakPolarHBondContact OG-CB 3.36Å
89	S	98.1	Very high	97	Very high	29 Å²	29	46.7 Å²	46.7	20%	0.203	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.2	147.9	-174.3	176.7	0	0	0	0	110.8	K70 S71 D93 R94	K70-S89 WeakPolarHBondContact O-CB 3.35Å; S71-S89 WeakPolarHBondContact O-CB 3.29Å; S71-S89 PolarHBondContact O-OG 2.82Å; S89-D93 WeakPolarHBondContact CA-O 3.48Å; S89-D93 PolarHBondContact OG-O 2.82Å; S89-R94 PolarHBondContact OG-NH1 2.03Å
90	S	97.2	Very high	97	Very high	73 Å²	73	43.3 Å²	43.3	51%	0.51	28%	0.28	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.8	109	168.7	178.6	0	0	0	0	110	A92 D93	S90-A92 PolarHBondContact O-N 2.91Å; S90-D93 PolarHBondContact N-O 3.23Å; S90-D93 VanDerWaalsContact N-O 3.08Å; S90-D93 WeakPolarHBondContact O-CB 3.32Å; S90-D93 PolarHBondContact O-N 2.85Å
91	G	96.3	Very high	97.1	Very high	55 Å²	55	40.6 Å²	40.6	57%	0.567	25%	0.247	S	C	*	.	T	Hydrogen-bonded Turn	trans	57.5	-120.8	-177.1	0	0	0	0	0	111.8	D93 R94	G91-D93 VanDerWaalsContact C-N 3.29Å; G91-R94 PolarHBondContact O-NH1 3.42Å
92	A	96.7	Very high	97.1	Very high	23 Å²	23	43.2 Å²	43.2	19%	0.19	26%	0.259	C	S	.	.	T	Hydrogen-bonded Turn	trans	-83.3	-1.5	177.4	0	0	0	0	0	113.8	L43 S90	L43-A92 HydrophobicContact CB-CB 4.5Å; L43-A92 WeakPolarHBondContact CB-O 3.36Å; L43-A92 WeakPolarHBondContact CD1-O 3.48Å; L43-A92 PolarHBondContact N-O 2.65Å; L43-A92 WeakPolarHBondContact O-CB 3.3Å; S90-A92 PolarHBondContact O-N 2.91Å
93	D	98	Very high	97	Very high	38 Å²	38	44.6 Å²	44.6	20%	0.203	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	142.7	178.8	-67.7	-19.2	0	0	0	111.9	T40 C41 T42 S89 S90 G91 Y95	T40-D93 HydrophobicContact CG2-CB 4.25Å; C41-D93 WeakPolarHBondContact O-CA 2.99Å; T42-D93 WeakPolarHBondContact CB-OD1 3.49Å; T42-D93 WeakPolarHBondContact CG2-OD1 2.99Å; T42-D93 PolarHBondContact OG1-OD1 2.9Å; S89-D93 WeakPolarHBondContact CA-O 3.48Å; S89-D93 PolarHBondContact OG-O 2.82Å; S90-D93 PolarHBondContact N-O 3.23Å; S90-D93 VanDerWaalsContact N-O 3.08Å; S90-D93 WeakPolarHBondContact O-CB 3.32Å; S90-D93 PolarHBondContact O-N 2.85Å; G91-D93 VanDerWaalsContact C-N 3.29Å; D93-Y95 HydrophobicContact CB-CE1 3.75Å; D93-Y95 HydrophobicContact CB-CE2 3.95Å; D93-Y95 VanDerWaalsContact CB-OH 3.28Å; D93-Y95 WeakPolarHBondContact CB-OH 3.33Å; D93-Y95 PolarHBondContact OD2-OH 2.97Å
94	R	97.9	Very high	96.9	Very high	0 Å²	0	43 Å²	43	0%	0	26%	0.261	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	134.3	165	-60.4	-67	-179.6	-81.6	-11.7	108.3	C41 L43 S48 Y50 I52 S71 S89 G91	C41-R94 PolarHBondContact N-O 3.2Å; C41-R94 PolarHBondContact O-N 2.86Å; L43-R94 HydrophobicContact CD1-CG 3.67Å; S48-R94 PolarHBondContact O-NH2 2.7Å; Y50-R94 PolarHBondContact O-NE 3.5Å; Y50-R94 PolarHBondContact O-NH2 2.94Å; I52-R94 HydrophobicContact CB-CB 4.02Å; I52-R94 HydrophobicContact CB-CG 3.78Å; I52-R94 HydrophobicContact CG1-CB 4.09Å; I52-R94 HydrophobicContact CG1-CG 3.53Å; I52-R94 HydrophobicContact CG2-CB 4.31Å; S71-R94 VanDerWaalsContact CA-CZ 3.47Å; S71-R94 VanDerWaalsContact CA-NH2 3.32Å; S71-R94 VanDerWaalsContact CB-NH2 3.3Å; S89-R94 PolarHBondContact OG-NH1 2.03Å; G91-R94 PolarHBondContact O-NH1 3.42Å
95	Y	98.4	Very high	96.8	Very high	28 Å²	28	41.4 Å²	41.4	11%	0.11	26%	0.255	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.5	139.1	-176.8	-51.2	-71.4	0	0	0	111.4	K38 L39 T40 G87 S88 D93	K38-Y95 HydrophobicContact CD-CD1 3.88Å; K38-Y95 HydrophobicContact CD-CG 3.91Å; K38-Y95 HydrophobicContact CG-CD1 4.11Å; K38-Y95 HydrophobicContact CG-CG 4.25Å; L39-Y95 WeakPolarHBondContact O-CA 3.01Å; T40-Y95 HydrophobicContact CG2-CD1 3.89Å; T40-Y95 HydrophobicContact CG2-CE1 3.55Å; T40-Y95 WeakPolarHBondContact OG1-CD1 3.28Å; T40-Y95 WeakPolarHBondContact OG1-CE1 3.33Å; G87-Y95 WeakPolarHBondContact CA-O 3.43Å; S88-Y95 PolarHBondContact N-O 2.79Å; S88-Y95 VanDerWaalsContact N-O 3.08Å; S88-Y95 PolarHBondContact O-N 2.95Å; S88-Y95 WeakPolarHBondContact OG-CB 3.36Å; D93-Y95 HydrophobicContact CB-CE1 3.75Å; D93-Y95 HydrophobicContact CB-CE2 3.95Å; D93-Y95 VanDerWaalsContact CB-OH 3.28Å; D93-Y95 WeakPolarHBondContact CB-OH 3.33Å; D93-Y95 PolarHBondContact OD2-OH 2.97Å
96	L	98.4	Very high	96.7	Very high	0 Å²	0	49.2 Å²	49.2	0%	0	29%	0.292	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	115	165.2	179.6	63.4	0	0	0	108.2	K38 L39 W54 I66 M67 F85 F98 Y109	K38-L96 CarbonylContact C-O 3.57Å; K38-L96 WeakPolarHBondContact CA-O 3.34Å; L39-L96 HydrophobicContact CB-CB 4.39Å; L39-L96 PolarHBondContact N-O 3.25Å; L39-L96 PolarHBondContact O-N 2.95Å; W54-L96 HydrophobicContact CB-CD2 4.06Å; W54-L96 HydrophobicContact CD2-CB 3.68Å; W54-L96 HydrophobicContact CD2-CD2 3.92Å; W54-L96 HydrophobicContact CD2-CG 4.38Å; W54-L96 HydrophobicContact CE3-CB 4.11Å; W54-L96 HydrophobicContact CE3-CD2 3.93Å; W54-L96 HydrophobicContact CG-CB 4.06Å; W54-L96 HydrophobicContact CG-CD1 4.49Å; W54-L96 HydrophobicContact CG-CD2 3.99Å; W54-L96 HydrophobicContact CG-CG 4.43Å; W54-L96 HydrophobicContact CH2-CB 4.31Å; W54-L96 HydrophobicContact CZ2-CB 3.91Å; W54-L96 HydrophobicContact CZ3-CB 4.4Å; I66-L96 HydrophobicContact CD1-CD2 3.78Å; I66-L96 HydrophobicContact CG2-CD1 4.27Å; M67-L96 HydrophobicContact CG-CD1 4.05Å; M67-L96 HydrophobicContact SD-CD1 3.2Å; M67-L96 WeakPolarHBondContact SD-CD1 3.45Å; F85-L96 HydrophobicContact CD1-CD1 4.2Å; L96-F98 HydrophobicContact CB-CZ 4.49Å; L96-F98 HydrophobicContact CD1-CE1 4.38Å; L96-F98 HydrophobicContact CD2-CD1 4.46Å; L96-F98 HydrophobicContact CD2-CE1 3.41Å; L96-F98 VanDerWaalsContact CD2-CE1 3.41Å; L96-F98 HydrophobicContact CD2-CZ 3.62Å; L96-F98 HydrophobicContact CG-CD1 4.26Å; L96-F98 HydrophobicContact CG-CE1 3.55Å; L96-F98 HydrophobicContact CG-CE2 4.5Å; L96-F98 HydrophobicContact CG-CZ 3.7Å; L96-Y109 HydrophobicContact CD2-CD1 3.88Å; L96-Y109 HydrophobicContact CD2-CE1 4.16Å
97	T	97.8	Very high	96.6	Very high	37 Å²	37	45.6 Å²	45.6	23%	0.227	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.9	135.6	179.4	-52.9	0	0	0	0	109.6	I37 F85 M86	I37-T97 WeakPolarHBondContact O-CA 3.47Å; F85-T97 CarbonylContact C-O 3.48Å; F85-T97 WeakPolarHBondContact CA-O 3.49Å; M86-T97 PolarHBondContact N-O 2.64Å; M86-T97 PolarHBondContact O-N 3.39Å
98	F	94.3	Very high	96.6	Very high	3 Å²	3	50.9 Å²	50.9	1%	0.013	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	127	173.9	-15.5	-110.9	0	0	0	107.4	S36 I37 L39 R84 F85 L96 Y109	S36-F98 WeakPolarHBondContact CA-O 3.16Å; I37-F98 HydrophobicContact CB-CD2 4.31Å; I37-F98 HydrophobicContact CG2-CD2 3.25Å; I37-F98 HydrophobicContact CG2-CE2 3.64Å; I37-F98 HydrophobicContact CG2-CG 4.28Å; I37-F98 PolarHBondContact N-O 3Å; I37-F98 VanDerWaalsContact O-CD2 3.23Å; I37-F98 WeakPolarHBondContact O-CD2 3.32Å; I37-F98 PolarHBondContact O-N 3.13Å; L39-F98 HydrophobicContact CD1-CE2 4.13Å; L39-F98 HydrophobicContact CD1-CZ 3.61Å; L39-F98 HydrophobicContact CD2-CE2 4.33Å; L39-F98 HydrophobicContact CG-CE2 3.71Å; L39-F98 HydrophobicContact CG-CZ 3.71Å; R84-F98 WeakPolarHBondContact O-CA 3.49Å; F85-F98 AromaticContact CD1-CD1 3.41Å; F85-F98 HydrophobicContact CD1-CD1 3.41Å; F85-F98 VanDerWaalsContact CD1-CD1 3.41Å; F85-F98 AromaticContact CD1-CE1 3.79Å; F85-F98 HydrophobicContact CD1-CE1 3.79Å; F85-F98 HydrophobicContact CD2-CD1 4.44Å; F85-F98 AromaticContact CE1-CD1 3.28Å; F85-F98 HydrophobicContact CE1-CD1 3.28Å; F85-F98 AromaticContact CE1-CE1 3.5Å; F85-F98 HydrophobicContact CE1-CE1 3.5Å; F85-F98 VanDerWaalsContact CE1-CE1 3.5Å; F85-F98 HydrophobicContact CE2-CD1 4.31Å; F85-F98 HydrophobicContact CG-CD1 4.01Å; F85-F98 AromaticContact CZ-CD1 3.74Å; F85-F98 HydrophobicContact CZ-CD1 3.74Å; F85-F98 HydrophobicContact CZ-CE1 4.25Å; L96-F98 HydrophobicContact CB-CZ 4.49Å; L96-F98 HydrophobicContact CD1-CE1 4.38Å; L96-F98 HydrophobicContact CD2-CD1 4.46Å; L96-F98 HydrophobicContact CD2-CE1 3.41Å; L96-F98 VanDerWaalsContact CD2-CE1 3.41Å; L96-F98 HydrophobicContact CD2-CZ 3.62Å; L96-F98 HydrophobicContact CG-CD1 4.26Å; L96-F98 HydrophobicContact CG-CE1 3.55Å; L96-F98 HydrophobicContact CG-CE2 4.5Å; L96-F98 HydrophobicContact CG-CZ 3.7Å; F98-Y109 HydrophobicContact CE1-CD1 4.32Å; F98-Y109 AromaticContact CE1-CE1 3.64Å; F98-Y109 HydrophobicContact CE1-CE1 3.64Å; F98-Y109 AromaticContact CE1-CZ 3.93Å; F98-Y109 HydrophobicContact CZ-CD1 4.31Å; F98-Y109 AromaticContact CZ-CE1 3.95Å; F98-Y109 HydrophobicContact CZ-CE1 3.95Å
99	S	96.6	Very high	96.6	Very high	51 Å²	51	50.3 Å²	50.3	36%	0.357	29%	0.293	S	S	.	.	S	Bend	trans	-89.2	152.6	168.7	52.2	0	0	0	0	109.9	R84	R84-S99 WeakPolarHBondContact CA-OG 3.29Å; R84-S99 VanDerWaalsContact CB-O 3.29Å; R84-S99 WeakPolarHBondContact CB-O 3.32Å; R84-S99 WeakPolarHBondContact CD-O 3.28Å; R84-S99 PolarHBondContact O-N 2.98Å; R84-S99 PolarHBondContact O-OG 3.13Å
100	N	96.6	Very high	96.6	Very high	90 Å²	90	52.4 Å²	52.4	48%	0.481	30%	0.299	S	S	.	.	S	Bend	trans	53.6	58.3	177	-171.1	37.2	0	0	0	113.3	G34 A35 Q102	G34-N100 WeakPolarHBondContact CA-OD1 3.44Å; A35-N100 PolarHBondContact O-N 3.12Å; N100-Q102 VanDerWaalsContact O-CG 3.31Å; N100-Q102 WeakPolarHBondContact O-CG 3.43Å; N100-Q102 PolarHBondContact O-N 3.13Å
101	L	96.6	Very high	96.6	Very high	24 Å²	24	49.7 Å²	49.7	13%	0.126	28%	0.28	C	S	.	.			trans	-51.3	129.6	-177.7	-176.5	66.1	0	0	0	111.9	A31 L33 G34 A35 I37 D105	A31-L101 HydrophobicContact CB-CD2 4.01Å; L33-L101 WeakPolarHBondContact CA-O 3.34Å; G34-L101 PolarHBondContact N-O 2.86Å; A35-L101 WeakPolarHBondContact O-CB 3.44Å; A35-L101 PolarHBondContact O-N 2.9Å; I37-L101 HydrophobicContact CG2-CD1 3.8Å; I37-L101 HydrophobicContact CG2-CD2 4.14Å; I37-L101 HydrophobicContact CG2-CG 4.41Å; L101-D105 HydrophobicContact CD1-CB 3.61Å
102	Q	96.4	Very high	96.5	Very high	75 Å²	75	48 Å²	48	35%	0.35	26%	0.263	S	S	.	.			trans	-110.2	160.5	-178.8	-54.8	-174.3	-19.9	0	0	111	N100 D104 D105	N100-Q102 VanDerWaalsContact O-CG 3.31Å; N100-Q102 WeakPolarHBondContact O-CG 3.43Å; N100-Q102 PolarHBondContact O-N 3.13Å; Q102-D104 PolarHBondContact O-N 3.35Å; Q102-D105 PolarHBondContact N-OD2 3.39Å; Q102-D105 WeakPolarHBondContact O-CB 3.27Å; Q102-D105 PolarHBondContact O-N 3.44Å; Q102-D105 VanDerWaalsContact O-N 3.13Å
103	S	94.1	Very high	96.4	Very high	79 Å²	79	49 Å²	49	55%	0.552	26%	0.263	S	S	*	.	G	3₁₀ helix	trans	-57.9	-34.4	174.9	50.7	0	0	0	0	112.3	D105 E106	S103-D105 PolarHBondContact O-N 3.47Å; S103-E106 WeakPolarHBondContact O-CB 3.3Å; S103-E106 PolarHBondContact O-N 2.81Å
104	D	92.9	Very high	95.9	Very high	100 Å²	100	47.8 Å²	47.8	54%	0.535	26%	0.258	S	S	.	.	G	3₁₀ helix	trans	-73.6	-8.8	-177.6	-64.8	5.1	0	0	0	113.5	R58 Q102 E106	R58-D104 PolarHBondContact NE-O 3.46Å; R58-D104 PolarHBondContact NH2-O 3.45Å; Q102-D104 PolarHBondContact O-N 3.35Å; D104-E106 VanDerWaalsContact C-N 3.33Å
105	D	95.1	Very high	94.7	Very high	5 Å²	5	53.5 Å²	53.5	3%	0.027	29%	0.285	C	S	.	.	G	3₁₀ helix	trans	-84.6	-8.2	175.7	-65.3	-35.1	0	0	0	112.4	R84 L101 Q102 S103 A107 Y109	R84-D105 IonicContact CZ-OD1 3.49Å; R84-D105 IonicContact CZ-OD2 2.92Å; R84-D105 IonicContact NE-OD1 3.02Å; R84-D105 IonicContact NE-OD2 2.66Å; R84-D105 PolarHBondContact NE-OD2 2.76Å; R84-D105 VanDerWaalsContact NH2-CG 3.31Å; R84-D105 IonicContact NH2-OD1 3.21Å; R84-D105 PolarHBondContact NH2-OD1 2.84Å; R84-D105 IonicContact NH2-OD2 3.56Å; R84-D105 PolarHBondContact NH2-OD2 2.81Å; L101-D105 HydrophobicContact CD1-CB 3.61Å; Q102-D105 PolarHBondContact N-OD2 3.39Å; Q102-D105 WeakPolarHBondContact O-CB 3.27Å; Q102-D105 PolarHBondContact O-N 3.44Å; Q102-D105 VanDerWaalsContact O-N 3.13Å; S103-D105 PolarHBondContact O-N 3.47Å; D105-A107 PolarHBondContact O-N 3.03Å; D105-A107 VanDerWaalsContact O-N 3.16Å; D105-Y109 VanDerWaalsContact O-CE2 3.3Å; D105-Y109 WeakPolarHBondContact O-CE2 3.44Å; D105-Y109 PolarHBondContact O-OH 3.13Å
106	E	95.3	Very high	92.8	Very high	168 Å²	168	57.4 Å²	57.4	79%	0.785	31%	0.312	S	S	*	.			trans	-68	110	174	-169.8	176.8	168.7	0	0	110.4	S103 D104	S103-E106 WeakPolarHBondContact O-CB 3.3Å; S103-E106 PolarHBondContact O-N 2.81Å; D104-E106 VanDerWaalsContact C-N 3.33Å
107	A	96.4	Very high	90.6	Very high	28 Å²	28	63.3 Å²	63.3	23%	0.231	34%	0.342	C	S	.	.	S	Bend	trans	-164.6	169.5	-174.8	0	0	0	0	0	110.5	Q56 Q57 R58 D105 Y109	Q56-A107 HydrophobicContact CG-CB 3.45Å; Q56-A107 VanDerWaalsContact CG-CB 3.45Å; Q57-A107 WeakPolarHBondContact O-CB 3.47Å; R58-A107 HydrophobicContact CG-CB 4.1Å; D105-A107 PolarHBondContact O-N 3.03Å; D105-A107 VanDerWaalsContact O-N 3.16Å; A107-Y109 HydrophobicContact CB-CD2 4.46Å; A107-Y109 HydrophobicContact CB-CE2 3.95Å; A107-Y109 WeakPolarHBondContact O-CD2 3.47Å
108	E	97.3	Very high	88	Confident	118 Å²	118	69.7 Å²	69.7	55%	0.551	38%	0.375	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.1	139.1	161.1	-65.8	179.3	-171.1	0	0	109.5	Q57 H110	Q57-E108 HydrophobicContact CB-CB 4.28Å; Q57-E108 PolarHBondContact N-O 3.34Å; Q57-E108 PolarHBondContact O-N 2.84Å; E108-H110 IonicContact OE2-CE1 3.2Å; E108-H110 IonicContact OE2-NE2 3.68Å; E108-H110 PolarHBondContact OE2-NE2 3.31Å
109	Y	97.8	Very high	85.7	Confident	32 Å²	32	73.1 Å²	73.1	13%	0.125	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	123.3	178	-71.3	-95.4	0	0	0	109.8	Q25 L39 Y55 Q56 I66 F85 L96 F98 D105 A107	Q25-Y109 PolarHBondContact NE2-O 2.86Å; L39-Y109 VanDerWaalsContact CD1-CB 3.41Å; L39-Y109 HydrophobicContact CD1-CD1 3.98Å; L39-Y109 HydrophobicContact CD1-CD2 3.79Å; L39-Y109 HydrophobicContact CD1-CG 3.45Å; L39-Y109 VanDerWaalsContact CD1-CG 3.45Å; Y55-Y109 VanDerWaalsContact O-CA 3.32Å; Y55-Y109 WeakPolarHBondContact O-CA 3.39Å; Q56-Y109 HydrophobicContact CB-CD1 4.46Å; Q56-Y109 HydrophobicContact CB-CE1 4.18Å; Q56-Y109 HydrophobicContact CG-CD1 4.44Å; Q56-Y109 HydrophobicContact CG-CE1 3.9Å; Q56-Y109 PolarHBondContact NE2-OH 3.38Å; I66-Y109 HydrophobicContact CD1-CD1 3.59Å; I66-Y109 HydrophobicContact CD1-CE1 3.54Å; F85-Y109 HydrophobicContact CE1-CE1 4.46Å; L96-Y109 HydrophobicContact CD2-CD1 3.88Å; L96-Y109 HydrophobicContact CD2-CE1 4.16Å; F98-Y109 HydrophobicContact CE1-CD1 4.32Å; F98-Y109 AromaticContact CE1-CE1 3.64Å; F98-Y109 HydrophobicContact CE1-CE1 3.64Å; F98-Y109 AromaticContact CE1-CZ 3.93Å; F98-Y109 HydrophobicContact CZ-CD1 4.31Å; F98-Y109 AromaticContact CZ-CE1 3.95Å; F98-Y109 HydrophobicContact CZ-CE1 3.95Å; D105-Y109 VanDerWaalsContact O-CE2 3.3Å; D105-Y109 WeakPolarHBondContact O-CE2 3.44Å; D105-Y109 PolarHBondContact O-OH 3.13Å; A107-Y109 HydrophobicContact CB-CD2 4.46Å; A107-Y109 HydrophobicContact CB-CE2 3.95Å; A107-Y109 WeakPolarHBondContact O-CD2 3.47Å
110	H	97.4	Very high	82.7	Confident	73 Å²	73	78.3 Å²	78.3	34%	0.338	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.8	136.4	-176	-61.7	-66.9	0	0	0	109.8	Y55 Q57 E108	Y55-H110 PolarHBondContact N-O 2.82Å; Y55-H110 PolarHBondContact O-N 2.87Å; Q57-H110 PolarHBondContact OE1-NE2 3.41Å; E108-H110 IonicContact OE2-CE1 3.2Å; E108-H110 IonicContact OE2-NE2 3.68Å; E108-H110 PolarHBondContact OE2-NE2 3.31Å
111	C	97.4	Very high	80.2	Confident	16 Å²	16	79 Å²	79	11%	0.108	44%	0.436	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	141.4	169.4	69.3	0	0	0	0	111.3	L23 Q25 C41 I52 E53 W54	L23-C111 WeakPolarHBondContact CD1-O 3.47Å; Q25-C111 VanDerWaalsContact CG-SG 3.53Å; Q25-C111 PolarHBondContact OE1-SG 3.29Å; C41-C111 HydrophobicContact CB-CB 3.48Å; C41-C111 VanDerWaalsContact CB-CB 3.48Å; C41-C111 WeakPolarHBondContact CB-SG 3.46Å; C41-C111 WeakPolarHBondContact SG-CB 3.36Å; C41-C111 CovalentContact SG-SG 2.03Å; C41-C111 PolarHBondContact SG-SG 3.49Å; I52-C111 HydrophobicContact CG2-CB 3.63Å; E53-C111 CarbonylContact O-C 3.57Å; E53-C111 VanDerWaalsContact O-CA 3.28Å; E53-C111 WeakPolarHBondContact O-CA 3.35Å; W54-C111 HydrophobicContact CD2-CB 4.38Å; W54-C111 HydrophobicContact CE3-CB 4.22Å; W54-C111 HydrophobicContact CH2-CB 4.32Å; W54-C111 HydrophobicContact CZ2-CB 4.46Å; W54-C111 HydrophobicContact CZ3-CB 4.19Å
112	G	96	Very high	77.3	Confident	21 Å²	21	82.2 Å²	82.2	22%	0.216	48%	0.476	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.3	152.6	175.6	0	0	0	0	0	111.1	I52 E53	I52-G112 CarbonylContact C-O 3.58Å; I52-G112 VanDerWaalsContact CA-O 3.3Å; I52-G112 WeakPolarHBondContact CA-O 3.45Å; I52-G112 WeakPolarHBondContact CD1-O 3.43Å; E53-G112 PolarHBondContact N-O 2.91Å; E53-G112 PolarHBondContact O-N 3.1Å
113	E	93.6	Very high	76.3	Confident	42 Å²	42	82.6 Å²	82.6	20%	0.196	48%	0.482	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73	133.5	169.1	-174	-128.4	149.2	0	0	110	Y50 H115	Y50-E113 HydrophobicContact CD2-CG 3.69Å; Y50-E113 HydrophobicContact CE2-CG 4.42Å; Y50-E113 HydrophobicContact CG-CG 4.37Å; E113-H115 PolarHBondContact O-N 3.15Å; E113-H115 IonicContact OE1-ND1 3.03Å; E113-H115 PolarHBondContact OE1-ND1 3.02Å; E113-H115 IonicContact OE2-CE1 2.84Å; E113-H115 PolarHBondContact OE2-CE1 2.88Å; E113-H115 IonicContact OE2-ND1 3.76Å; E113-H115 PolarHBondContact OE2-ND1 2.93Å; E113-H115 IonicContact OE2-NE2 3.82Å
114	S	88.3	Confident	75.4	Confident	14 Å²	14	82.7 Å²	82.7	10%	0.098	48%	0.478	C	S	.	.			trans	-75.7	105.1	171.4	-167.3	0	0	0	0	109.5	T51 E53 T116	T51-S114 PolarHBondContact O-N 2.95Å; E53-S114 VanDerWaalsContact OE1-CB 3.29Å; E53-S114 WeakPolarHBondContact OE1-CB 3.42Å; E53-S114 PolarHBondContact OE1-OG 2.97Å; S114-T116 PolarHBondContact O-N 2.84Å
115	H	72.5	Confident	74.4	Confident	120 Å²	120	81.8 Å²	81.8	56%	0.556	48%	0.475	S	S	*	.			trans	-77.4	120.6	172.5	-67.3	-57.4	0	0	0	110	E113 I117	E113-H115 PolarHBondContact O-N 3.15Å; E113-H115 IonicContact OE1-ND1 3.03Å; E113-H115 PolarHBondContact OE1-ND1 3.02Å; E113-H115 IonicContact OE2-CE1 2.84Å; E113-H115 PolarHBondContact OE2-CE1 2.88Å; E113-H115 IonicContact OE2-ND1 3.76Å; E113-H115 PolarHBondContact OE2-ND1 2.93Å; E113-H115 IonicContact OE2-NE2 3.82Å; H115-I117 PolarHBondContact O-N 3.04Å
116	T	57.7	Low	73.2	Confident	109 Å²	109	86.3 Å²	86.3	67%	0.669	50%	0.501	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.9	102.4	165.3	-53.2	0	0	0	0	108.4	S114 D118	S114-T116 PolarHBondContact O-N 2.84Å; T116-D118 PolarHBondContact O-N 3.07Å
117	I	53.1	Low	71.8	Confident	125 Å²	125	81.2 Å²	81.2	64%	0.641	48%	0.484	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.8	97.8	167.6	-57.4	175.5	0	0	0	106.2	H115 G119 Q120	H115-I117 PolarHBondContact O-N 3.04Å; I117-G119 VanDerWaalsContact C-N 3.35Å; I117-G119 PolarHBondContact O-N 3.29Å; I117-Q120 PolarHBondContact N-O 3.24Å; I117-Q120 PolarHBondContact O-N 3.27Å
118	D	41.8	Very low	70.2	Confident	170 Å²	170	84.7 Å²	84.7	91%	0.909	50%	0.5	S	S	*	.	T	Hydrogen-bonded Turn	trans	20.3	65.8	165.4	-135.8	7.6	0	0	0	115.6	T116	T116-D118 PolarHBondContact O-N 3.07Å
119	G	47.3	Very low	68.3	Low	75 Å²	75	82.4 Å²	82.4	77%	0.773	50%	0.497	S	S	*	.	T	Hydrogen-bonded Turn	trans	99.2	-1.3	176.2	0	0	0	0	0	117.9	I117	I117-G119 VanDerWaalsContact C-N 3.35Å; I117-G119 PolarHBondContact O-N 3.29Å
120	Q	34	Very low	66	Low	161 Å²	161	86.2 Å²	86.2	75%	0.752	53%	0.525	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-128.4	122.2	170.1	-73.8	179.2	-88	0	0	110.6	I117 G122	I117-Q120 PolarHBondContact N-O 3.24Å; I117-Q120 PolarHBondContact O-N 3.27Å; Q120-G122 PolarHBondContact O-N 3.32Å
121	V	43.1	Very low	63.4	Low	103 Å²	103	87.3 Å²	87.3	62%	0.624	54%	0.541	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.5	113.6	170.3	-179.1	0	0	0	0	106.7
122	G	36	Very low	60.3	Low	92 Å²	92	93.8 Å²	93.8	95%	0.948	58%	0.58	S	S	*	*			trans	-85.1	0	167.4	0	0	0	0	0	111.3	Q120	Q120-G122 PolarHBondContact O-N 3.32Å

Retrieved 122 of 122 residues in 64.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).