A0A075B6P7_HUMAN Loading...

KAT8 regulatory NSL complex subunit 3

AlphaFold DB , UniProt , Accession A0A075B6P7, Species HUMAN (Homo sapiens, Human), Gene KANSL3, Length 93 aa.

						>A0A075B6P7_HUMAN|A0A075B6P7|KANSL3
SESDVPIDVETVTSTPMPLYDNQKARSVMNECERHVIFARTDADAPPPPEDWEEHVNRVSLCHPDCSAVARSQLTTSLDLQDSVSLWTTTLLL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	S	53.8	Low	70.4	Confident	166 Å²	166	137.1 Å²	137.1	100%	1.161	79%	0.786	S	S	*	*				0	133.4	0	33.6	0	0	0	0	106.7
2	E	61.5	Low	70.6	Confident	174 Å²	174	136.8 Å²	136.8	81%	0.813	79%	0.788	S	S	*	*			cis	-174	127.4	4.9	-173.4	174.8	119.5	0	0	102.7
3	S	58.4	Low	70.9	Confident	113 Å²	113	136.2 Å²	136.2	79%	0.79	79%	0.788	S	S	*	*			trans	-148.6	66.5	158.3	9.1	0	0	0	0	106.5	V5	S3-V5 VanDerWaalsContact C-N 3.26Å; S3-V5 PolarHBondContact O-N 3.32Å; S3-V5 VanDerWaalsContact O-N 3.09Å
4	D	66.3	Low	70.7	Confident	146 Å²	146	133.7 Å²	133.7	78%	0.781	78%	0.783	S	S	*	*			trans	-71.3	92	161.5	-151.8	-77.7	0	0	0	105.6	P6	D4-P6 VanDerWaalsContact O-CD 3.29Å; D4-P6 WeakPolarHBondContact O-CD 3.29Å
5	V	77.6	Confident	71.1	Confident	112 Å²	112	133.8 Å²	133.8	68%	0.679	79%	0.786	S	S	*	*			trans	-75.4	114.7	177.5	179.5	0	0	0	0	106.2	S3 I7	S3-V5 VanDerWaalsContact C-N 3.26Å; S3-V5 PolarHBondContact O-N 3.32Å; S3-V5 VanDerWaalsContact O-N 3.09Å; V5-I7 PolarHBondContact O-N 3.07Å
6	P	71.7	Confident	71	Confident	113 Å²	113	132.4 Å²	132.4	73%	0.734	78%	0.782	S	S	*	*			trans	-64.7	115.5	179.9	25.5	-32.1	0	0	0	108.8	D4 D8	D4-P6 VanDerWaalsContact O-CD 3.29Å; D4-P6 WeakPolarHBondContact O-CD 3.29Å; P6-D8 PolarHBondContact O-N 3.09Å
7	I	76.2	Confident	71	Confident	148 Å²	148	134.8 Å²	134.8	76%	0.759	79%	0.786	S	S	*	*			trans	-73.1	115	173.2	-62.7	171.4	0	0	0	106.7	V5 V9	V5-I7 PolarHBondContact O-N 3.07Å; I7-V9 HydrophobicContact CG2-CG2 4.44Å; I7-V9 PolarHBondContact O-N 3.16Å; I7-V9 VanDerWaalsContact O-N 3.12Å
8	D	78.7	Confident	70.9	Confident	139 Å²	139	131.7 Å²	131.7	74%	0.743	77%	0.771	S	S	*	*			trans	-71	103.9	172.6	-171	20.4	0	0	0	108.8	P6 E10	P6-D8 PolarHBondContact O-N 3.09Å; D8-E10 PolarHBondContact O-N 3.12Å; D8-E10 VanDerWaalsContact O-N 3.16Å
9	V	77.2	Confident	71	Confident	110 Å²	110	134.7 Å²	134.7	67%	0.667	78%	0.782	S	S	*	*			trans	-82.7	89.2	177.3	-177.9	0	0	0	0	107.4	I7 T11	I7-V9 HydrophobicContact CG2-CG2 4.44Å; I7-V9 PolarHBondContact O-N 3.16Å; I7-V9 VanDerWaalsContact O-N 3.12Å; V9-T11 PolarHBondContact O-N 3.05Å
10	E	76.6	Confident	71.2	Confident	165 Å²	165	134.8 Å²	134.8	77%	0.771	77%	0.77	S	S	*	*			trans	-60.6	113.1	167.5	-78	-164.8	142.4	0	0	108.8	D8 V12	D8-E10 PolarHBondContact O-N 3.12Å; D8-E10 VanDerWaalsContact O-N 3.16Å; E10-V12 PolarHBondContact O-N 2.9Å
11	T	76.2	Confident	72	Confident	122 Å²	122	133 Å²	133	75%	0.748	76%	0.758	S	S	*	*			trans	-74.8	109.6	179.1	-52.3	0	0	0	0	108	V9 T13	V9-T11 PolarHBondContact O-N 3.05Å; T11-T13 PolarHBondContact O-N 3.17Å
12	V	73.2	Confident	73.5	Confident	133 Å²	133	128.8 Å²	128.8	81%	0.806	72%	0.723	S	S	*	*			trans	-66	98.5	174.4	-178.6	0	0	0	0	108.3	E10 S14	E10-V12 PolarHBondContact O-N 2.9Å; V12-S14 PolarHBondContact O-N 3.08Å; V12-S14 VanDerWaalsContact O-N 3.08Å
13	T	74.1	Confident	74.9	Confident	130 Å²	130	127.5 Å²	127.5	80%	0.798	72%	0.717	S	S	*	*			trans	-66.9	106.9	170.5	-18.1	0	0	0	0	107.7	T11 T15	T11-T13 PolarHBondContact O-N 3.17Å; T13-T15 PolarHBondContact O-N 3.33Å
14	S	69.1	Low	76.3	Confident	101 Å²	101	129.1 Å²	129.1	71%	0.706	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-61.5	128.1	174.3	39.1	0	0	0	0	109.3	V12 P16	V12-S14 PolarHBondContact O-N 3.08Å; V12-S14 VanDerWaalsContact O-N 3.08Å; S14-P16 VanDerWaalsContact O-CD 3.29Å; S14-P16 WeakPolarHBondContact O-CD 3.29Å; S14-P16 VanDerWaalsContact O-N 3.13Å
15	T	75.9	Confident	77.3	Confident	135 Å²	135	124 Å²	124	83%	0.828	69%	0.688	S	S	*	*	P	Polyproline II helix	trans	-60	117.9	175	-46.7	0	0	0	0	108.2	T13 M17	T13-T15 PolarHBondContact O-N 3.33Å; T15-M17 PolarHBondContact O-N 3.24Å
16	P	69.3	Low	77.9	Confident	112 Å²	112	127.2 Å²	127.2	73%	0.727	69%	0.687	S	S	*	*	P	Polyproline II helix	trans	-62.1	126.9	-178.6	22.3	-30.5	0	0	0	109	S14	S14-P16 VanDerWaalsContact O-CD 3.29Å; S14-P16 WeakPolarHBondContact O-CD 3.29Å; S14-P16 VanDerWaalsContact O-N 3.13Å
17	M	70.9	Confident	78.8	Confident	172 Å²	172	125.2 Å²	125.2	85%	0.847	68%	0.676	S	S	*	*	P	Polyproline II helix	trans	-62	131.4	178.4	-158.2	171.4	-176.1	0	0	108.3	T15 L19	T15-M17 PolarHBondContact O-N 3.24Å; M17-L19 PolarHBondContact O-N 3.23Å
18	P	70.3	Confident	79.5	Confident	79 Å²	79	122.2 Å²	122.2	51%	0.513	66%	0.664	S	S	.	*	P	Polyproline II helix	trans	-52.5	131.1	177.2	-25.2	33.2	0	0	0	110	Y20	P18-Y20 PolarHBondContact O-N 3.41Å
19	L	72.8	Confident	80	Confident	189 Å²	189	121.8 Å²	121.8	99%	0.99	66%	0.66	S	S	*	*	S	Bend	trans	-62.4	-12.1	-177.4	-68.1	174.1	0	0	0	113.4	M17	M17-L19 PolarHBondContact O-N 3.23Å
20	Y	74.9	Confident	80.6	Confident	136 Å²	136	121.3 Å²	121.3	53%	0.533	65%	0.653	S	S	.	*	S	Bend	trans	-119.6	141.6	172.2	88	-89.8	0	0	0	110.8	P18 N22 A25	P18-Y20 PolarHBondContact O-N 3.41Å; Y20-N22 HydrophobicContact CE2-CB 4.35Å; Y20-N22 WeakPolarHBondContact CE2-OD1 3.47Å; Y20-N22 VanDerWaalsContact CZ-OD1 3.24Å; Y20-N22 PolarHBondContact O-N 3.17Å; Y20-N22 PolarHBondContact OH-OD1 3Å; Y20-A25 HydrophobicContact CD2-CB 3.98Å; Y20-A25 HydrophobicContact CE2-CB 3.73Å
21	D	87.6	Confident	81.3	Confident	99 Å²	99	117.2 Å²	117.2	53%	0.529	63%	0.634	S	S	.	*			trans	-77.5	111.5	175.9	-177.3	-14	0	0	0	109.7	Q23 K24 A25	D21-Q23 PolarHBondContact O-N 2.69Å; D21-Q23 WeakPolarHBondContact OD1-CA 3.43Å; D21-Q23 WeakPolarHBondContact OD1-CB 3.4Å; D21-Q23 PolarHBondContact OD1-N 3.31Å; D21-K24 HydrophobicContact CB-CB 3.83Å; D21-K24 PolarHBondContact O-N 3.39Å; D21-K24 VanDerWaalsContact O-N 3.17Å; D21-K24 PolarHBondContact OD1-N 2.97Å; D21-A25 PolarHBondContact O-N 2.75Å
22	N	86.2	Confident	81.7	Confident	77 Å²	77	114.5 Å²	114.5	41%	0.412	62%	0.62	S	S	.	*	H	α-helix	trans	-59.6	-31.9	177	-81.8	-80.7	0	0	0	112.8	Y20 R26	Y20-N22 HydrophobicContact CE2-CB 4.35Å; Y20-N22 WeakPolarHBondContact CE2-OD1 3.47Å; Y20-N22 VanDerWaalsContact CZ-OD1 3.24Å; Y20-N22 PolarHBondContact O-N 3.17Å; Y20-N22 PolarHBondContact OH-OD1 3Å; N22-R26 WeakPolarHBondContact O-CD 3.34Å; N22-R26 WeakPolarHBondContact O-CG 3.43Å; N22-R26 PolarHBondContact O-N 2.96Å; N22-R26 VanDerWaalsContact O-N 3.07Å
23	Q	89.9	Confident	82.1	Confident	147 Å²	147	114.1 Å²	114.1	69%	0.687	61%	0.609	S	S	*	*	H	α-helix	trans	-70.4	-42.4	177	-171.8	154.9	0.3	0	0	110.8	D21 A25 R26 S27	D21-Q23 PolarHBondContact O-N 2.69Å; D21-Q23 WeakPolarHBondContact OD1-CA 3.43Å; D21-Q23 WeakPolarHBondContact OD1-CB 3.4Å; D21-Q23 PolarHBondContact OD1-N 3.31Å; Q23-A25 PolarHBondContact O-N 3.38Å; Q23-R26 PolarHBondContact O-N 3.1Å; Q23-S27 PolarHBondContact O-N 3.25Å; Q23-S27 PolarHBondContact O-OG 3.49Å
24	K	87.1	Confident	82.6	Confident	147 Å²	147	114 Å²	114	64%	0.639	59%	0.594	S	S	*	*	H	α-helix	trans	-63	-42.8	175.4	-166.1	175.1	-176.8	-177.8	0	112	D21 R26 S27 V28	D21-K24 HydrophobicContact CB-CB 3.83Å; D21-K24 PolarHBondContact O-N 3.39Å; D21-K24 VanDerWaalsContact O-N 3.17Å; D21-K24 PolarHBondContact OD1-N 2.97Å; K24-R26 VanDerWaalsContact C-N 3.32Å; K24-R26 PolarHBondContact O-N 3.37Å; K24-S27 PolarHBondContact O-N 3.48Å; K24-V28 WeakPolarHBondContact O-CG2 3.31Å; K24-V28 PolarHBondContact O-N 3.32Å; K24-V28 VanDerWaalsContact O-N 3.1Å
25	A	88.8	Confident	83.1	Confident	39 Å²	39	112.3 Å²	112.3	32%	0.322	57%	0.574	S	S	.	*	H	α-helix	trans	-60.3	-42.3	175.4	0	0	0	0	0	111.9	Y20 D21 Q23 V28 M29	Y20-A25 HydrophobicContact CD2-CB 3.98Å; Y20-A25 HydrophobicContact CE2-CB 3.73Å; D21-A25 PolarHBondContact O-N 2.75Å; Q23-A25 PolarHBondContact O-N 3.38Å; A25-V28 PolarHBondContact O-N 3.04Å; A25-M29 WeakPolarHBondContact O-CG 3.44Å; A25-M29 PolarHBondContact O-N 3.03Å; A25-M29 VanDerWaalsContact O-N 3.1Å
26	R	88.8	Confident	82.9	Confident	178 Å²	178	109 Å²	109	67%	0.672	55%	0.554	S	S	*	*	H	α-helix	trans	-64.2	-41.8	176.1	-72.6	170.5	65.5	120.4	6.2	112.5	N22 Q23 K24 V28 M29 N30	N22-R26 WeakPolarHBondContact O-CD 3.34Å; N22-R26 WeakPolarHBondContact O-CG 3.43Å; N22-R26 PolarHBondContact O-N 2.96Å; N22-R26 VanDerWaalsContact O-N 3.07Å; Q23-R26 PolarHBondContact O-N 3.1Å; K24-R26 VanDerWaalsContact C-N 3.32Å; K24-R26 PolarHBondContact O-N 3.37Å; R26-V28 VanDerWaalsContact C-N 3.31Å; R26-V28 PolarHBondContact O-N 3.44Å; R26-M29 PolarHBondContact O-N 2.98Å; R26-N30 PolarHBondContact O-N 3.1Å; R26-N30 PolarHBondContact O-OD1 3.07Å
27	S	92	Very high	83.1	Confident	72 Å²	72	108 Å²	108	50%	0.503	54%	0.542	S	S	.	.	H	α-helix	trans	-60.6	-41.1	176.7	-66.6	0	0	0	0	112.3	Q23 K24 N30 E31	Q23-S27 PolarHBondContact O-N 3.25Å; Q23-S27 PolarHBondContact O-OG 3.49Å; K24-S27 PolarHBondContact O-N 3.48Å; S27-N30 PolarHBondContact O-N 3.28Å; S27-E31 PolarHBondContact O-N 3.17Å; S27-E31 VanDerWaalsContact O-N 3.13Å
28	V	89.9	Confident	82.7	Confident	84 Å²	84	103.6 Å²	103.6	51%	0.509	52%	0.518	S	S	.	.	H	α-helix	trans	-63.8	-46.7	176.2	173.8	0	0	0	0	110.9	K24 A25 R26 N30 E31 C32	K24-V28 WeakPolarHBondContact O-CG2 3.31Å; K24-V28 PolarHBondContact O-N 3.32Å; K24-V28 VanDerWaalsContact O-N 3.1Å; A25-V28 PolarHBondContact O-N 3.04Å; R26-V28 VanDerWaalsContact C-N 3.31Å; R26-V28 PolarHBondContact O-N 3.44Å; V28-N30 VanDerWaalsContact C-N 3.34Å; V28-N30 PolarHBondContact O-N 3.32Å; V28-E31 PolarHBondContact O-N 2.77Å; V28-C32 PolarHBondContact O-N 2.86Å; V28-C32 PolarHBondContact O-SG 3.42Å; V28-C32 VanDerWaalsContact O-SG 3.33Å
29	M	89.9	Confident	82.4	Confident	131 Å²	131	102 Å²	102	65%	0.645	51%	0.511	S	S	*	.	H	α-helix	trans	-60.9	-41.5	179	-69.9	-62.4	-65.3	0	0	112.6	A25 R26 E31 C32 E33	A25-M29 WeakPolarHBondContact O-CG 3.44Å; A25-M29 PolarHBondContact O-N 3.03Å; A25-M29 VanDerWaalsContact O-N 3.1Å; R26-M29 PolarHBondContact O-N 2.98Å; M29-E31 VanDerWaalsContact C-N 3.3Å; M29-E31 PolarHBondContact O-N 3.3Å; M29-C32 PolarHBondContact O-N 3.32Å; M29-E33 PolarHBondContact O-N 2.89Å
30	N	90.1	Very high	81.8	Confident	100 Å²	100	101.5 Å²	101.5	54%	0.535	50%	0.496	S	S	.	.	H	α-helix	trans	-64.3	-37.3	177.7	-68.8	0.7	0	0	0	111.9	R26 S27 V28 E33 R34	R26-N30 PolarHBondContact O-N 3.1Å; R26-N30 PolarHBondContact O-OD1 3.07Å; S27-N30 PolarHBondContact O-N 3.28Å; V28-N30 VanDerWaalsContact C-N 3.34Å; V28-N30 PolarHBondContact O-N 3.32Å; N30-E33 PolarHBondContact O-N 2.94Å; N30-R34 PolarHBondContact O-N 3.33Å; N30-R34 VanDerWaalsContact O-N 3.09Å
31	E	89.6	Confident	81.2	Confident	79 Å²	79	99.7 Å²	99.7	37%	0.369	50%	0.499	S	S	.	.	H	α-helix	trans	-71.4	-36.7	177.2	-175.9	59.1	-166.1	0	0	111.7	S27 V28 M29 E33 R34 H35	S27-E31 PolarHBondContact O-N 3.17Å; S27-E31 VanDerWaalsContact O-N 3.13Å; V28-E31 PolarHBondContact O-N 2.77Å; M29-E31 VanDerWaalsContact C-N 3.3Å; M29-E31 PolarHBondContact O-N 3.3Å; E31-E33 VanDerWaalsContact C-N 3.33Å; E31-R34 PolarHBondContact O-N 3.41Å; E31-R34 IonicContact OE1-CZ 3.94Å; E31-R34 IonicContact OE1-NE 3.03Å; E31-R34 PolarHBondContact OE1-NE 2.71Å; E31-R34 IonicContact OE1-NH2 3.34Å; E31-R34 PolarHBondContact OE1-NH2 3.02Å; E31-R34 IonicContact OE2-CZ 3.12Å; E31-R34 IonicContact OE2-NE 3.97Å; E31-R34 PolarHBondContact OE2-NE 2.83Å; E31-R34 IonicContact OE2-NH2 2.67Å; E31-H35 PolarHBondContact O-N 2.99Å; E31-H35 VanDerWaalsContact O-N 3.13Å; E31-H35 PolarHBondContact O-ND1 2.95Å; E31-H35 IonicContact OE1-CE1 2.89Å; E31-H35 PolarHBondContact OE1-CE1 3.45Å; E31-H35 IonicContact OE1-ND1 3.59Å; E31-H35 IonicContact OE1-NE2 3.54Å
32	C	84.7	Confident	79.6	Confident	65 Å²	65	99.6 Å²	99.6	44%	0.439	50%	0.499	S	S	.	.	H	α-helix	trans	-61.6	-41.8	171.6	-68.2	0	0	0	0	111.7	V28 M29 R34 H35 V36	V28-C32 PolarHBondContact O-N 2.86Å; V28-C32 PolarHBondContact O-SG 3.42Å; V28-C32 VanDerWaalsContact O-SG 3.33Å; M29-C32 PolarHBondContact O-N 3.32Å; C32-R34 PolarHBondContact O-N 3.29Å; C32-H35 PolarHBondContact O-N 2.95Å; C32-V36 WeakPolarHBondContact O-CG2 3.46Å; C32-V36 PolarHBondContact O-N 3.46Å
33	E	82.3	Confident	78.3	Confident	124 Å²	124	100 Å²	100	58%	0.579	51%	0.513	S	S	*	.	H	α-helix	trans	-60.8	-44.6	175.9	-176	175.2	-162.2	0	0	111.6	M29 N30 E31 H35 V36 I37	M29-E33 PolarHBondContact O-N 2.89Å; N30-E33 PolarHBondContact O-N 2.94Å; E31-E33 VanDerWaalsContact C-N 3.33Å; E33-H35 VanDerWaalsContact C-N 3.3Å; E33-H35 PolarHBondContact O-N 3.29Å; E33-V36 PolarHBondContact O-N 3.19Å; E33-I37 HydrophobicContact CG-CD1 3.99Å; E33-I37 WeakPolarHBondContact O-CG1 3.33Å; E33-I37 PolarHBondContact O-N 3.13Å
34	R	84.4	Confident	76.6	Confident	129 Å²	129	100.2 Å²	100.2	49%	0.487	52%	0.519	S	S	.	.	H	α-helix	trans	-58	-41.5	176.6	-164.6	-170	66.8	70.7	2.7	112.2	N30 E31 C32 F38	N30-R34 PolarHBondContact O-N 3.33Å; N30-R34 VanDerWaalsContact O-N 3.09Å; E31-R34 PolarHBondContact O-N 3.41Å; E31-R34 IonicContact OE1-CZ 3.94Å; E31-R34 IonicContact OE1-NE 3.03Å; E31-R34 PolarHBondContact OE1-NE 2.71Å; E31-R34 IonicContact OE1-NH2 3.34Å; E31-R34 PolarHBondContact OE1-NH2 3.02Å; E31-R34 IonicContact OE2-CZ 3.12Å; E31-R34 IonicContact OE2-NE 3.97Å; E31-R34 PolarHBondContact OE2-NE 2.83Å; E31-R34 IonicContact OE2-NH2 2.67Å; C32-R34 PolarHBondContact O-N 3.29Å; R34-F38 PolarHBondContact O-N 3.4Å
35	H	79.3	Confident	75.2	Confident	64 Å²	64	95.3 Å²	95.3	30%	0.296	51%	0.506	S	S	.	.	H	α-helix	trans	-68.9	-41.4	177.2	-72.8	113.2	0	0	0	113.1	E31 C32 E33 I37 F38 A39	E31-H35 PolarHBondContact O-N 2.99Å; E31-H35 VanDerWaalsContact O-N 3.13Å; E31-H35 PolarHBondContact O-ND1 2.95Å; E31-H35 IonicContact OE1-CE1 2.89Å; E31-H35 PolarHBondContact OE1-CE1 3.45Å; E31-H35 IonicContact OE1-ND1 3.59Å; E31-H35 IonicContact OE1-NE2 3.54Å; C32-H35 PolarHBondContact O-N 2.95Å; E33-H35 VanDerWaalsContact C-N 3.3Å; E33-H35 PolarHBondContact O-N 3.29Å; H35-I37 VanDerWaalsContact C-N 3.33Å; H35-I37 PolarHBondContact O-N 3.49Å; H35-F38 PolarHBondContact O-N 3.01Å; H35-A39 PolarHBondContact O-N 3.3Å
36	V	73.1	Confident	73.8	Confident	65 Å²	65	98.7 Å²	98.7	39%	0.394	52%	0.524	S	S	.	.	H	α-helix	trans	-62.9	-40.7	177.9	169	0	0	0	0	111.3	C32 E33 F38 A39 R40	C32-V36 WeakPolarHBondContact O-CG2 3.46Å; C32-V36 PolarHBondContact O-N 3.46Å; E33-V36 PolarHBondContact O-N 3.19Å; V36-F38 VanDerWaalsContact C-N 3.34Å; V36-A39 PolarHBondContact O-N 3.49Å; V36-R40 HydrophobicContact CG1-CG 4.35Å; V36-R40 VanDerWaalsContact CG1-CZ 3.47Å; V36-R40 WeakPolarHBondContact O-CB 3.37Å; V36-R40 VanDerWaalsContact O-CG 3.28Å; V36-R40 WeakPolarHBondContact O-CG 3.41Å; V36-R40 PolarHBondContact O-N 3.24Å
37	I	72.9	Confident	72.4	Confident	92 Å²	92	95.5 Å²	95.5	47%	0.472	53%	0.527	S	S	.	.	H	α-helix	trans	-63.1	-43.8	177.1	-67.6	165.9	0	0	0	110.5	E33 H35 R40 T41	E33-I37 HydrophobicContact CG-CD1 3.99Å; E33-I37 WeakPolarHBondContact O-CG1 3.33Å; E33-I37 PolarHBondContact O-N 3.13Å; H35-I37 VanDerWaalsContact C-N 3.33Å; H35-I37 PolarHBondContact O-N 3.49Å; I37-R40 PolarHBondContact O-N 3.43Å; I37-T41 WeakPolarHBondContact O-CB 3.5Å; I37-T41 PolarHBondContact O-N 2.95Å; I37-T41 PolarHBondContact O-OG1 2.95Å
38	F	62.9	Low	70.7	Confident	80 Å²	80	96.8 Å²	96.8	35%	0.351	53%	0.534	S	S	.	.	H	α-helix	trans	-61.2	-49.8	177.1	-175.4	-100.7	0	0	0	111.6	R34 H35 V36 R40 T41 D42 Q73	R34-F38 PolarHBondContact O-N 3.4Å; H35-F38 PolarHBondContact O-N 3.01Å; V36-F38 VanDerWaalsContact C-N 3.34Å; F38-R40 PolarHBondContact O-N 3.23Å; F38-T41 PolarHBondContact O-N 2.71Å; F38-D42 PolarHBondContact O-N 2.94Å; F38-Q73 VanDerWaalsContact CE2-NE2 3.32Å
39	A	62.9	Low	69.3	Low	45 Å²	45	96.6 Å²	96.6	37%	0.372	53%	0.534	S	S	.	.	H	α-helix	trans	-64	-36	179.4	0	0	0	0	0	113.4	H35 V36 D42 A43	H35-A39 PolarHBondContact O-N 3.3Å; V36-A39 PolarHBondContact O-N 3.49Å; A39-D42 PolarHBondContact O-N 2.99Å; A39-A43 WeakPolarHBondContact O-CB 3.22Å; A39-A43 PolarHBondContact O-N 3.3Å
40	R	60.1	Low	67.9	Low	179 Å²	179	99.2 Å²	99.2	68%	0.675	55%	0.545	S	S	*	.	H	α-helix	trans	-68.8	-38.5	175.4	-75.8	176.2	177.8	165.6	1.3	112.4	V36 I37 F38 D42 A43 D44	V36-R40 HydrophobicContact CG1-CG 4.35Å; V36-R40 VanDerWaalsContact CG1-CZ 3.47Å; V36-R40 WeakPolarHBondContact O-CB 3.37Å; V36-R40 VanDerWaalsContact O-CG 3.28Å; V36-R40 WeakPolarHBondContact O-CG 3.41Å; V36-R40 PolarHBondContact O-N 3.24Å; I37-R40 PolarHBondContact O-N 3.43Å; F38-R40 PolarHBondContact O-N 3.23Å; R40-D42 VanDerWaalsContact C-N 3.26Å; R40-D42 PolarHBondContact O-N 3.39Å; R40-A43 PolarHBondContact O-N 2.96Å; R40-D44 PolarHBondContact O-N 3.42Å; R40-D44 VanDerWaalsContact O-N 3.08Å
41	T	62.2	Low	66.5	Low	97 Å²	97	99 Å²	99	60%	0.595	54%	0.543	S	S	*	.	H	α-helix	trans	-66	-34.1	176.4	-52.3	0	0	0	0	111	I37 F38 A45	I37-T41 WeakPolarHBondContact O-CB 3.5Å; I37-T41 PolarHBondContact O-N 2.95Å; I37-T41 PolarHBondContact O-OG1 2.95Å; F38-T41 PolarHBondContact O-N 2.71Å; T41-A45 PolarHBondContact O-N 2.96Å
42	D	55.3	Low	65.1	Low	97 Å²	97	101.2 Å²	101.2	52%	0.519	55%	0.548	S	S	.	.	H	α-helix	trans	-71.4	-37.7	173.9	-161.4	53.5	0	0	0	112.3	F38 A39 R40 A45	F38-D42 PolarHBondContact O-N 2.94Å; A39-D42 PolarHBondContact O-N 2.99Å; R40-D42 VanDerWaalsContact C-N 3.26Å; R40-D42 PolarHBondContact O-N 3.39Å; D42-A45 VanDerWaalsContact O-CB 3.22Å; D42-A45 WeakPolarHBondContact O-CB 3.2Å; D42-A45 PolarHBondContact O-N 3Å
43	A	57.8	Low	63.9	Low	87 Å²	87	104 Å²	104	72%	0.719	56%	0.555	S	S	*	*	H	α-helix	trans	-73	-25.4	178.5	0	0	0	0	0	114.4	A39 R40 A45	A39-A43 WeakPolarHBondContact O-CB 3.22Å; A39-A43 PolarHBondContact O-N 3.3Å; R40-A43 PolarHBondContact O-N 2.96Å; A43-A45 VanDerWaalsContact C-N 3.33Å
44	D	55.3	Low	62.8	Low	150 Å²	150	104.1 Å²	104.1	80%	0.802	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.1	-1.1	173.6	-138.9	-21.4	0	0	0	111.8	R40	R40-D44 PolarHBondContact O-N 3.42Å; R40-D44 VanDerWaalsContact O-N 3.08Å
45	A	56	Low	61.4	Low	44 Å²	44	102.8 Å²	102.8	36%	0.364	56%	0.555	S	S	.	*	S	Bend	trans	-69.7	141.8	170.6	0	0	0	0	0	109	T41 D42 A43	T41-A45 PolarHBondContact O-N 2.96Å; D42-A45 VanDerWaalsContact O-CB 3.22Å; D42-A45 WeakPolarHBondContact O-CB 3.2Å; D42-A45 PolarHBondContact O-N 3Å; A43-A45 VanDerWaalsContact C-N 3.33Å
46	P	60.6	Low	60.3	Low	110 Å²	110	102.6 Å²	102.6	71%	0.714	56%	0.558	S	S	*	*	P	Polyproline II helix	trans	-52.9	140.8	169.8	22.4	-30.9	0	0	0	108.6
47	P	58.3	Low	59.3	Low	111 Å²	111	104.9 Å²	104.9	72%	0.721	57%	0.568	S	S	*	*	P	Polyproline II helix	trans	-48.6	135.3	177.6	19.8	-31.3	0	0	0	108.3	P49	P47-P49 VanDerWaalsContact O-N 3.15Å
48	P	56.7	Low	58.4	Low	100 Å²	100	108.6 Å²	108.6	65%	0.649	58%	0.576	S	S	*	*	P	Polyproline II helix	trans	-52.3	128.6	-176.8	18.9	-29.6	0	0	0	107.9	E50	P48-E50 PolarHBondContact O-N 3.46Å
49	P	60.3	Low	57.9	Low	80 Å²	80	107 Å²	107	52%	0.519	57%	0.573	S	S	.	*	P	Polyproline II helix	trans	-54.4	145.2	-178.5	18	-28.9	0	0	0	109.9	P47 D51 W52	P47-P49 VanDerWaalsContact O-N 3.15Å; P49-D51 PolarHBondContact O-N 2.86Å; P49-W52 WeakPolarHBondContact O-CB 3.41Å; P49-W52 PolarHBondContact O-N 3.28Å
50	E	60.2	Low	57.3	Low	185 Å²	185	108.4 Å²	108.4	86%	0.864	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.6	-24.7	-177.6	-144.1	83.3	-160.1	0	0	112.5	P48 W52	P48-E50 PolarHBondContact O-N 3.46Å; E50-W52 PolarHBondContact O-N 2.89Å
51	D	61.1	Low	56.9	Low	95 Å²	95	107 Å²	107	51%	0.508	59%	0.585	S	S	.	*	T	Hydrogen-bonded Turn	trans	-91.2	27.3	177.8	-52.3	-46.6	0	0	0	114.1	P49 E53 E54 H55	P49-D51 PolarHBondContact O-N 2.86Å; D51-E53 VanDerWaalsContact C-N 3.25Å; D51-E53 PolarHBondContact O-N 3.4Å; D51-E54 HydrophobicContact CB-CB 4.35Å; D51-E54 PolarHBondContact O-N 2.94Å; D51-E54 VanDerWaalsContact O-N 3.12Å; D51-H55 PolarHBondContact O-N 3.04Å; D51-H55 PolarHBondContact O-ND1 2.67Å
52	W	60.9	Low	56.5	Low	126 Å²	126	106.6 Å²	106.6	48%	0.477	59%	0.585	S	S	.	*	H	α-helix	trans	-59.8	-35.1	179.8	70.7	-85.6	0	0	0	112.2	P49 E50 E54 H55 V56	P49-W52 WeakPolarHBondContact O-CB 3.41Å; P49-W52 PolarHBondContact O-N 3.28Å; E50-W52 PolarHBondContact O-N 2.89Å; W52-E54 VanDerWaalsContact C-N 3.33Å; W52-E54 PolarHBondContact O-N 3.47Å; W52-H55 PolarHBondContact O-N 3.25Å; W52-V56 HydrophobicContact CE3-CG2 4.15Å; W52-V56 VanDerWaalsContact O-CG2 3.29Å; W52-V56 WeakPolarHBondContact O-CG2 3.45Å; W52-V56 PolarHBondContact O-N 3.19Å
53	E	58.6	Low	56.2	Low	125 Å²	125	107.8 Å²	107.8	58%	0.584	59%	0.587	S	S	*	*	H	α-helix	trans	-63.9	-38.2	175.1	-69.9	-172	126.6	0	0	111.9	D51 N57	D51-E53 VanDerWaalsContact C-N 3.25Å; D51-E53 PolarHBondContact O-N 3.4Å; E53-N57 WeakPolarHBondContact O-CB 3.45Å; E53-N57 PolarHBondContact O-N 3.46Å; E53-N57 PolarHBondContact O-ND2 3.22Å
54	E	59.1	Low	56.2	Low	126 Å²	126	108.2 Å²	108.2	59%	0.589	58%	0.583	S	S	*	*	H	α-helix	trans	-72.1	-35.2	176.7	-148.1	-179.2	-159.7	0	0	110.8	D51 W52 N57 R58	D51-E54 HydrophobicContact CB-CB 4.35Å; D51-E54 PolarHBondContact O-N 2.94Å; D51-E54 VanDerWaalsContact O-N 3.12Å; W52-E54 VanDerWaalsContact C-N 3.33Å; W52-E54 PolarHBondContact O-N 3.47Å; E54-N57 CarbonylContact O-C 3.56Å; E54-N57 PolarHBondContact O-N 2.85Å; E54-R58 WeakPolarHBondContact O-CB 3.32Å; E54-R58 VanDerWaalsContact O-CG 3.3Å; E54-R58 WeakPolarHBondContact O-CG 3.4Å; E54-R58 PolarHBondContact O-N 3.23Å
55	H	56.1	Low	56	Low	101 Å²	101	106 Å²	106	47%	0.468	57%	0.571	S	S	.	*	H	α-helix	trans	-68.8	-40.5	174	-83.5	81.2	0	0	0	113.2	D51 W52 N57 R58 V59	D51-H55 PolarHBondContact O-N 3.04Å; D51-H55 PolarHBondContact O-ND1 2.67Å; W52-H55 PolarHBondContact O-N 3.25Å; H55-N57 VanDerWaalsContact C-N 3.31Å; H55-R58 CarbonylContact O-C 3.53Å; H55-R58 PolarHBondContact O-N 3.35Å; H55-R58 VanDerWaalsContact O-N 3.1Å; H55-V59 VanDerWaalsContact O-CG2 3.28Å; H55-V59 WeakPolarHBondContact O-CG2 3.46Å; H55-V59 PolarHBondContact O-N 3.13Å
56	V	56.1	Low	55.7	Low	60 Å²	60	107.1 Å²	107.1	36%	0.364	58%	0.575	S	S	.	*	H	α-helix	trans	-64.9	-38.9	173.8	176.1	0	0	0	0	110.5	W52 R58 V59 S60	W52-V56 HydrophobicContact CE3-CG2 4.15Å; W52-V56 VanDerWaalsContact O-CG2 3.29Å; W52-V56 WeakPolarHBondContact O-CG2 3.45Å; W52-V56 PolarHBondContact O-N 3.19Å; V56-R58 VanDerWaalsContact C-N 3.25Å; V56-R58 PolarHBondContact O-N 3.35Å; V56-V59 PolarHBondContact O-N 3.09Å; V56-S60 PolarHBondContact O-N 3.03Å; V56-S60 VanDerWaalsContact O-N 3.1Å
57	N	51.9	Low	55.3	Low	113 Å²	113	103.6 Å²	103.6	60%	0.604	55%	0.553	S	S	*	*	H	α-helix	trans	-68.1	-19.3	172.2	-81.7	-43.9	0	0	0	113.9	E53 E54 H55 S60	E53-N57 WeakPolarHBondContact O-CB 3.45Å; E53-N57 PolarHBondContact O-N 3.46Å; E53-N57 PolarHBondContact O-ND2 3.22Å; E54-N57 CarbonylContact O-C 3.56Å; E54-N57 PolarHBondContact O-N 2.85Å; H55-N57 VanDerWaalsContact C-N 3.31Å; N57-S60 VanDerWaalsContact C-OG 3.29Å; N57-S60 PolarHBondContact O-OG 3.41Å
58	R	53.2	Low	55.3	Low	170 Å²	170	100.9 Å²	100.9	64%	0.642	54%	0.54	S	S	*	.	H	α-helix	trans	-92.1	-28.5	171	-73.4	-173.7	71.2	178.8	1.4	113.1	E54 H55 V56 S60 L61 C62	E54-R58 WeakPolarHBondContact O-CB 3.32Å; E54-R58 VanDerWaalsContact O-CG 3.3Å; E54-R58 WeakPolarHBondContact O-CG 3.4Å; E54-R58 PolarHBondContact O-N 3.23Å; H55-R58 CarbonylContact O-C 3.53Å; H55-R58 PolarHBondContact O-N 3.35Å; H55-R58 VanDerWaalsContact O-N 3.1Å; V56-R58 VanDerWaalsContact C-N 3.25Å; V56-R58 PolarHBondContact O-N 3.35Å; R58-S60 VanDerWaalsContact C-N 3.32Å; R58-L61 WeakPolarHBondContact O-CB 3.23Å; R58-L61 PolarHBondContact O-N 3.36Å; R58-L61 VanDerWaalsContact O-N 3.09Å; R58-C62 PolarHBondContact O-N 3.29Å
59	V	53.4	Low	55.3	Low	47 Å²	47	100.5 Å²	100.5	29%	0.285	54%	0.536	S	S	.	.	H	α-helix	trans	-68.6	-31.8	173	168.1	0	0	0	0	111.1	H55 V56 L61 C62 C66	H55-V59 VanDerWaalsContact O-CG2 3.28Å; H55-V59 WeakPolarHBondContact O-CG2 3.46Å; H55-V59 PolarHBondContact O-N 3.13Å; V56-V59 PolarHBondContact O-N 3.09Å; V59-L61 PolarHBondContact O-N 2.93Å; V59-C62 CarbonylContact O-C 3.52Å; V59-C62 PolarHBondContact O-N 3.05Å; V59-C66 HydrophobicContact CG1-CB 3.9Å
60	S	49.7	Very low	55.2	Low	74 Å²	74	98.2 Å²	98.2	52%	0.517	52%	0.524	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.6	-18.2	169.2	57.3	0	0	0	0	113.5	V56 N57 R58	V56-S60 PolarHBondContact O-N 3.03Å; V56-S60 VanDerWaalsContact O-N 3.1Å; N57-S60 VanDerWaalsContact C-OG 3.29Å; N57-S60 PolarHBondContact O-OG 3.41Å; R58-S60 VanDerWaalsContact C-N 3.32Å
61	L	51.3	Low	55.1	Low	150 Å²	150	98.4 Å²	98.4	79%	0.785	52%	0.517	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.3	-14	171	-64	166.5	0	0	0	113.3	R58 V59	R58-L61 WeakPolarHBondContact O-CB 3.23Å; R58-L61 PolarHBondContact O-N 3.36Å; R58-L61 VanDerWaalsContact O-N 3.09Å; V59-L61 PolarHBondContact O-N 2.93Å
62	C	54.3	Low	55.2	Low	87 Å²	87	96.8 Å²	96.8	59%	0.588	51%	0.513	S	S	*	.	S	Bend	trans	-108.5	86	-177.1	-123.7	0	0	0	0	110.2	R58 V59 C66	R58-C62 PolarHBondContact O-N 3.29Å; V59-C62 CarbonylContact O-C 3.52Å; V59-C62 PolarHBondContact O-N 3.05Å; C62-C66 WeakPolarHBondContact O-CB 3.45Å
63	H	49.3	Very low	55.2	Low	122 Å²	122	94.9 Å²	94.9	57%	0.565	51%	0.509	S	S	*	.			trans	61.9	127.2	174.2	-149.1	-104.2	0	0	0	115.5	D65 C66	H63-D65 IonicContact CE1-OD2 2.99Å; H63-D65 PolarHBondContact CE1-OD2 3.02Å; H63-D65 IonicContact ND1-OD2 3.19Å; H63-D65 PolarHBondContact ND1-OD2 3.27Å; H63-D65 VanDerWaalsContact ND1-OD2 3.12Å; H63-D65 PolarHBondContact O-N 3.36Å; H63-C66 PolarHBondContact O-N 3.38Å; H63-C66 VanDerWaalsContact O-N 3.08Å
64	P	57.1	Low	55.2	Low	96 Å²	96	93 Å²	93	62%	0.623	50%	0.503	S	S	*	.	H	α-helix	trans	-50.9	-34.4	-177.8	-25.9	32.9	0	0	0	114	S67 A68	P64-S67 PolarHBondContact O-N 3.31Å; P64-S67 PolarHBondContact O-OG 3.24Å; P64-A68 PolarHBondContact O-N 3.34Å
65	D	52.6	Low	55.4	Low	103 Å²	103	90.3 Å²	90.3	55%	0.551	50%	0.495	S	S	*	.	H	α-helix	trans	-70	-32.6	-177.2	-59.1	-35.4	0	0	0	114.1	H63 A68 V69	H63-D65 IonicContact CE1-OD2 2.99Å; H63-D65 PolarHBondContact CE1-OD2 3.02Å; H63-D65 IonicContact ND1-OD2 3.19Å; H63-D65 PolarHBondContact ND1-OD2 3.27Å; H63-D65 VanDerWaalsContact ND1-OD2 3.12Å; H63-D65 PolarHBondContact O-N 3.36Å; D65-A68 PolarHBondContact O-N 3.08Å; D65-V69 WeakPolarHBondContact O-CG2 3.44Å; D65-V69 PolarHBondContact O-N 3.48Å; D65-V69 VanDerWaalsContact O-N 3.09Å
66	C	48.7	Very low	55.8	Low	68 Å²	68	88.4 Å²	88.4	46%	0.459	49%	0.491	S	S	.	.	H	α-helix	trans	-70.4	-34.8	177.5	-75.4	0	0	0	0	111.7	V59 C62 H63 A68 V69 A70	V59-C66 HydrophobicContact CG1-CB 3.9Å; C62-C66 WeakPolarHBondContact O-CB 3.45Å; H63-C66 PolarHBondContact O-N 3.38Å; H63-C66 VanDerWaalsContact O-N 3.08Å; C66-A68 VanDerWaalsContact C-N 3.33Å; C66-V69 PolarHBondContact O-N 3.04Å; C66-A70 WeakPolarHBondContact O-CB 3.39Å; C66-A70 PolarHBondContact O-N 2.75Å
67	S	53.4	Low	56	Low	36 Å²	36	88.1 Å²	88.1	25%	0.252	49%	0.492	S	S	.	.	H	α-helix	trans	-66.6	-36.4	175.4	78.6	0	0	0	0	112	P64 R71	P64-S67 PolarHBondContact O-N 3.31Å; P64-S67 PolarHBondContact O-OG 3.24Å; S67-R71 WeakPolarHBondContact O-CB 3.49Å; S67-R71 WeakPolarHBondContact O-CG 3.5Å; S67-R71 PolarHBondContact O-N 3.23Å
68	A	57.2	Low	56.7	Low	55 Å²	55	88.2 Å²	88.2	46%	0.455	49%	0.491	S	S	.	.	H	α-helix	trans	-67.9	-43.1	176.4	0	0	0	0	0	111.3	P64 D65 C66 R71 S72	P64-A68 PolarHBondContact O-N 3.34Å; D65-A68 PolarHBondContact O-N 3.08Å; C66-A68 VanDerWaalsContact C-N 3.33Å; A68-R71 PolarHBondContact O-N 3.02Å; A68-S72 VanDerWaalsContact O-CB 3.23Å; A68-S72 WeakPolarHBondContact O-CB 3.46Å; A68-S72 PolarHBondContact O-N 2.98Å
69	V	57.6	Low	57.3	Low	91 Å²	91	84.6 Å²	84.6	55%	0.552	49%	0.485	S	S	*	.	H	α-helix	trans	-62.6	-50.3	175.1	174	0	0	0	0	110.6	D65 C66 R71 S72 Q73	D65-V69 WeakPolarHBondContact O-CG2 3.44Å; D65-V69 PolarHBondContact O-N 3.48Å; D65-V69 VanDerWaalsContact O-N 3.09Å; C66-V69 PolarHBondContact O-N 3.04Å; V69-R71 VanDerWaalsContact C-N 3.33Å; V69-R71 PolarHBondContact O-N 2.99Å; V69-S72 WeakPolarHBondContact O-CB 3.21Å; V69-S72 PolarHBondContact O-N 3.47Å; V69-S72 VanDerWaalsContact O-N 3.13Å; V69-Q73 HydrophobicContact CG1-CG 4.18Å; V69-Q73 WeakPolarHBondContact O-CG 3.3Å; V69-Q73 PolarHBondContact O-N 3.02Å
70	A	57.4	Low	58.1	Low	33 Å²	33	85.8 Å²	85.8	27%	0.273	49%	0.489	S	S	.	.	H	α-helix	trans	-58.8	-42.6	179.2	0	0	0	0	0	112.5	C66 Q73 L74	C66-A70 WeakPolarHBondContact O-CB 3.39Å; C66-A70 PolarHBondContact O-N 2.75Å; A70-Q73 PolarHBondContact O-N 2.75Å; A70-L74 WeakPolarHBondContact O-CG 3.42Å; A70-L74 PolarHBondContact O-N 2.85Å
71	R	58.9	Low	59	Low	188 Å²	188	88.1 Å²	88.1	71%	0.709	49%	0.492	S	S	*	.	H	α-helix	trans	-66.7	-38.6	175.8	-70.6	174.4	72.4	-168.4	2.3	112.4	S67 A68 V69 Q73 L74 T75	S67-R71 WeakPolarHBondContact O-CB 3.49Å; S67-R71 WeakPolarHBondContact O-CG 3.5Å; S67-R71 PolarHBondContact O-N 3.23Å; A68-R71 PolarHBondContact O-N 3.02Å; V69-R71 VanDerWaalsContact C-N 3.33Å; V69-R71 PolarHBondContact O-N 2.99Å; R71-Q73 VanDerWaalsContact C-N 3.33Å; R71-L74 PolarHBondContact O-N 3.36Å; R71-T75 WeakPolarHBondContact O-CG2 3.28Å; R71-T75 PolarHBondContact O-N 2.9Å
72	S	62.3	Low	59.9	Low	62 Å²	62	85.7 Å²	85.7	43%	0.434	48%	0.48	S	S	.	.	H	α-helix	trans	-65.9	-36.1	175.8	-163.3	0	0	0	0	111.7	A68 V69 T75 T76	A68-S72 VanDerWaalsContact O-CB 3.23Å; A68-S72 WeakPolarHBondContact O-CB 3.46Å; A68-S72 PolarHBondContact O-N 2.98Å; V69-S72 WeakPolarHBondContact O-CB 3.21Å; V69-S72 PolarHBondContact O-N 3.47Å; V69-S72 VanDerWaalsContact O-N 3.13Å; S72-T75 VanDerWaalsContact O-CG2 3.29Å; S72-T75 WeakPolarHBondContact O-CG2 3.39Å; S72-T76 WeakPolarHBondContact O-CB 3.34Å; S72-T76 WeakPolarHBondContact O-CG2 3.42Å; S72-T76 PolarHBondContact O-N 3.43Å; S72-T76 VanDerWaalsContact O-N 3.11Å; S72-T76 PolarHBondContact O-OG1 3.5Å
73	Q	60.3	Low	60.5	Low	86 Å²	86	84.1 Å²	84.1	40%	0.402	47%	0.47	S	S	.	.	H	α-helix	trans	-71.5	-42.3	176.4	-64.9	-70.6	83.2	0	0	111.3	F38 V69 A70 R71 T76 S77	F38-Q73 VanDerWaalsContact CE2-NE2 3.32Å; V69-Q73 HydrophobicContact CG1-CG 4.18Å; V69-Q73 WeakPolarHBondContact O-CG 3.3Å; V69-Q73 PolarHBondContact O-N 3.02Å; A70-Q73 PolarHBondContact O-N 2.75Å; R71-Q73 VanDerWaalsContact C-N 3.33Å; Q73-T76 WeakPolarHBondContact CA-OG1 3.36Å; Q73-T76 PolarHBondContact O-OG1 3.11Å; Q73-S77 WeakPolarHBondContact O-CB 3.38Å; Q73-S77 PolarHBondContact O-N 2.93Å
74	L	60	Low	61.6	Low	85 Å²	85	82.1 Å²	82.1	45%	0.445	47%	0.466	S	S	.	.	H	α-helix	trans	-64.1	-46.4	176.7	-72.9	168.7	0	0	0	112	A70 R71 S77 L78	A70-L74 WeakPolarHBondContact O-CG 3.42Å; A70-L74 PolarHBondContact O-N 2.85Å; R71-L74 PolarHBondContact O-N 3.36Å; L74-S77 PolarHBondContact O-N 3.01Å; L74-L78 WeakPolarHBondContact O-CD1 3.22Å; L74-L78 PolarHBondContact O-N 3.48Å
75	T	61.7	Low	62.3	Low	70 Å²	70	79.8 Å²	79.8	43%	0.429	45%	0.452	S	S	.	.	H	α-helix	trans	-63.9	-43.9	178.7	-168.2	0	0	0	0	111.7	R71 S72 S77 L78 D79	R71-T75 WeakPolarHBondContact O-CG2 3.28Å; R71-T75 PolarHBondContact O-N 2.9Å; S72-T75 VanDerWaalsContact O-CG2 3.29Å; S72-T75 WeakPolarHBondContact O-CG2 3.39Å; T75-S77 VanDerWaalsContact C-N 3.3Å; T75-S77 PolarHBondContact O-N 3.34Å; T75-L78 PolarHBondContact O-N 2.87Å; T75-D79 WeakPolarHBondContact O-CB 3.46Å; T75-D79 PolarHBondContact O-N 3.09Å; T75-D79 PolarHBondContact OG1-OD2 3.45Å
76	T	64.8	Low	63.1	Low	60 Å²	60	80.4 Å²	80.4	37%	0.368	45%	0.454	S	S	.	.	H	α-helix	trans	-65.5	-34.6	179.5	50	0	0	0	0	112	S72 Q73 L80	S72-T76 WeakPolarHBondContact O-CB 3.34Å; S72-T76 WeakPolarHBondContact O-CG2 3.42Å; S72-T76 PolarHBondContact O-N 3.43Å; S72-T76 VanDerWaalsContact O-N 3.11Å; S72-T76 PolarHBondContact O-OG1 3.5Å; Q73-T76 WeakPolarHBondContact CA-OG1 3.36Å; Q73-T76 PolarHBondContact O-OG1 3.11Å; T76-L80 VanDerWaalsContact O-CB 3.3Å; T76-L80 WeakPolarHBondContact O-CB 3.44Å; T76-L80 PolarHBondContact O-N 3.27Å
77	S	61.2	Low	64	Low	55 Å²	55	86.5 Å²	86.5	39%	0.385	47%	0.468	S	S	.	.	H	α-helix	trans	-65.7	-45.6	174.1	-170.7	0	0	0	0	112.3	Q73 L74 T75 L80 Q81	Q73-S77 WeakPolarHBondContact O-CB 3.38Å; Q73-S77 PolarHBondContact O-N 2.93Å; L74-S77 PolarHBondContact O-N 3.01Å; T75-S77 VanDerWaalsContact C-N 3.3Å; T75-S77 PolarHBondContact O-N 3.34Å; S77-L80 PolarHBondContact O-N 2.98Å; S77-Q81 WeakPolarHBondContact O-CB 3.46Å; S77-Q81 PolarHBondContact O-N 3.48Å
78	L	66.3	Low	64.5	Low	114 Å²	114	88.1 Å²	88.1	60%	0.597	48%	0.477	S	S	*	.	H	α-helix	trans	-60.8	-47.2	173.5	-84.7	144.1	0	0	0	112	L74 T75 L80 Q81 D82	L74-L78 WeakPolarHBondContact O-CD1 3.22Å; L74-L78 PolarHBondContact O-N 3.48Å; T75-L78 PolarHBondContact O-N 2.87Å; L78-L80 VanDerWaalsContact C-N 3.32Å; L78-L80 PolarHBondContact O-N 3.13Å; L78-Q81 WeakPolarHBondContact O-CB 3.2Å; L78-Q81 PolarHBondContact O-N 2.94Å; L78-D82 PolarHBondContact O-N 3.12Å
79	D	66.9	Low	65.3	Low	94 Å²	94	89.3 Å²	89.3	50%	0.503	48%	0.478	S	S	.	.	H	α-helix	trans	-62.2	-38	177.8	-75.3	-54.8	0	0	0	112	T75 S83	T75-D79 WeakPolarHBondContact O-CB 3.46Å; T75-D79 PolarHBondContact O-N 3.09Å; T75-D79 PolarHBondContact OG1-OD2 3.45Å; D79-S83 WeakPolarHBondContact O-CB 3.29Å; D79-S83 PolarHBondContact O-N 3.06Å
80	L	69	Low	66.1	Low	72 Å²	72	89.5 Å²	89.5	38%	0.377	48%	0.48	S	S	.	.	H	α-helix	trans	-67.6	-41.4	176.7	-146.9	81.7	0	0	0	110.9	T76 S77 L78 S83 V84	T76-L80 VanDerWaalsContact O-CB 3.3Å; T76-L80 WeakPolarHBondContact O-CB 3.44Å; T76-L80 PolarHBondContact O-N 3.27Å; S77-L80 PolarHBondContact O-N 2.98Å; L78-L80 VanDerWaalsContact C-N 3.32Å; L78-L80 PolarHBondContact O-N 3.13Å; L80-S83 PolarHBondContact O-N 3.33Å; L80-V84 WeakPolarHBondContact O-CB 3.39Å; L80-V84 VanDerWaalsContact O-CG2 3.23Å; L80-V84 WeakPolarHBondContact O-CG2 3.19Å; L80-V84 PolarHBondContact O-N 2.87Å
81	Q	68.3	Low	66.8	Low	123 Å²	123	95.3 Å²	95.3	58%	0.575	51%	0.505	S	S	*	.	H	α-helix	trans	-64.2	-43	177.8	-170.7	68.8	51.5	0	0	111.6	S77 L78 S85	S77-Q81 WeakPolarHBondContact O-CB 3.46Å; S77-Q81 PolarHBondContact O-N 3.48Å; L78-Q81 WeakPolarHBondContact O-CB 3.2Å; L78-Q81 PolarHBondContact O-N 2.94Å; Q81-S85 WeakPolarHBondContact O-CB 3.48Å; Q81-S85 PolarHBondContact O-N 3.43Å; Q81-S85 PolarHBondContact O-OG 3.1Å
82	D	69.9	Low	67.2	Low	99 Å²	99	93.6 Å²	93.6	53%	0.529	51%	0.51	S	S	.	.	H	α-helix	trans	-66.2	-41.9	175.9	-79	-20.3	0	0	0	111.4	L78 S85 L86	L78-D82 PolarHBondContact O-N 3.12Å; D82-S85 PolarHBondContact O-N 3.39Å; D82-L86 WeakPolarHBondContact O-CB 3.38Å; D82-L86 WeakPolarHBondContact O-CD1 3.23Å; D82-L86 WeakPolarHBondContact O-CG 3.16Å; D82-L86 PolarHBondContact O-N 3.1Å
83	S	68.1	Low	67.1	Low	55 Å²	55	100 Å²	100	39%	0.385	54%	0.538	S	S	.	.	H	α-helix	trans	-62.1	-45.9	176.1	-173.7	0	0	0	0	112	D79 L80 S85 L86 W87	D79-S83 WeakPolarHBondContact O-CB 3.29Å; D79-S83 PolarHBondContact O-N 3.06Å; L80-S83 PolarHBondContact O-N 3.33Å; S83-S85 VanDerWaalsContact C-N 3.33Å; S83-S85 PolarHBondContact O-N 3.32Å; S83-L86 PolarHBondContact O-N 2.78Å; S83-W87 WeakPolarHBondContact O-CB 3.49Å; S83-W87 PolarHBondContact O-N 3.37Å
84	V	72.8	Confident	67.4	Low	79 Å²	79	100.8 Å²	100.8	48%	0.479	55%	0.545	S	S	.	.	H	α-helix	trans	-63.6	-39.8	175.8	171.2	0	0	0	0	111.1	L80 W87 T88	L80-V84 WeakPolarHBondContact O-CB 3.39Å; L80-V84 VanDerWaalsContact O-CG2 3.23Å; L80-V84 WeakPolarHBondContact O-CG2 3.19Å; L80-V84 PolarHBondContact O-N 2.87Å; V84-W87 PolarHBondContact O-N 3.19Å; V84-T88 HydrophobicContact CG1-CG2 4.41Å; V84-T88 WeakPolarHBondContact O-CB 3.34Å; V84-T88 WeakPolarHBondContact O-CG2 3.41Å; V84-T88 PolarHBondContact O-N 3.33Å; V84-T88 PolarHBondContact O-OG1 2.75Å
85	S	70.1	Confident	67.8	Low	48 Å²	48	101.6 Å²	101.6	34%	0.336	55%	0.55	S	S	.	*	H	α-helix	trans	-65.3	-40.4	177.2	-58.9	0	0	0	0	111.9	Q81 D82 S83 T88 T89	Q81-S85 WeakPolarHBondContact O-CB 3.48Å; Q81-S85 PolarHBondContact O-N 3.43Å; Q81-S85 PolarHBondContact O-OG 3.1Å; D82-S85 PolarHBondContact O-N 3.39Å; S83-S85 VanDerWaalsContact C-N 3.33Å; S83-S85 PolarHBondContact O-N 3.32Å; S85-T88 WeakPolarHBondContact CA-OG1 3.38Å; S85-T88 PolarHBondContact O-OG1 3.44Å; S85-T89 VanDerWaalsContact O-CB 3.31Å; S85-T89 WeakPolarHBondContact O-CB 3.33Å; S85-T89 PolarHBondContact O-N 3.08Å; S85-T89 PolarHBondContact O-OG1 2.8Å
86	L	71.1	Confident	68.1	Low	115 Å²	115	103.3 Å²	103.3	60%	0.602	56%	0.557	S	S	*	*	H	α-helix	trans	-65.3	-44	175.2	-84.6	157.4	0	0	0	112	D82 S83 T90	D82-L86 WeakPolarHBondContact O-CB 3.38Å; D82-L86 WeakPolarHBondContact O-CD1 3.23Å; D82-L86 WeakPolarHBondContact O-CG 3.16Å; D82-L86 PolarHBondContact O-N 3.1Å; S83-L86 PolarHBondContact O-N 2.78Å; L86-T90 WeakPolarHBondContact O-CB 3.29Å; L86-T90 PolarHBondContact O-N 3.17Å; L86-T90 PolarHBondContact O-OG1 3.34Å
87	W	65.8	Low	68.3	Low	197 Å²	197	105.9 Å²	105.9	75%	0.746	57%	0.568	S	S	*	*	H	α-helix	trans	-64.6	-45.7	178.9	-86.8	57.5	0	0	0	112.3	S83 V84 T90 L91	S83-W87 WeakPolarHBondContact O-CB 3.49Å; S83-W87 PolarHBondContact O-N 3.37Å; V84-W87 PolarHBondContact O-N 3.19Å; W87-T90 PolarHBondContact O-N 3.09Å; W87-L91 WeakPolarHBondContact O-CB 3.28Å; W87-L91 PolarHBondContact O-N 2.94Å
88	T	64.9	Low	68.8	Low	70 Å²	70	109.1 Å²	109.1	43%	0.429	58%	0.579	S	S	.	*	H	α-helix	trans	-65.8	-40.6	178.5	49.5	0	0	0	0	112	V84 S85 L91 L92	V84-T88 HydrophobicContact CG1-CG2 4.41Å; V84-T88 WeakPolarHBondContact O-CB 3.34Å; V84-T88 WeakPolarHBondContact O-CG2 3.41Å; V84-T88 PolarHBondContact O-N 3.33Å; V84-T88 PolarHBondContact O-OG1 2.75Å; S85-T88 WeakPolarHBondContact CA-OG1 3.38Å; S85-T88 PolarHBondContact O-OG1 3.44Å; T88-L91 PolarHBondContact O-N 2.98Å; T88-L92 WeakPolarHBondContact O-CB 3.37Å; T88-L92 WeakPolarHBondContact O-CD1 3.49Å; T88-L92 WeakPolarHBondContact O-CG 3.3Å; T88-L92 PolarHBondContact O-N 3.12Å
89	T	74.4	Confident	69	Low	79 Å²	79	108.7 Å²	108.7	49%	0.485	58%	0.578	S	S	.	*	H	α-helix	trans	-63.9	-41.9	175.5	-55.9	0	0	0	0	111.8	S85 L91 L92 L93	S85-T89 VanDerWaalsContact O-CB 3.31Å; S85-T89 WeakPolarHBondContact O-CB 3.33Å; S85-T89 PolarHBondContact O-N 3.08Å; S85-T89 PolarHBondContact O-OG1 2.8Å; T89-L91 VanDerWaalsContact C-N 3.34Å; T89-L91 PolarHBondContact O-N 3Å; T89-L92 PolarHBondContact O-N 2.93Å; T89-L93 HydrophobicContact CG2-CD1 4.37Å; T89-L93 WeakPolarHBondContact O-CG 3.35Å; T89-L93 PolarHBondContact O-N 2.99Å
90	T	74.9	Confident	69.1	Low	95 Å²	95	109.8 Å²	109.8	58%	0.583	58%	0.584	S	S	*	*	H	α-helix	trans	-67.7	-33.5	178.7	-56.2	0	0	0	0	112.4	L86 W87 L92	L86-T90 WeakPolarHBondContact O-CB 3.29Å; L86-T90 PolarHBondContact O-N 3.17Å; L86-T90 PolarHBondContact O-OG1 3.34Å; W87-T90 PolarHBondContact O-N 3.09Å; T90-L92 VanDerWaalsContact C-N 3.32Å
91	L	70.8	Confident	69.1	Low	156 Å²	156	112.7 Å²	112.7	82%	0.817	60%	0.599	S	S	*	*	H	α-helix	trans	-77.2	-19.4	178.3	-164.7	70	0	0	0	113	W87 T88 T89	W87-L91 WeakPolarHBondContact O-CB 3.28Å; W87-L91 PolarHBondContact O-N 2.94Å; T88-L91 PolarHBondContact O-N 2.98Å; T89-L91 VanDerWaalsContact C-N 3.34Å; T89-L91 PolarHBondContact O-N 3Å
92	L	66.9	Low	69.2	Low	152 Å²	152	111.8 Å²	111.8	80%	0.796	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93	-3	178.3	-75.9	166.2	0	0	0	113.5	T88 T89 T90	T88-L92 WeakPolarHBondContact O-CB 3.37Å; T88-L92 WeakPolarHBondContact O-CD1 3.49Å; T88-L92 WeakPolarHBondContact O-CG 3.3Å; T88-L92 PolarHBondContact O-N 3.12Å; T89-L92 PolarHBondContact O-N 2.93Å; T90-L92 VanDerWaalsContact C-N 3.32Å
93	L	60.5	Low	69.1	Low	197 Å²	197	113 Å²	113	100%	1.031	61%	0.608	S	S	*	*			trans	-102.2	0	174.6	-72.1	171	0	0	0	111.1	T89	T89-L93 HydrophobicContact CG2-CD1 4.37Å; T89-L93 WeakPolarHBondContact O-CG 3.35Å; T89-L93 PolarHBondContact O-N 2.99Å

Retrieved 93 of 93 residues in 53.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).