A0A075B725_HUMAN Loading...

Tubulin beta 8 class VIII

AlphaFold DB , UniProt , Accession A0A075B725, Species HUMAN (Homo sapiens, Human), Gene TUBB8, Length 89 aa.

						>A0A075B725_HUMAN|A0A075B725|TUBB8
MNMPSTPLAPTTGTATCSWSASTCTTTRPAVAGTCPALCSWIWSRAPWTLCARGPSGRSSGQTTSSSVSCGRGLGCGSLARAAQNPGVC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.4	Very low	50.2	Low	250 Å²	250	139.1 Å²	139.1	100%	1.232	82%	0.816	S	S	*	*				0	118.6	0	-65.6	176.2	172.6	0	0	106.9
2	N	55	Low	50	Low	164 Å²	164	137.3 Å²	137.3	88%	0.877	81%	0.808	S	S	*	*			trans	-120.9	115.9	-174.4	-156.7	36.4	0	0	0	108.5	P4	N2-P4 WeakPolarHBondContact O-CD 3.42Å
3	M	48.2	Very low	50.2	Low	177 Å²	177	131.1 Å²	131.1	87%	0.872	79%	0.791	S	S	*	*			trans	-89.4	113.7	-178.2	-177.3	173.1	-81.5	0	0	109.2	S5	M3-S5 PolarHBondContact O-N 3.33Å
4	P	50.4	Low	49.9	Very low	112 Å²	112	129.9 Å²	129.9	73%	0.727	79%	0.785	S	S	*	*			trans	-69.5	118.4	178.4	27.5	-31.1	0	0	0	109.4	N2 T6	N2-P4 WeakPolarHBondContact O-CD 3.42Å; P4-T6 PolarHBondContact O-N 3.24Å
5	S	48.4	Very low	49.9	Very low	116 Å²	116	127.5 Å²	127.5	81%	0.811	78%	0.784	S	S	*	*			trans	-79.6	108	173.9	-164.9	0	0	0	0	108.8	M3 P7	M3-S5 PolarHBondContact O-N 3.33Å; S5-P7 WeakPolarHBondContact O-CD 3.37Å
6	T	50.7	Low	49.8	Very low	115 Å²	115	126.1 Å²	126.1	71%	0.706	78%	0.775	S	S	*	*			trans	-70.1	118.9	172	-43.1	0	0	0	0	108.2	P4 L8	P4-T6 PolarHBondContact O-N 3.24Å; T6-L8 PolarHBondContact O-N 3.12Å
7	P	50.8	Low	49.6	Very low	115 Å²	115	125.6 Å²	125.6	75%	0.747	78%	0.777	S	S	*	*			trans	-68.5	108.3	172	26.6	-29.5	0	0	0	107.5	S5 A9	S5-P7 WeakPolarHBondContact O-CD 3.37Å; P7-A9 PolarHBondContact O-N 3.02Å; P7-A9 VanDerWaalsContact O-N 3.12Å
8	L	51	Low	49.3	Very low	158 Å²	158	120.9 Å²	120.9	83%	0.827	75%	0.75	S	S	*	*			trans	-56.7	120.5	164.5	-115.9	75.3	0	0	0	106.3	T6	T6-L8 PolarHBondContact O-N 3.12Å
9	A	56.6	Low	48.8	Very low	74 Å²	74	124.9 Å²	124.9	61%	0.612	75%	0.75	S	S	*	*			trans	-46.8	137.2	175.9	0	0	0	0	0	108.8	P7 T11	P7-A9 PolarHBondContact O-N 3.02Å; P7-A9 VanDerWaalsContact O-N 3.12Å; A9-T11 VanDerWaalsContact C-N 3.31Å; A9-T11 PolarHBondContact O-N 2.89Å
10	P	49.3	Very low	48.7	Very low	117 Å²	117	123.3 Å²	123.3	76%	0.76	74%	0.744	S	S	*	*			trans	-57.2	105.6	171.9	-6.8	17.3	0	0	0	105.7	T12	P10-T12 PolarHBondContact O-N 2.7Å
11	T	52.8	Low	48.6	Very low	132 Å²	132	120.6 Å²	120.6	81%	0.81	74%	0.735	S	S	*	*			trans	-72.3	88.1	166.5	-57.6	0	0	0	0	102.7	A9 G13	A9-T11 VanDerWaalsContact C-N 3.31Å; A9-T11 PolarHBondContact O-N 2.89Å; T11-G13 PolarHBondContact O-N 2.8Å
12	T	48.5	Very low	49.1	Very low	117 Å²	117	114 Å²	114	72%	0.718	71%	0.714	S	S	*	*			trans	-61.5	81.2	165.4	-56.1	0	0	0	0	104.8	P10 T14	P10-T12 PolarHBondContact O-N 2.7Å; T12-T14 VanDerWaalsContact C-N 3.28Å; T12-T14 PolarHBondContact O-N 2.75Å
13	G	52.6	Low	48.6	Very low	57 Å²	57	110 Å²	110	59%	0.588	70%	0.696	S	S	*	*			trans	-57.8	106.2	163.6	0	0	0	0	0	104	T11 A15	T11-G13 PolarHBondContact O-N 2.8Å; G13-A15 VanDerWaalsContact C-N 3.29Å; G13-A15 PolarHBondContact O-N 2.77Å
14	T	45.2	Very low	48.6	Very low	114 Å²	114	106.8 Å²	106.8	70%	0.699	69%	0.689	S	S	*	*			trans	-51.4	104.2	169.2	-54.7	0	0	0	0	105.1	T12 T16	T12-T14 VanDerWaalsContact C-N 3.28Å; T12-T14 PolarHBondContact O-N 2.75Å; T14-T16 PolarHBondContact O-N 3.31Å; T14-T16 PolarHBondContact O-OG1 2.89Å
15	A	50	Low	48.2	Very low	94 Å²	94	108.2 Å²	108.2	78%	0.777	70%	0.696	S	S	*	*			trans	-67.4	88.5	168.2	0	0	0	0	0	104.1	G13 C17	G13-A15 VanDerWaalsContact C-N 3.29Å; G13-A15 PolarHBondContact O-N 2.77Å; A15-C17 PolarHBondContact O-N 3.14Å
16	T	48.1	Very low	48.2	Very low	105 Å²	105	108.2 Å²	108.2	64%	0.644	69%	0.691	S	S	*	*			trans	-65.5	84.1	173	-51	0	0	0	0	105.1	T14 S18	T14-T16 PolarHBondContact O-N 3.31Å; T14-T16 PolarHBondContact O-OG1 2.89Å; T16-S18 PolarHBondContact O-N 2.72Å; T16-S18 PolarHBondContact O-OG 3.42Å
17	C	47	Very low	48.1	Very low	118 Å²	118	109 Å²	109	80%	0.797	70%	0.696	S	S	*	*			trans	-69.8	71.9	169.5	-169.7	0	0	0	0	106.4	A15 W19	A15-C17 PolarHBondContact O-N 3.14Å; C17-W19 PolarHBondContact O-N 3.05Å
18	S	44.6	Very low	48.1	Very low	42 Å²	42	115 Å²	115	29%	0.294	70%	0.703	S	S	.	*			trans	-76.5	91	169	30.8	0	0	0	0	103.9	T16 S20 A21 S22	T16-S18 PolarHBondContact O-N 2.72Å; T16-S18 PolarHBondContact O-OG 3.42Å; S18-S20 PolarHBondContact O-N 3.16Å; S18-A21 WeakPolarHBondContact O-CA 3.08Å; S18-A21 PolarHBondContact O-N 2.75Å; S18-A21 WeakPolarHBondContact OG-CB 3.04Å; S18-S22 PolarHBondContact O-N 2.8Å; S18-S22 VanDerWaalsContact O-N 3.1Å
19	W	40.1	Very low	47.8	Very low	197 Å²	197	112.5 Å²	112.5	75%	0.746	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-45.4	-30.4	165.9	-173.3	-84.1	0	0	0	110.8	C17 W43	C17-W19 PolarHBondContact O-N 3.05Å; W19-W43 HydrophobicContact CH2-CZ2 4.29Å; W19-W43 HydrophobicContact CZ3-CZ2 4.32Å
20	S	46.6	Very low	47.6	Very low	91 Å²	91	113.9 Å²	113.9	64%	0.636	71%	0.709	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.7	-26.3	171.7	32.1	0	0	0	0	116.2	S18 T23	S18-S20 PolarHBondContact O-N 3.16Å; S20-T23 WeakPolarHBondContact CA-OG1 3.44Å; S20-T23 WeakPolarHBondContact O-CB 3.48Å; S20-T23 PolarHBondContact O-N 3.1Å; S20-T23 PolarHBondContact O-OG1 2.71Å
21	A	46.7	Very low	47.6	Very low	68 Å²	68	111.8 Å²	111.8	56%	0.562	69%	0.693	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.4	-20.3	171.3	0	0	0	0	0	112.6	S18 T23	S18-A21 WeakPolarHBondContact O-CA 3.08Å; S18-A21 PolarHBondContact O-N 2.75Å; S18-A21 WeakPolarHBondContact OG-CB 3.04Å; A21-T23 PolarHBondContact O-N 3.02Å; A21-T23 VanDerWaalsContact O-N 3.16Å
22	S	47.7	Very low	47.6	Very low	111 Å²	111	110.3 Å²	110.3	78%	0.776	69%	0.694	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.2	14	163.8	-148.6	0	0	0	0	112.3	S18	S18-S22 PolarHBondContact O-N 2.8Å; S18-S22 VanDerWaalsContact O-N 3.1Å
23	T	45.9	Very low	48	Very low	81 Å²	81	107.2 Å²	107.2	50%	0.497	69%	0.686	S	S	.	*	S	Bend	trans	-91.9	106.8	172	-50.2	0	0	0	0	108	S20 A21	S20-T23 WeakPolarHBondContact CA-OG1 3.44Å; S20-T23 WeakPolarHBondContact O-CB 3.48Å; S20-T23 PolarHBondContact O-N 3.1Å; S20-T23 PolarHBondContact O-OG1 2.71Å; A21-T23 PolarHBondContact O-N 3.02Å; A21-T23 VanDerWaalsContact O-N 3.16Å
24	C	48.5	Very low	47.9	Very low	108 Å²	108	107.7 Å²	107.7	73%	0.73	68%	0.677	S	S	*	*			trans	65.4	59.6	140.3	-55.8	0	0	0	0	117.5
25	T	42.2	Very low	48.5	Very low	142 Å²	142	106.2 Å²	106.2	87%	0.871	67%	0.671	S	S	*	*			trans	-96.7	32.9	149.7	-30.6	0	0	0	0	111.3
26	T	47.4	Very low	48.9	Very low	117 Å²	117	105.1 Å²	105.1	72%	0.718	66%	0.656	S	S	*	*	S	Bend	trans	-110.2	95.4	163.3	-54.2	0	0	0	0	106	R28	T26-R28 PolarHBondContact O-N 3.02Å
27	T	48.5	Very low	49.6	Very low	132 Å²	132	103 Å²	103	81%	0.81	65%	0.649	S	S	*	*			trans	-37.1	116.2	163	-52.6	0	0	0	0	108.4
28	R	50.1	Low	50.3	Low	239 Å²	239	102 Å²	102	90%	0.902	64%	0.635	S	S	*	*			trans	-29.9	130.8	-176.9	-60.7	169.6	177.1	-121	-0.7	112.1	T26	T26-R28 PolarHBondContact O-N 3.02Å
29	P	45.3	Very low	50.9	Low	107 Å²	107	103.3 Å²	103.3	70%	0.695	64%	0.643	S	S	*	*				-128.2	141.9	95.6	33.5	-24.3	0	0	0	112.2	V31	P29-V31 PolarHBondContact O-N 3.05Å
30	A	51.9	Low	51.9	Low	103 Å²	103	97.4 Å²	97.4	85%	0.851	63%	0.632	S	S	*	*			trans	-55.5	106.8	175.7	0	0	0	0	0	111
31	V	50.3	Low	52.6	Low	73 Å²	73	99.9 Å²	99.9	44%	0.442	63%	0.627	S	S	.	*			trans	-136.6	95.9	163.5	174.3	0	0	0	0	106.3	P29 G33 T34	P29-V31 PolarHBondContact O-N 3.05Å; V31-G33 PolarHBondContact O-N 2.94Å; V31-T34 WeakPolarHBondContact CB-OG1 3.14Å; V31-T34 HydrophobicContact CG1-CG2 3.98Å; V31-T34 WeakPolarHBondContact CG1-OG1 3.39Å; V31-T34 PolarHBondContact O-N 3.12Å; V31-T34 VanDerWaalsContact O-N 3.13Å; V31-T34 PolarHBondContact O-OG1 3.41Å; V31-T34 VanDerWaalsContact O-OG1 3.12Å
32	A	53.6	Low	53.3	Low	100 Å²	100	101.8 Å²	101.8	83%	0.826	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.7	-10.6	174.2	0	0	0	0	0	113	P36	A32-P36 VanDerWaalsContact O-CD 3.29Å; A32-P36 WeakPolarHBondContact O-CD 3.29Å; A32-P36 WeakPolarHBondContact O-CG 3.18Å
33	G	55.2	Low	53.8	Low	52 Å²	52	104.6 Å²	104.6	54%	0.536	62%	0.621	S	S	.	*	T	Hydrogen-bonded Turn	trans	-98.4	-16.4	176.6	0	0	0	0	0	116.9	V31	V31-G33 PolarHBondContact O-N 2.94Å
34	T	51.8	Low	54.6	Low	67 Å²	67	104.2 Å²	104.2	41%	0.411	62%	0.622	S	S	.	*	H	α-helix	trans	-90	-29.9	178.8	30.7	0	0	0	0	111.8	V31 A37 L38	V31-T34 WeakPolarHBondContact CB-OG1 3.14Å; V31-T34 HydrophobicContact CG1-CG2 3.98Å; V31-T34 WeakPolarHBondContact CG1-OG1 3.39Å; V31-T34 PolarHBondContact O-N 3.12Å; V31-T34 VanDerWaalsContact O-N 3.13Å; V31-T34 PolarHBondContact O-OG1 3.41Å; V31-T34 VanDerWaalsContact O-OG1 3.12Å; T34-A37 PolarHBondContact O-N 3.13Å; T34-L38 VanDerWaalsContact O-CB 3.29Å; T34-L38 WeakPolarHBondContact O-CB 3.36Å; T34-L38 WeakPolarHBondContact O-CG 3.16Å; T34-L38 PolarHBondContact O-N 2.88Å
35	C	56.9	Low	55.1	Low	83 Å²	83	107.5 Å²	107.5	56%	0.561	62%	0.619	S	S	*	*	H	α-helix	trans	-59.4	-48.8	175.2	-62.3	0	0	0	0	112.1	A37 L38 C39	C35-A37 PolarHBondContact O-N 2.93Å; C35-L38 PolarHBondContact O-N 3.5Å; C35-C39 VanDerWaalsContact O-CB 3.23Å; C35-C39 WeakPolarHBondContact O-CB 3.36Å; C35-C39 PolarHBondContact O-N 3.41Å; C35-C39 PolarHBondContact O-SG 3.25Å
36	P	59.7	Low	55.9	Low	71 Å²	71	103 Å²	103	46%	0.461	60%	0.596	S	S	.	*	H	α-helix	trans	-63.9	-39	178.4	-19.8	31.9	0	0	0	113	A32 S40	A32-P36 VanDerWaalsContact O-CD 3.29Å; A32-P36 WeakPolarHBondContact O-CD 3.29Å; A32-P36 WeakPolarHBondContact O-CG 3.18Å; P36-S40 VanDerWaalsContact O-CB 3.3Å; P36-S40 WeakPolarHBondContact O-CB 3.4Å; P36-S40 PolarHBondContact O-N 3.17Å; P36-S40 PolarHBondContact O-OG 3.14Å
37	A	62.6	Low	56	Low	60 Å²	60	101.9 Å²	101.9	50%	0.496	59%	0.591	S	S	.	*	H	α-helix	trans	-67.7	-45.3	179.9	0	0	0	0	0	111.7	T34 C35 S40 W41	T34-A37 PolarHBondContact O-N 3.13Å; C35-A37 PolarHBondContact O-N 2.93Å; A37-S40 PolarHBondContact O-N 2.85Å; A37-W41 WeakPolarHBondContact O-CB 3.29Å; A37-W41 PolarHBondContact O-N 2.87Å
38	L	60.7	Low	56.2	Low	98 Å²	98	104.6 Å²	104.6	51%	0.513	59%	0.586	S	S	.	*	H	α-helix	trans	-67.7	-41.7	176.4	-75.3	169	0	0	0	111.8	T34 C35 W41 I42	T34-L38 VanDerWaalsContact O-CB 3.29Å; T34-L38 WeakPolarHBondContact O-CB 3.36Å; T34-L38 WeakPolarHBondContact O-CG 3.16Å; T34-L38 PolarHBondContact O-N 2.88Å; C35-L38 PolarHBondContact O-N 3.5Å; L38-W41 PolarHBondContact O-N 2.76Å; L38-I42 WeakPolarHBondContact O-CB 3.23Å; L38-I42 WeakPolarHBondContact O-CD1 3.37Å; L38-I42 WeakPolarHBondContact O-CG1 3.3Å; L38-I42 PolarHBondContact O-N 3.46Å
39	C	57.8	Low	56.4	Low	69 Å²	69	98.2 Å²	98.2	47%	0.466	57%	0.574	S	S	.	*	H	α-helix	trans	-59.9	-49.5	174.9	-72.4	0	0	0	0	110.8	C35 W41 I42 W43	C35-C39 VanDerWaalsContact O-CB 3.23Å; C35-C39 WeakPolarHBondContact O-CB 3.36Å; C35-C39 PolarHBondContact O-N 3.41Å; C35-C39 PolarHBondContact O-SG 3.25Å; C39-W41 VanDerWaalsContact C-N 3.28Å; C39-W41 PolarHBondContact O-N 2.88Å; C39-I42 PolarHBondContact O-N 3.3Å; C39-W43 WeakPolarHBondContact O-CB 3.18Å; C39-W43 PolarHBondContact O-N 3.34Å
40	S	60.7	Low	56.6	Low	73 Å²	73	100.8 Å²	100.8	51%	0.51	58%	0.581	S	S	.	*	H	α-helix	trans	-59.9	-39.4	177.7	-60	0	0	0	0	112.3	P36 A37 S44	P36-S40 VanDerWaalsContact O-CB 3.3Å; P36-S40 WeakPolarHBondContact O-CB 3.4Å; P36-S40 PolarHBondContact O-N 3.17Å; P36-S40 PolarHBondContact O-OG 3.14Å; A37-S40 PolarHBondContact O-N 2.85Å; S40-S44 WeakPolarHBondContact O-CB 3.33Å; S40-S44 PolarHBondContact O-N 3.31Å; S40-S44 PolarHBondContact O-OG 2.96Å
41	W	60.6	Low	56.6	Low	143 Å²	143	101 Å²	101	54%	0.542	58%	0.575	S	S	.	*	H	α-helix	trans	-69.2	-41.9	178.8	-178.8	-101.7	0	0	0	112.9	A37 L38 C39 S44 R45	A37-W41 WeakPolarHBondContact O-CB 3.29Å; A37-W41 PolarHBondContact O-N 2.87Å; L38-W41 PolarHBondContact O-N 2.76Å; C39-W41 VanDerWaalsContact C-N 3.28Å; C39-W41 PolarHBondContact O-N 2.88Å; W41-S44 PolarHBondContact O-N 2.95Å; W41-R45 VanDerWaalsContact CE2-NE 3.26Å; W41-R45 VanDerWaalsContact CE2-NH2 3.31Å; W41-R45 VanDerWaalsContact CZ2-NH2 3.31Å; W41-R45 WeakPolarHBondContact O-CG 3.48Å; W41-R45 PolarHBondContact O-N 3.32Å
42	I	62.9	Low	56.6	Low	109 Å²	109	101.1 Å²	101.1	56%	0.559	58%	0.584	S	S	*	*	H	α-helix	trans	-66.7	-41.1	175.2	-67	161.6	0	0	0	110.2	L38 C39 S44 R45 A46	L38-I42 WeakPolarHBondContact O-CB 3.23Å; L38-I42 WeakPolarHBondContact O-CD1 3.37Å; L38-I42 WeakPolarHBondContact O-CG1 3.3Å; L38-I42 PolarHBondContact O-N 3.46Å; C39-I42 PolarHBondContact O-N 3.3Å; I42-S44 VanDerWaalsContact C-N 3.31Å; I42-S44 PolarHBondContact O-N 2.73Å; I42-R45 PolarHBondContact O-N 2.91Å; I42-A46 WeakPolarHBondContact O-CB 3.5Å; I42-A46 PolarHBondContact O-N 2.8Å
43	W	58.2	Low	56.5	Low	170 Å²	170	107.2 Å²	107.2	64%	0.644	59%	0.585	S	S	*	*	H	α-helix	trans	-63.3	-36	173.9	-88.1	70.7	0	0	0	112.7	W19 C39	W19-W43 HydrophobicContact CH2-CZ2 4.29Å; W19-W43 HydrophobicContact CZ3-CZ2 4.32Å; C39-W43 WeakPolarHBondContact O-CB 3.18Å; C39-W43 PolarHBondContact O-N 3.34Å
44	S	61.7	Low	56.6	Low	73 Å²	73	106.8 Å²	106.8	51%	0.51	58%	0.581	S	S	.	*	H	α-helix	trans	-74.5	-31.3	177.4	-59.1	0	0	0	0	113	S40 W41 I42	S40-S44 WeakPolarHBondContact O-CB 3.33Å; S40-S44 PolarHBondContact O-N 3.31Å; S40-S44 PolarHBondContact O-OG 2.96Å; W41-S44 PolarHBondContact O-N 2.95Å; I42-S44 VanDerWaalsContact C-N 3.31Å; I42-S44 PolarHBondContact O-N 2.73Å
45	R	59.6	Low	56.6	Low	176 Å²	176	110 Å²	110	66%	0.664	60%	0.603	S	S	*	*	H	α-helix	trans	-85.2	-22.7	175.3	-75.2	-159.2	-156.7	170.8	3.8	113.7	W41 I42	W41-R45 VanDerWaalsContact CE2-NE 3.26Å; W41-R45 VanDerWaalsContact CE2-NH2 3.31Å; W41-R45 VanDerWaalsContact CZ2-NH2 3.31Å; W41-R45 WeakPolarHBondContact O-CG 3.48Å; W41-R45 PolarHBondContact O-N 3.32Å; I42-R45 PolarHBondContact O-N 2.91Å
46	A	58.3	Low	56.5	Low	48 Å²	48	111.6 Å²	111.6	40%	0.397	62%	0.615	S	S	.	*	S	Bend	trans	-58.2	126	174.1	0	0	0	0	0	107.4	I42 W48	I42-A46 WeakPolarHBondContact O-CB 3.5Å; I42-A46 PolarHBondContact O-N 2.8Å; A46-W48 PolarHBondContact O-N 3.46Å
47	P	50	Low	56.2	Low	93 Å²	93	110.8 Å²	110.8	60%	0.604	62%	0.62	S	S	*	*			trans	-56.1	117.5	-179.5	-22.5	31.7	0	0	0	108.5	T49 L50	P47-T49 WeakPolarHBondContact CB-OG1 3.36Å; P47-T49 PolarHBondContact O-N 3.34Å; P47-L50 PolarHBondContact O-N 2.96Å
48	W	53.1	Low	56	Low	190 Å²	190	119.5 Å²	119.5	72%	0.72	64%	0.64	S	S	*	*	G	3₁₀ helix	trans	-49.1	-11.1	172.2	-61.3	85.6	0	0	0	113.2	A46 L50 C51 A52	A46-W48 PolarHBondContact O-N 3.46Å; W48-L50 PolarHBondContact O-N 2.75Å; W48-C51 PolarHBondContact O-N 3.24Å; W48-A52 WeakPolarHBondContact O-CB 3.44Å; W48-A52 PolarHBondContact O-N 3.24Å
49	T	52.7	Low	55.9	Low	104 Å²	104	120.2 Å²	120.2	64%	0.638	65%	0.653	S	S	*	*	G	3₁₀ helix	trans	-48.7	-33.1	169	-41.6	0	0	0	0	114.7	P47	P47-T49 WeakPolarHBondContact CB-OG1 3.36Å; P47-T49 PolarHBondContact O-N 3.34Å
50	L	49.8	Very low	55.9	Low	161 Å²	161	122 Å²	122	84%	0.843	67%	0.666	S	S	*	*	G	3₁₀ helix	trans	-77.9	-30.2	-179.8	-110.9	161.6	0	0	0	113.4	P47 W48	P47-L50 PolarHBondContact O-N 2.96Å; W48-L50 PolarHBondContact O-N 2.75Å
51	C	51.9	Low	55.8	Low	108 Å²	108	120.9 Å²	120.9	73%	0.73	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.5	-10.1	179.8	-63.3	0	0	0	0	113.5	W48	W48-C51 PolarHBondContact O-N 3.24Å
52	A	51	Low	55.5	Low	76 Å²	76	122.6 Å²	122.6	63%	0.628	68%	0.681	S	S	*	*	S	Bend	trans	-100.1	6.8	-174.7	0	0	0	0	0	115	W48	W48-A52 WeakPolarHBondContact O-CB 3.44Å; W48-A52 PolarHBondContact O-N 3.24Å
53	R	51.2	Low	54.9	Low	227 Å²	227	123.1 Å²	123.1	86%	0.857	69%	0.689	S	S	*	*	S	Bend	trans	-115	52.8	175.1	-161.7	83.4	70.1	172.7	1.6	112.4
54	G	57.4	Low	54.6	Low	44 Å²	44	120.6 Å²	120.6	45%	0.454	69%	0.693	S	S	.	*	S	Bend	trans	-137.8	150.2	147.8	0	0	0	0	0	105.6	S56	G54-S56 PolarHBondContact O-N 2.71Å
55	P	52.3	Low	54.1	Low	134 Å²	134	122.1 Å²	122.1	87%	0.87	70%	0.703	S	S	*	*			trans	-58.6	100.4	161.2	23.6	-22.1	0	0	0	104.4	G57	P55-G57 PolarHBondContact O-N 2.69Å
56	S	54.6	Low	53.8	Low	116 Å²	116	118 Å²	118	81%	0.811	70%	0.702	S	S	*	*			trans	-64.6	80.8	161.6	-172	0	0	0	0	102.9	G54 R58	G54-S56 PolarHBondContact O-N 2.71Å; S56-R58 PolarHBondContact O-N 2.58Å; S56-R58 VanDerWaalsContact O-N 3.1Å
57	G	53.1	Low	53.5	Low	55 Å²	55	121.2 Å²	121.2	57%	0.567	72%	0.721	S	S	*	*			trans	-47.4	125.8	177.8	0	0	0	0	0	104.7	P55 S59	P55-G57 PolarHBondContact O-N 2.69Å; G57-S59 PolarHBondContact O-N 3.1Å
58	R	58.4	Low	53.3	Low	242 Å²	242	122 Å²	122	91%	0.913	72%	0.724	S	S	*	*			trans	-51.8	83	179.5	-86.3	163.3	60.1	-143.7	3	108.7	S56 S60	S56-R58 PolarHBondContact O-N 2.58Å; S56-R58 VanDerWaalsContact O-N 3.1Å; R58-S60 PolarHBondContact O-N 3.06Å
59	S	59.4	Low	53.5	Low	113 Å²	113	118.2 Å²	118.2	79%	0.79	73%	0.727	S	S	*	*			trans	-97.2	52.5	158.4	-161.3	0	0	0	0	106	G57 G61	G57-S59 PolarHBondContact O-N 3.1Å; S59-G61 PolarHBondContact O-N 3.47Å
60	S	57.9	Low	53.1	Low	106 Å²	106	118.9 Å²	118.9	74%	0.741	73%	0.734	S	S	*	*			trans	-73.1	70	138.7	-67.4	0	0	0	0	105.5	R58 Q62	R58-S60 PolarHBondContact O-N 3.06Å; S60-Q62 VanDerWaalsContact C-N 3.27Å; S60-Q62 PolarHBondContact O-N 2.94Å
61	G	58.2	Low	53.2	Low	51 Å²	51	114 Å²	114	53%	0.526	72%	0.722	S	S	.	*			trans	-53.3	109.4	152.2	0	0	0	0	0	103.8	S59 T63	S59-G61 PolarHBondContact O-N 3.47Å; G61-T63 PolarHBondContact O-N 2.71Å
62	Q	52.9	Low	53.3	Low	179 Å²	179	120.8 Å²	120.8	84%	0.836	73%	0.733	S	S	*	*			trans	-56.9	95	-175.1	-156.9	134.4	62.8	0	0	105.7	S60 T64	S60-Q62 VanDerWaalsContact C-N 3.27Å; S60-Q62 PolarHBondContact O-N 2.94Å; Q62-T64 PolarHBondContact O-N 2.84Å
63	T	51.7	Low	53.5	Low	119 Å²	119	120.2 Å²	120.2	73%	0.73	73%	0.734	S	S	*	*			trans	-69.5	98	170.1	-59.2	0	0	0	0	101.7	G61 S65	G61-T63 PolarHBondContact O-N 2.71Å; T63-S65 PolarHBondContact O-N 2.69Å
64	T	51.3	Low	53.6	Low	117 Å²	117	118.1 Å²	118.1	72%	0.718	74%	0.739	S	S	*	*			trans	-56.8	89.9	164	-58.3	0	0	0	0	104.8	Q62 S66	Q62-T64 PolarHBondContact O-N 2.84Å; T64-S66 PolarHBondContact O-N 3.38Å
65	S	51.3	Low	53.2	Low	105 Å²	105	120.1 Å²	120.1	73%	0.734	76%	0.759	S	S	*	*			trans	-66.8	81.5	165.4	-71.9	0	0	0	0	105.4	T63 S67	T63-S65 PolarHBondContact O-N 2.69Å; S65-S67 PolarHBondContact O-N 2.88Å
66	S	53.8	Low	53.2	Low	91 Å²	91	119.9 Å²	119.9	64%	0.636	76%	0.759	S	S	*	*			trans	-68.7	87.6	165.4	56.1	0	0	0	0	106	T64 V68	T64-S66 PolarHBondContact O-N 3.38Å; S66-V68 PolarHBondContact O-N 3.5Å
67	S	52.3	Low	53.3	Low	115 Å²	115	117.8 Å²	117.8	80%	0.804	76%	0.756	S	S	*	*			trans	-66.2	94	160.6	-160	0	0	0	0	105.4	S65 S69	S65-S67 PolarHBondContact O-N 2.88Å; S67-S69 PolarHBondContact O-N 2.78Å
68	V	45.1	Very low	53.4	Low	109 Å²	109	120.7 Å²	120.7	66%	0.661	77%	0.768	S	S	*	*			trans	-67.1	85	168	-92.3	0	0	0	0	106.4	S66 C70	S66-V68 PolarHBondContact O-N 3.5Å; V68-C70 VanDerWaalsContact C-N 3.25Å; V68-C70 PolarHBondContact O-N 2.9Å
69	S	56.2	Low	53.1	Low	110 Å²	110	117.8 Å²	117.8	77%	0.769	77%	0.769	S	S	*	*			trans	-63.1	102.7	152	-171.9	0	0	0	0	104.5	S67 G71	S67-S69 PolarHBondContact O-N 2.78Å; S69-G71 PolarHBondContact O-N 3.01Å
70	C	45.7	Very low	52.6	Low	118 Å²	118	116.7 Å²	116.7	80%	0.797	77%	0.768	S	S	*	*			trans	-67.4	66.7	169.2	-68.8	0	0	0	0	108.4	V68 R72	V68-C70 VanDerWaalsContact C-N 3.25Å; V68-C70 PolarHBondContact O-N 2.9Å; C70-R72 PolarHBondContact O-N 3.38Å
71	G	51.5	Low	52.2	Low	58 Å²	58	122.5 Å²	122.5	60%	0.598	77%	0.773	S	S	*	*			trans	-63	117.7	156.6	0	0	0	0	0	106.2	S69 G73	S69-G71 PolarHBondContact O-N 3.01Å; G71-G73 PolarHBondContact O-N 2.83Å
72	R	54.5	Low	51.6	Low	252 Å²	252	124.8 Å²	124.8	95%	0.951	79%	0.787	S	S	*	*	S	Bend	trans	-47.3	115	173.2	-72.7	167.4	76	-108.7	8.9	108.7	C70	C70-R72 PolarHBondContact O-N 3.38Å
73	G	54.8	Low	51.5	Low	63 Å²	63	121 Å²	121	65%	0.649	79%	0.786	S	S	*	*	S	Bend	trans	132.6	97.5	166.8	0	0	0	0	0	114.2	G71	G71-G73 PolarHBondContact O-N 2.83Å
74	L	52.6	Low	51.5	Low	184 Å²	184	123.3 Å²	123.3	96%	0.963	79%	0.788	S	S	*	*	S	Bend	trans	78.5	97.6	149.3	-52.6	169.5	0	0	0	117.7
75	G	48.5	Very low	51.6	Low	85 Å²	85	124.6 Å²	124.6	88%	0.876	79%	0.791	S	S	*	*			trans	97.3	81.8	137.9	0	0	0	0	0	117.2
76	C	53.7	Low	51.5	Low	129 Å²	129	124.7 Å²	124.7	87%	0.872	79%	0.789	S	S	*	*			trans	-94.9	131.9	155.2	83.5	0	0	0	0	109.3
77	G	56.3	Low	51.8	Low	72 Å²	72	123.7 Å²	123.7	74%	0.742	79%	0.793	S	S	*	*			trans	109.8	98.9	170.2	0	0	0	0	0	113.9
78	S	55.6	Low	51.3	Low	117 Å²	117	124.5 Å²	124.5	82%	0.818	79%	0.793	S	S	*	*			trans	-175.4	-8.3	140.6	-83.5	0	0	0	0	115.7	A80	S78-A80 PolarHBondContact O-N 3Å
79	L	51.8	Low	51.2	Low	180 Å²	180	129 Å²	129	94%	0.942	83%	0.827	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88	6.5	-173.4	-65.3	179.3	0	0	0	116.7
80	A	48.9	Very low	51	Low	91 Å²	91	130 Å²	130	75%	0.752	83%	0.83	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.2	1.8	-177.9	0	0	0	0	0	115.3	S78	S78-A80 PolarHBondContact O-N 3Å
81	R	48.9	Very low	51.3	Low	228 Å²	228	130.6 Å²	130.6	86%	0.86	83%	0.831	S	S	*	*	S	Bend	trans	-95.2	-10.7	-177	-166	160.8	-72.9	-173.1	-0.8	115
82	A	46.8	Very low	51.2	Low	99 Å²	99	134.6 Å²	134.6	82%	0.818	84%	0.844	S	S	*	*	S	Bend	trans	-92.4	-7	-173.3	0	0	0	0	0	115.9
83	A	49.9	Very low	51.1	Low	98 Å²	98	127.7 Å²	127.7	81%	0.81	84%	0.838	S	S	*	*	S	Bend	trans	-108	10.9	-175	0	0	0	0	0	115.2
84	Q	51.7	Low	50.8	Low	168 Å²	168	131.8 Å²	131.8	79%	0.785	85%	0.85	S	S	*	*			trans	-102.7	25.4	178.2	-67.7	-165.6	105.6	0	0	113.9	P86	Q84-P86 VanDerWaalsContact C-CD 3.44Å; Q84-P86 WeakPolarHBondContact O-CD 3.39Å
85	N	54	Low	50.7	Low	145 Å²	145	128.3 Å²	128.3	78%	0.775	84%	0.842	S	S	*	*			trans	-119.2	78	176.4	-142.3	-22.8	0	0	0	111.5	G87	N85-G87 PolarHBondContact O-N 2.72Å
86	P	49.4	Very low	50.9	Low	107 Å²	107	131.4 Å²	131.4	70%	0.695	84%	0.84	S	S	*	*			trans	-78.7	109	153.1	31.9	-23	0	0	0	106.4	Q84 V88	Q84-P86 VanDerWaalsContact C-CD 3.44Å; Q84-P86 WeakPolarHBondContact O-CD 3.39Å; P86-V88 PolarHBondContact O-N 3.29Å
87	G	59.7	Low	50.6	Low	69 Å²	69	131.5 Å²	131.5	71%	0.711	84%	0.838	S	S	*	*			trans	-54.6	133.2	-176.8	0	0	0	0	0	112.7	N85	N85-G87 PolarHBondContact O-N 2.72Å
88	V	40.7	Very low	50.2	Low	132 Å²	132	136.5 Å²	136.5	80%	0.8	85%	0.846	S	S	*	*			trans	-147.4	119.3	161.5	-152.5	0	0	0	0	108.8	P86	P86-V88 PolarHBondContact O-N 3.29Å
89	C	44.4	Very low	49.7	Very low	204 Å²	204	138.3 Å²	138.3	100%	1.378	85%	0.848	S	S	*	*			trans	74	0	179.5	-59.3	0	0	0	0	117.9

Retrieved 89 of 89 residues in 51.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).