A0A075B7A5_HUMAN Loading...

Leukocyte immunoglobulin like receptor A4

AlphaFold DB , UniProt , Accession A0A075B7A5, Species HUMAN (Homo sapiens, Human), Gene LILRA4, Length 140 aa.

						>A0A075B7A5_HUMAN|A0A075B7A5|LILRA4
SSEWSAPSDPLDILIAGQISDRPSLSVQPGPTVTSGEKVTLLCQSWDPMFTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSHPSEPLELVVSGEGADPVHSELKGVLGNEKGELP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	S	65.8	Low	89.2	Confident	159 Å²	159	139.4 Å²	139.4	100%	1.112	82%	0.82	S	S	*	*				0	127.8	0	34.5	0	0	0	0	107.5
2	S	75.5	Confident	89.5	Confident	112 Å²	112	136 Å²	136	78%	0.783	80%	0.796	S	S	*	*			trans	-89.7	106.4	165.7	-84.6	0	0	0	0	107.3
3	E	85.9	Confident	89.9	Confident	184 Å²	184	134.3 Å²	134.3	86%	0.86	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-87.5	123.4	167.6	-69.3	-172.6	121.8	0	0	108
4	W	90.9	Very high	90.3	Very high	238 Å²	238	128.5 Å²	128.5	90%	0.902	74%	0.744	S	S	*	*	P	Polyproline II helix	trans	-82.3	145.6	176.9	-67.9	88.5	0	0	0	109.8
5	S	93.9	Very high	90.8	Very high	109 Å²	109	125.2 Å²	125.2	76%	0.762	72%	0.721	S	S	*	*	P	Polyproline II helix	trans	-67	160.8	169.8	60.2	0	0	0	0	110.9
6	A	94.9	Very high	91.1	Very high	85 Å²	85	120.3 Å²	120.3	70%	0.702	70%	0.701	S	S	*	*	P	Polyproline II helix	trans	-58.8	151.1	166.3	0	0	0	0	0	110.9
7	P	95.6	Very high	91.4	Very high	127 Å²	127	114.7 Å²	114.7	83%	0.825	67%	0.674	S	S	*	*	P	Polyproline II helix	trans	-64.6	155.1	173.5	28.5	-34.9	0	0	0	111.2
8	S	97	Very high	91.8	Very high	109 Å²	109	114.7 Å²	114.7	76%	0.762	67%	0.667	S	S	*	*	P	Polyproline II helix	trans	-73.5	171.3	172.2	65.5	0	0	0	0	111.7
9	D	95	Very high	92	Very high	148 Å²	148	109.6 Å²	109.6	79%	0.791	64%	0.636	S	S	*	*	P	Polyproline II helix	trans	-56.8	141.3	165	-64.2	-38.4	0	0	0	110.5
10	P	93.8	Very high	92.2	Very high	121 Å²	121	109.3 Å²	109.3	79%	0.786	64%	0.641	S	S	*	*	P	Polyproline II helix	trans	-70.2	145.7	179.3	29.1	-34.4	0	0	0	111
11	L	92.9	Very high	92.3	Very high	141 Å²	141	105 Å²	105	74%	0.738	62%	0.615	S	S	*	*			trans	-119	116.4	173.2	178.3	63.6	0	0	0	109.2	I13	L11-I13 HydrophobicContact CD2-CD1 4.14Å; L11-I13 HydrophobicContact CG-CD1 4.15Å; L11-I13 PolarHBondContact O-N 3.16Å
12	D	92.6	Very high	93.9	Very high	99 Å²	99	103.7 Å²	103.7	53%	0.529	59%	0.586	S	S	.	*			trans	-74.6	122.7	176.2	-75.6	-20.7	0	0	0	110.6	L14 Y103	D12-L14 HydrophobicContact CB-CD2 4.5Å; D12-Y103 HydrophobicContact CB-CE1 4.21Å
13	I	94.6	Very high	95	Very high	114 Å²	114	98.6 Å²	98.6	59%	0.585	55%	0.55	S	S	*	.			trans	-96.3	122	172.8	-54.2	-57.7	0	0	0	109	L11 I15	L11-I13 HydrophobicContact CD2-CD1 4.14Å; L11-I13 HydrophobicContact CG-CD1 4.15Å; L11-I13 PolarHBondContact O-N 3.16Å; I13-I15 HydrophobicContact CG2-CD1 4.14Å
14	L	95.7	Very high	95.6	Very high	53 Å²	53	92.4 Å²	92.4	28%	0.277	53%	0.527	S	S	.	.			trans	-110.1	136.3	-177	-51.4	177.3	0	0	0	110.5	D12 L53 P63 Y103 L105	D12-L14 HydrophobicContact CB-CD2 4.5Å; L14-L53 HydrophobicContact CD1-CD2 3.49Å; L14-L53 VanDerWaalsContact CD1-CD2 3.49Å; L14-P63 HydrophobicContact CD1-CG 3.93Å; L14-Y103 WeakPolarHBondContact CA-O 3.37Å; L14-Y103 HydrophobicContact CD2-CD1 4.06Å; L14-L105 HydrophobicContact CB-CD1 3.78Å; L14-L105 HydrophobicContact CB-CG 4.12Å; L14-L105 HydrophobicContact CD1-CD1 4.11Å
15	I	97.4	Very high	95.9	Very high	79 Å²	79	82.3 Å²	82.3	41%	0.405	49%	0.491	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.4	114.2	-176.2	-47.8	-58.8	0	0	0	110.1	I13 Q18 Y103 L104 L105	I13-I15 HydrophobicContact CG2-CD1 4.14Å; I15-Q18 HydrophobicContact CB-CG 4.07Å; I15-Q18 HydrophobicContact CG2-CG 3.66Å; I15-Y103 PolarHBondContact N-O 3.17Å; I15-L104 HydrophobicContact CB-CD2 4.12Å; I15-L104 HydrophobicContact CG1-CD2 4.37Å; I15-L105 PolarHBondContact O-N 3.15Å
16	A	97	Very high	96.1	Very high	47 Å²	47	79.1 Å²	79.1	39%	0.388	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.3	157.9	178.2	0	0	0	0	0	113.5	Q18 Y95	A16-Q18 VanDerWaalsContact C-N 3.3Å; A16-Q18 PolarHBondContact O-N 3.38Å; A16-Y95 HydrophobicContact CB-CD1 4.37Å; A16-Y95 HydrophobicContact CB-CE1 3.85Å
17	G	96.3	Very high	96.3	Very high	25 Å²	25	76.2 Å²	76.2	26%	0.258	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	71.9	19.7	174.1	0	0	0	0	0	114.9	L105 S106	G17-L105 PolarHBondContact N-O 3.34Å; G17-S106 PolarHBondContact N-O 3.49Å
18	Q	97.6	Very high	96.4	Very high	115 Å²	115	76 Å²	76	54%	0.537	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.7	-22.3	178.8	-61	-60.1	-56.3	0	0	112	I15 A16 L104 L105	I15-Q18 HydrophobicContact CB-CG 4.07Å; I15-Q18 HydrophobicContact CG2-CG 3.66Å; A16-Q18 VanDerWaalsContact C-N 3.3Å; A16-Q18 PolarHBondContact O-N 3.38Å; Q18-L104 HydrophobicContact CB-CB 3.9Å; Q18-L104 HydrophobicContact CB-CD1 4.46Å; Q18-L104 HydrophobicContact CB-CD2 4.36Å; Q18-L104 HydrophobicContact CB-CG 4.44Å; Q18-L104 HydrophobicContact CG-CB 4.38Å; Q18-L104 HydrophobicContact CG-CD2 4Å; Q18-L105 PolarHBondContact N-O 3.47Å
19	I	96.4	Very high	96.3	Very high	17 Å²	17	75.5 Å²	75.5	9%	0.087	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	128.3	169.6	-55.2	160.5	0	0	0	107	D21 M49 R98 L105 S106 H107	I19-D21 HydrophobicContact CG2-CB 4.3Å; I19-D21 PolarHBondContact O-N 3.45Å; I19-M49 HydrophobicContact CG2-CE 4.26Å; I19-R98 HydrophobicContact CD1-CG 4Å; I19-L105 PolarHBondContact N-O 2.86Å; I19-L105 VanDerWaalsContact N-O 3.14Å; I19-S106 CarbonylContact O-C 3.47Å; I19-S106 VanDerWaalsContact O-CA 3.32Å; I19-S106 WeakPolarHBondContact O-CA 3.29Å; I19-H107 PolarHBondContact O-N 2.99Å
20	S	95.3	Very high	96.3	Very high	103 Å²	103	69.1 Å²	69.1	72%	0.72	39%	0.393	S	S	*	.	S	Bend	trans	-66.4	-22.5	-172.8	54.4	0	0	0	0	114.4
21	D	95.3	Very high	96.5	Very high	20 Å²	20	66.5 Å²	66.5	11%	0.107	38%	0.376	C	S	.	.			trans	-59.8	152.7	177.3	-177.7	65.2	0	0	0	111.6	I19 S45 D47 M49 S106 H107	I19-D21 HydrophobicContact CG2-CB 4.3Å; I19-D21 PolarHBondContact O-N 3.45Å; D21-S45 PolarHBondContact OD1-OG 3.38Å; D21-S45 PolarHBondContact OD2-OG 2.98Å; D21-D47 HydrophobicContact CB-CB 3.96Å; D21-M49 HydrophobicContact CB-CE 3.74Å; D21-S106 WeakPolarHBondContact O-CB 3.49Å; D21-H107 PolarHBondContact O-N 2.79Å; D21-H107 VanDerWaalsContact O-N 3.16Å
22	R	98.2	Very high	96.6	Very high	132 Å²	132	64.2 Å²	64.2	50%	0.498	37%	0.368	S	S	.	.			trans	-131.4	104.1	175.3	-162.8	172	-160.7	-157	-9.7	109.4	H107 P108 E110	R22-H107 HydrophobicContact CB-CB 4.28Å; R22-H107 HydrophobicContact CG-CB 4.04Å; R22-P108 VanDerWaalsContact CG-O 3.27Å; R22-P108 WeakPolarHBondContact CG-O 3.38Å; R22-P108 PolarHBondContact NE-O 3.14Å; R22-E110 IonicContact CZ-OE1 3.83Å; R22-E110 IonicContact NE-OE1 2.98Å; R22-E110 IonicContact NH1-OE1 2.76Å; R22-E110 PolarHBondContact NH1-OE1 3.24Å; R22-E110 IonicContact NH2-OE1 3.93Å; R22-E110 PolarHBondContact NH2-OE1 3.26Å
23	P	98.1	Very high	96.8	Very high	4 Å²	4	59.8 Å²	59.8	3%	0.026	35%	0.345	C	S	.	.			trans	-70.7	155.8	-177.4	30.7	-35.4	0	0	0	111.3	Q44 F52 S106 H107 S109	P23-Q44 CarbonylContact C-O 3.45Å; P23-Q44 WeakPolarHBondContact CA-O 3.48Å; P23-Q44 VanDerWaalsContact CB-O 3.23Å; P23-Q44 WeakPolarHBondContact CB-O 3.37Å; P23-F52 HydrophobicContact CB-CE1 3.95Å; P23-S106 WeakPolarHBondContact CD-OG 3.36Å; P23-H107 VanDerWaalsContact CD-O 3.31Å; P23-H107 WeakPolarHBondContact CD-O 3.21Å; P23-S109 WeakPolarHBondContact O-CA 3.32Å; P23-S109 WeakPolarHBondContact O-CB 3.39Å
24	S	98.3	Very high	96.8	Very high	55 Å²	55	57.8 Å²	57.8	39%	0.385	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.5	139.4	171.4	59.7	0	0	0	0	110.6	C43 Q44	S24-C43 CarbonylContact O-C 3.55Å; S24-C43 WeakPolarHBondContact O-CA 3.41Å; S24-Q44 PolarHBondContact N-O 2.66Å; S24-Q44 PolarHBondContact O-N 2.83Å; S24-Q44 PolarHBondContact OG-O 3.32Å
25	L	98.6	Very high	96.8	Very high	26 Å²	26	56.8 Å²	56.8	14%	0.136	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	131.8	172.1	-177.2	59.3	0	0	0	109.5	L41 C43 L54 C94 S109 L112	L25-L41 HydrophobicContact CD1-CB 4.26Å; L25-L41 HydrophobicContact CD1-CD2 4.31Å; L25-C43 HydrophobicContact CD1-CB 4.45Å; L25-L54 HydrophobicContact CD1-CD1 4.03Å; L25-L54 HydrophobicContact CD2-CD1 4.14Å; L25-C94 HydrophobicContact CD1-CB 4.12Å; L25-C94 HydrophobicContact CD2-CB 4.47Å; L25-S109 WeakPolarHBondContact CB-OG 3.33Å; L25-L112 HydrophobicContact CD2-CB 3.79Å; L25-L112 HydrophobicContact CG-CB 4.12Å; L25-L112 HydrophobicContact CG-CD1 4.02Å
26	S	98.3	Very high	96.6	Very high	42 Å²	42	55.4 Å²	55.4	29%	0.294	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.9	166.3	178.2	60.3	0	0	0	0	110.3	L41 L42	S26-L41 CarbonylContact O-C 3.58Å; S26-L41 WeakPolarHBondContact O-CA 3.44Å; S26-L42 PolarHBondContact N-O 2.93Å; S26-L42 PolarHBondContact O-N 3.45Å; S26-L42 WeakPolarHBondContact OG-CB 3.35Å; S26-L42 PolarHBondContact OG-O 2.86Å
27	V	98.1	Very high	96.5	Very high	23 Å²	23	57 Å²	57	14%	0.139	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.6	139.2	-176.7	64	0	0	0	0	110.3	G30 P31 V39 T40 L41 L112 L114	V27-G30 VanDerWaalsContact CG1-C 3.44Å; V27-G30 WeakPolarHBondContact CG2-O 3.36Å; V27-P31 HydrophobicContact CG1-CB 4.08Å; V27-V39 HydrophobicContact CG2-CG1 3.49Å; V27-V39 VanDerWaalsContact CG2-CG1 3.49Å; V27-T40 WeakPolarHBondContact CA-O 3.22Å; V27-L41 HydrophobicContact CB-CD2 3.85Å; V27-L41 HydrophobicContact CG2-CD2 3.92Å; V27-L112 HydrophobicContact CB-CD1 3.78Å; V27-L112 HydrophobicContact CB-CD2 4.11Å; V27-L112 HydrophobicContact CG1-CD1 3.83Å; V27-L112 HydrophobicContact CG1-CD2 4.13Å; V27-L112 HydrophobicContact CG1-CG 4.41Å; V27-L114 HydrophobicContact CG2-CD1 4.17Å
28	Q	97.3	Very high	96.5	Very high	123 Å²	123	62.2 Å²	62.2	58%	0.575	36%	0.355	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-124.8	139.3	171.2	-64.1	-177.3	16.1	0	0	109.5	V39 T40	Q28-V39 WeakPolarHBondContact O-CA 3.25Å; Q28-T40 PolarHBondContact N-O 3.04Å; Q28-T40 PolarHBondContact O-N 3.11Å
29	P	95.3	Very high	96.5	Very high	99 Å²	99	56.7 Å²	56.7	64%	0.643	33%	0.33	S	S	*	.	S	Bend	cis	-75.2	-19.8	1.2	31.4	-35.9	0	0	0	114	V33	P29-V33 HydrophobicContact CG-CG1 4.24Å
30	G	96.3	Very high	96.5	Very high	14 Å²	14	57.1 Å²	57.1	14%	0.144	33%	0.333	C	S	.	.			trans	-178.4	176.4	179.9	0	0	0	0	0	112	V27 T32	V27-G30 VanDerWaalsContact CG1-C 3.44Å; V27-G30 WeakPolarHBondContact CG2-O 3.36Å; G30-T32 VanDerWaalsContact C-N 3.32Å
31	P	96.2	Very high	96.7	Very high	66 Å²	66	52.2 Å²	52.2	43%	0.429	30%	0.299	S	S	.	.	S	Bend	trans	-77.6	-16.2	-177.4	30.9	-35.5	0	0	0	113.5	V27 E113 L114 V115	V27-P31 HydrophobicContact CG1-CB 4.08Å; P31-E113 WeakPolarHBondContact CB-O 3.16Å; P31-L114 CarbonylContact O-C 3.53Å; P31-L114 WeakPolarHBondContact O-CA 3.43Å; P31-L114 WeakPolarHBondContact O-CD1 3.48Å; P31-V115 PolarHBondContact O-N 2.92Å
32	T	96.8	Very high	96.8	Very high	93 Å²	93	52 Å²	52	57%	0.571	30%	0.298	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.2	119.5	177.3	-53.1	0	0	0	0	108.9	G30 V115	G30-T32 VanDerWaalsContact C-N 3.32Å; T32-V115 WeakPolarHBondContact CA-O 3.44Å; T32-V115 HydrophobicContact CG2-CB 4.37Å; T32-V115 HydrophobicContact CG2-CG1 4.45Å
33	V	95.4	Very high	96.8	Very high	5 Å²	5	45.8 Å²	45.8	3%	0.03	27%	0.274	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.8	168	-177.7	-65.5	0	0	0	0	110.8	P29 V39 V84 L114 V115 V116 S117	P29-V33 HydrophobicContact CG-CG1 4.24Å; V33-V39 HydrophobicContact CB-CG2 4.15Å; V33-V39 HydrophobicContact CG1-CG2 3.66Å; V33-V39 HydrophobicContact CG2-CG2 3.76Å; V33-V84 HydrophobicContact CG2-CG2 3.95Å; V33-L114 HydrophobicContact CG2-CD1 4.31Å; V33-V115 PolarHBondContact N-O 2.81Å; V33-V116 HydrophobicContact CG2-CG2 4.08Å; V33-V116 CarbonylContact O-C 3.6Å; V33-V116 WeakPolarHBondContact O-CA 3.24Å; V33-S117 PolarHBondContact O-N 3.37Å
34	T	95.1	Very high	96.8	Very high	73 Å²	73	47.1 Å²	47.1	45%	0.448	28%	0.28	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.3	149.8	173.7	56.1	0	0	0	0	111.6	G36 E37 V84 S117	T34-G36 PolarHBondContact O-N 2.87Å; T34-E37 PolarHBondContact N-OE2 3.21Å; T34-E37 WeakPolarHBondContact O-CB 3.39Å; T34-E37 WeakPolarHBondContact O-CG 3.27Å; T34-E37 PolarHBondContact O-N 3.27Å; T34-E37 WeakPolarHBondContact OG1-CG 2.9Å; T34-E37 PolarHBondContact OG1-OE2 3.2Å; T34-V84 VanDerWaalsContact O-CG2 3.27Å; T34-V84 WeakPolarHBondContact O-CG2 3.3Å; T34-S117 CarbonylContact C-O 3.49Å; T34-S117 WeakPolarHBondContact CA-O 3.45Å
35	S	95.8	Very high	96.8	Very high	32 Å²	32	44.7 Å²	44.7	22%	0.224	26%	0.263	C	S	.	.	T	Hydrogen-bonded Turn	trans	-57.4	136.1	175.9	-171.7	0	0	0	0	110.5	V84 S117 G120	S35-V84 PolarHBondContact OG-O 2.83Å; S35-S117 PolarHBondContact N-O 2.85Å; S35-G120 WeakPolarHBondContact OG-CA 3.38Å
36	G	93.6	Very high	96.7	Very high	50 Å²	50	51.6 Å²	51.6	52%	0.515	29%	0.288	S	S	.	.	T	Hydrogen-bonded Turn	trans	97.2	-16.8	-175.1	0	0	0	0	0	114.6	T34 V84	T34-G36 PolarHBondContact O-N 2.87Å; G36-V84 PolarHBondContact N-O 2.79Å
37	E	94.1	Very high	96.5	Very high	80 Å²	80	52.7 Å²	52.7	37%	0.374	29%	0.29	S	S	.	.			trans	-73.4	168	178.2	-68.5	-169	99.8	0	0	113.3	T34 V84	T34-E37 PolarHBondContact N-OE2 3.21Å; T34-E37 WeakPolarHBondContact O-CB 3.39Å; T34-E37 WeakPolarHBondContact O-CG 3.27Å; T34-E37 PolarHBondContact O-N 3.27Å; T34-E37 WeakPolarHBondContact OG1-CG 2.9Å; T34-E37 PolarHBondContact OG1-OE2 3.2Å; E37-V84 HydrophobicContact CB-CG2 4.26Å; E37-V84 WeakPolarHBondContact O-CG2 3.04Å; E37-V84 PolarHBondContact O-N 2.92Å
38	K	96.3	Very high	96.4	Very high	134 Å²	134	55 Å²	55	58%	0.583	31%	0.305	S	S	*	.			trans	-100.6	128.7	171.8	176.4	173.5	-179.1	-176	0	109.5
39	V	97.2	Very high	96.3	Very high	0 Å²	0	49.4 Å²	49.4	0%	0	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	144.5	174.1	173.7	0	0	0	0	109.5	V27 Q28 V33 M81 V84 L114	V27-V39 HydrophobicContact CG2-CG1 3.49Å; V27-V39 VanDerWaalsContact CG2-CG1 3.49Å; Q28-V39 WeakPolarHBondContact O-CA 3.25Å; V33-V39 HydrophobicContact CB-CG2 4.15Å; V33-V39 HydrophobicContact CG1-CG2 3.66Å; V33-V39 HydrophobicContact CG2-CG2 3.76Å; V39-M81 HydrophobicContact CB-CE 4.11Å; V39-M81 HydrophobicContact CG1-CE 3.63Å; V39-M81 PolarHBondContact N-O 2.81Å; V39-M81 PolarHBondContact O-N 2.82Å; V39-V84 HydrophobicContact CB-CG1 3.82Å; V39-V84 HydrophobicContact CG2-CG1 3.68Å; V39-L114 HydrophobicContact CG1-CD1 4.15Å; V39-L114 HydrophobicContact CG2-CD1 4.5Å
40	T	98.2	Very high	96.4	Very high	25 Å²	25	48.5 Å²	48.5	15%	0.153	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.1	123.1	168	-59.4	0	0	0	0	109.2	V27 Q28 E78	V27-T40 WeakPolarHBondContact CA-O 3.22Å; Q28-T40 PolarHBondContact N-O 3.04Å; Q28-T40 PolarHBondContact O-N 3.11Å; T40-E78 HydrophobicContact CG2-CB 3.82Å; T40-E78 HydrophobicContact CG2-CG 4.05Å
41	L	98.4	Very high	96.5	Very high	0 Å²	0	48.2 Å²	48.2	0%	0	26%	0.261	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.7	126	167.5	-74.2	166.1	0	0	0	108.8	L25 S26 V27 L54 F79 M81 Y92 L112	L25-L41 HydrophobicContact CD1-CB 4.26Å; L25-L41 HydrophobicContact CD1-CD2 4.31Å; S26-L41 CarbonylContact O-C 3.58Å; S26-L41 WeakPolarHBondContact O-CA 3.44Å; V27-L41 HydrophobicContact CB-CD2 3.85Å; V27-L41 HydrophobicContact CG2-CD2 3.92Å; L41-L54 HydrophobicContact CB-CD2 4.19Å; L41-L54 HydrophobicContact CD1-CD1 4.21Å; L41-L54 HydrophobicContact CD1-CD2 3.61Å; L41-L54 HydrophobicContact CD1-CG 4.48Å; L41-F79 HydrophobicContact CB-CB 4.23Å; L41-F79 PolarHBondContact N-O 2.89Å; L41-F79 PolarHBondContact O-N 2.95Å; L41-M81 HydrophobicContact CD1-CE 3.39Å; L41-M81 HydrophobicContact CD1-SD 4.19Å; L41-M81 HydrophobicContact CG-CE 3.73Å; L41-Y92 HydrophobicContact CD1-CD1 3.67Å; L41-Y92 HydrophobicContact CD1-CD2 4.18Å; L41-Y92 HydrophobicContact CD1-CE1 3.95Å; L41-Y92 HydrophobicContact CD1-CE2 4.47Å; L41-Y92 HydrophobicContact CD1-CG 3.78Å; L41-L112 HydrophobicContact CD2-CD1 4.07Å; L41-L112 HydrophobicContact CD2-CD2 3.75Å; L41-L112 HydrophobicContact CD2-CG 4.49Å
42	L	98.3	Very high	96.6	Very high	17 Å²	17	45.1 Å²	45.1	9%	0.089	24%	0.241	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	114.7	-176.7	172.6	67	0	0	0	109.5	S26 Q44 Q76 E78	S26-L42 PolarHBondContact N-O 2.93Å; S26-L42 PolarHBondContact O-N 3.45Å; S26-L42 WeakPolarHBondContact OG-CB 3.35Å; S26-L42 PolarHBondContact OG-O 2.86Å; L42-Q44 HydrophobicContact CD1-CG 4.05Å; L42-Q44 HydrophobicContact CD2-CG 4.12Å; L42-Q44 HydrophobicContact CG-CG 3.76Å; L42-Q76 HydrophobicContact CD1-CB 4Å; L42-Q76 HydrophobicContact CD1-CG 4.49Å; L42-E78 HydrophobicContact CD1-CG 3.68Å
43	C	98.3	Very high	96.7	Very high	0 Å²	0	40.9 Å²	40.9	0%	0	22%	0.215	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-98	135	172.3	-169.8	0	0	0	0	109.7	S24 L25 F52 Q76 A77 F79 C94	S24-C43 CarbonylContact O-C 3.55Å; S24-C43 WeakPolarHBondContact O-CA 3.41Å; L25-C43 HydrophobicContact CD1-CB 4.45Å; C43-F52 HydrophobicContact CB-CB 4.35Å; C43-F52 HydrophobicContact CB-CD1 4.07Å; C43-F52 HydrophobicContact CB-CG 4.19Å; C43-F52 WeakPolarHBondContact SG-CD1 3.42Å; C43-Q76 CarbonylContact O-C 3.48Å; C43-Q76 WeakPolarHBondContact O-CA 3.49Å; C43-A77 PolarHBondContact N-O 2.78Å; C43-A77 PolarHBondContact O-N 3.03Å; C43-F79 HydrophobicContact CB-CE2 4.21Å; C43-C94 HydrophobicContact CB-CB 3.61Å; C43-C94 WeakPolarHBondContact CB-SG 3.46Å; C43-C94 WeakPolarHBondContact SG-CB 3.26Å; C43-C94 CovalentContact SG-SG 2.04Å; C43-C94 PolarHBondContact SG-SG 2.91Å
44	Q	98.2	Very high	96.8	Very high	32 Å²	32	40.9 Å²	40.9	15%	0.15	21%	0.214	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-139.2	150.5	-178.2	-48.1	-176.9	-64	0	0	112.2	P23 S24 L42 K74 Y75 Q76	P23-Q44 CarbonylContact C-O 3.45Å; P23-Q44 WeakPolarHBondContact CA-O 3.48Å; P23-Q44 VanDerWaalsContact CB-O 3.23Å; P23-Q44 WeakPolarHBondContact CB-O 3.37Å; S24-Q44 PolarHBondContact N-O 2.66Å; S24-Q44 PolarHBondContact O-N 2.83Å; S24-Q44 PolarHBondContact OG-O 3.32Å; L42-Q44 HydrophobicContact CD1-CG 4.05Å; L42-Q44 HydrophobicContact CD2-CG 4.12Å; L42-Q44 HydrophobicContact CG-CG 3.76Å; Q44-K74 HydrophobicContact CB-CD 4.24Å; Q44-Y75 CarbonylContact C-O 3.47Å; Q44-Y75 VanDerWaalsContact CA-O 3.24Å; Q44-Y75 WeakPolarHBondContact CA-O 3.45Å; Q44-Q76 HydrophobicContact CB-CB 4.36Å; Q44-Q76 HydrophobicContact CG-CB 3.86Å
45	S	97.9	Very high	97	Very high	4 Å²	4	39.4 Å²	39.4	3%	0.028	21%	0.205	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-140.5	147.2	173.7	172.1	0	0	0	0	110.1	D21 D47 Y75	D21-S45 PolarHBondContact OD1-OG 3.38Å; D21-S45 PolarHBondContact OD2-OG 2.98Å; S45-D47 WeakPolarHBondContact CB-O 3.31Å; S45-D47 PolarHBondContact OG-N 3.21Å; S45-D47 PolarHBondContact OG-O 3.47Å; S45-Y75 PolarHBondContact N-O 3.45Å; S45-Y75 PolarHBondContact O-N 2.75Å
46	W	96.1	Very high	97	Very high	172 Å²	172	40.7 Å²	40.7	65%	0.652	21%	0.207	S	C	*	.	S	Bend	trans	-77.6	-40.7	165.5	-68.4	105.6	0	0	0	110.9	H73 K74	W46-H73 VanDerWaalsContact CE3-O 3.32Å; W46-H73 HydrophobicContact CZ3-CB 4.18Å; W46-H73 WeakPolarHBondContact CZ3-O 3.47Å; W46-K74 HydrophobicContact CD2-CG 4.06Å; W46-K74 HydrophobicContact CE3-CG 3.83Å; W46-K74 HydrophobicContact CH2-CG 4.26Å; W46-K74 HydrophobicContact CZ2-CD 4.42Å; W46-K74 HydrophobicContact CZ2-CG 4.47Å; W46-K74 HydrophobicContact CZ3-CG 3.93Å
47	D	94.7	Very high	97.1	Very high	65 Å²	65	44 Å²	44	35%	0.348	21%	0.209	S	C	.	.	S	Bend	trans	-71.2	144.7	177.3	-77.6	-14.3	0	0	0	111.3	D21 S45 M49	D21-D47 HydrophobicContact CB-CB 3.96Å; S45-D47 WeakPolarHBondContact CB-O 3.31Å; S45-D47 PolarHBondContact OG-N 3.21Å; S45-D47 PolarHBondContact OG-O 3.47Å; D47-M49 HydrophobicContact CB-CE 3.69Å; D47-M49 PolarHBondContact O-N 3.28Å; D47-M49 VanDerWaalsContact O-N 3.1Å
48	P	94.9	Very high	97	Very high	70 Å²	70	44.3 Å²	44.3	46%	0.455	23%	0.234	S	C	.	.			trans	-58.2	115.4	177.8	-24.7	33.9	0	0	0	113.2	Y75	P48-Y75 VanDerWaalsContact CA-CE2 3.46Å; P48-Y75 HydrophobicContact CB-CE1 4.19Å; P48-Y75 HydrophobicContact CB-CE2 3.89Å; P48-Y75 HydrophobicContact CG-CE2 3.84Å
49	M	96.3	Very high	96.7	Very high	7 Å²	7	40.2 Å²	40.2	3%	0.034	23%	0.225	C	C	.	.			trans	-110.5	150.4	169.2	-61.8	-55.4	133.4	0	0	109.3	I19 D21 D47 F52 S68	I19-M49 HydrophobicContact CG2-CE 4.26Å; D21-M49 HydrophobicContact CB-CE 3.74Å; D47-M49 HydrophobicContact CB-CE 3.69Å; D47-M49 PolarHBondContact O-N 3.28Å; D47-M49 VanDerWaalsContact O-N 3.1Å; M49-F52 HydrophobicContact CB-CE1 4.11Å; M49-F52 HydrophobicContact CB-CE2 4.01Å; M49-F52 HydrophobicContact CB-CZ 3.74Å; M49-F52 HydrophobicContact CG-CE1 3.87Å; M49-F52 HydrophobicContact CG-CZ 3.79Å; M49-S68 PolarHBondContact O-OG 2.87Å
50	F	97.1	Very high	96.2	Very high	79 Å²	79	45.2 Å²	45.2	35%	0.346	27%	0.266	S	S	.	.	S	Bend	trans	-99.1	-41.9	175.3	-179.9	-102.6	0	0	0	111.4	S68 S97	F50-S68 PolarHBondContact O-N 2.77Å; F50-S68 PolarHBondContact O-OG 3.21Å; F50-S68 VanDerWaalsContact O-OG 3.11Å; F50-S97 PolarHBondContact N-O 3.11Å
51	T	97.9	Very high	95.7	Very high	9 Å²	9	51.6 Å²	51.6	6%	0.055	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	149.8	173.1	42.2	0	0	0	0	110.2	R65 L66 S97	T51-R65 HydrophobicContact CG2-CG 4.28Å; T51-R65 PolarHBondContact OG1-NE 2.9Å; T51-R65 VanDerWaalsContact OG1-NE 3.13Å; T51-R65 PolarHBondContact OG1-NH2 2.7Å; T51-R65 VanDerWaalsContact OG1-NH2 3.11Å; T51-L66 CarbonylContact C-O 3.55Å; T51-L66 WeakPolarHBondContact CA-O 3.22Å; T51-L66 WeakPolarHBondContact CB-O 3.36Å; T51-S97 PolarHBondContact N-O 3.13Å; T51-S97 PolarHBondContact O-N 2.86Å; T51-S97 PolarHBondContact OG1-OG 2.84Å
52	F	98.4	Very high	95.2	Very high	0 Å²	0	56.6 Å²	56.6	0%	0	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109	146.9	166	-73.6	-75.8	0	0	0	109.9	P23 C43 M49 R65 L66 Y75 A77 F79 Y95	P23-F52 HydrophobicContact CB-CE1 3.95Å; C43-F52 HydrophobicContact CB-CB 4.35Å; C43-F52 HydrophobicContact CB-CD1 4.07Å; C43-F52 HydrophobicContact CB-CG 4.19Å; C43-F52 WeakPolarHBondContact SG-CD1 3.42Å; M49-F52 HydrophobicContact CB-CE1 4.11Å; M49-F52 HydrophobicContact CB-CE2 4.01Å; M49-F52 HydrophobicContact CB-CZ 3.74Å; M49-F52 HydrophobicContact CG-CE1 3.87Å; M49-F52 HydrophobicContact CG-CZ 3.79Å; F52-R65 WeakPolarHBondContact O-CA 3.35Å; F52-L66 PolarHBondContact N-O 2.68Å; F52-L66 PolarHBondContact O-N 2.8Å; F52-Y75 WeakPolarHBondContact CZ-O 3.42Å; F52-A77 HydrophobicContact CB-CB 3.83Å; F52-A77 HydrophobicContact CD2-CB 3.7Å; F52-A77 HydrophobicContact CG-CB 4.15Å; F52-F79 HydrophobicContact CB-CE2 4.23Å; F52-F79 HydrophobicContact CB-CZ 4.11Å; F52-Y95 CarbonylContact C-O 3.59Å; F52-Y95 VanDerWaalsContact CA-O 3.26Å; F52-Y95 WeakPolarHBondContact CA-O 3.09Å; F52-Y95 WeakPolarHBondContact CD1-O 3.22Å
53	L	98.1	Very high	95	Very high	4 Å²	4	58.1 Å²	58.1	2%	0.021	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	137.6	176.1	-63.2	82.8	0	0	0	109	L14 P63 L64 R65 C94 Y95 L105	L14-L53 HydrophobicContact CD1-CD2 3.49Å; L14-L53 VanDerWaalsContact CD1-CD2 3.49Å; L53-P63 HydrophobicContact CB-CB 4.39Å; L53-P63 HydrophobicContact CD2-CB 4.3Å; L53-P63 HydrophobicContact CD2-CG 4.09Å; L53-L64 CarbonylContact C-O 3.52Å; L53-L64 WeakPolarHBondContact CA-O 3.17Å; L53-R65 HydrophobicContact CG-CB 4.31Å; L53-R65 HydrophobicContact CG-CG 4.13Å; L53-C94 CarbonylContact O-C 3.51Å; L53-C94 WeakPolarHBondContact O-CA 3.21Å; L53-C94 WeakPolarHBondContact O-CB 3.49Å; L53-Y95 PolarHBondContact N-O 2.8Å; L53-Y95 PolarHBondContact O-N 2.68Å; L53-L105 HydrophobicContact CD1-CD2 3.74Å; L53-L105 HydrophobicContact CD2-CD1 4.38Å; L53-L105 HydrophobicContact CD2-CD2 4.04Å
54	L	98.4	Very high	94.9	Very high	5 Å²	5	63.1 Å²	63.1	3%	0.026	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	123.1	174.7	-175.4	73.8	0	0	0	109	L25 L41 P63 L64 F79 Y92 C94	L25-L54 HydrophobicContact CD1-CD1 4.03Å; L25-L54 HydrophobicContact CD2-CD1 4.14Å; L41-L54 HydrophobicContact CB-CD2 4.19Å; L41-L54 HydrophobicContact CD1-CD1 4.21Å; L41-L54 HydrophobicContact CD1-CD2 3.61Å; L41-L54 HydrophobicContact CD1-CG 4.48Å; L54-P63 WeakPolarHBondContact O-CA 3.4Å; L54-L64 HydrophobicContact CB-CB 4.38Å; L54-L64 PolarHBondContact N-O 2.92Å; L54-L64 PolarHBondContact O-N 2.98Å; L54-F79 HydrophobicContact CB-CD1 3.81Å; L54-F79 HydrophobicContact CB-CD2 4.16Å; L54-F79 HydrophobicContact CB-CE1 3.71Å; L54-F79 HydrophobicContact CB-CE2 4.08Å; L54-F79 HydrophobicContact CB-CG 4.03Å; L54-F79 HydrophobicContact CB-CZ 3.86Å; L54-F79 HydrophobicContact CD2-CB 3.71Å; L54-F79 HydrophobicContact CD2-CD1 4.05Å; L54-F79 HydrophobicContact CD2-CD2 4.26Å; L54-F79 HydrophobicContact CD2-CG 3.76Å; L54-F79 HydrophobicContact CG-CG 4.45Å; L54-Y92 HydrophobicContact CD1-CD1 4.15Å; L54-Y92 HydrophobicContact CD2-CD1 4.03Å; L54-Y92 HydrophobicContact CD2-CE1 4.34Å; L54-Y92 HydrophobicContact CG-CD1 4.01Å; L54-C94 HydrophobicContact CD1-CB 4.26Å
55	T	97.9	Very high	94.8	Very high	42 Å²	42	66.9 Å²	66.9	26%	0.258	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	144.2	176.5	56.5	0	0	0	0	109.9	P63 Y92 R93 Y95	T55-P63 HydrophobicContact CG2-CB 3.83Å; T55-Y92 VanDerWaalsContact O-CA 3.31Å; T55-Y92 WeakPolarHBondContact O-CA 3.49Å; T55-R93 PolarHBondContact N-O 2.96Å; T55-R93 PolarHBondContact O-N 2.7Å; T55-R93 PolarHBondContact OG1-O 2.89Å; T55-R93 VanDerWaalsContact OG1-O 3.13Å; T55-Y95 HydrophobicContact CG2-CD2 4.33Å; T55-Y95 HydrophobicContact CG2-CE2 3.97Å; T55-Y95 WeakPolarHBondContact OG1-CE2 3.38Å
56	K	97.3	Very high	94.8	Very high	59 Å²	59	70 Å²	70	26%	0.257	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	133	166.6	-174.5	-168.9	-177.2	-167.6	0	108.9	G58 A59 A87 A89 T91 Y92	K56-G58 PolarHBondContact O-N 3.45Å; K56-A59 HydrophobicContact CB-CB 4.04Å; K56-A59 VanDerWaalsContact O-CB 3.3Å; K56-A59 WeakPolarHBondContact O-CB 3.49Å; K56-A59 PolarHBondContact O-N 3.13Å; K56-A87 PolarHBondContact NZ-O 2.89Å; K56-A89 WeakPolarHBondContact CE-O 3.41Å; K56-A89 PolarHBondContact NZ-O 2.76Å; K56-T91 WeakPolarHBondContact CA-O 3.31Å; K56-Y92 HydrophobicContact CB-CD1 4.01Å; K56-Y92 HydrophobicContact CB-CE1 3.74Å; K56-Y92 HydrophobicContact CD-CE1 4.36Å; K56-Y92 HydrophobicContact CD-CE2 4.48Å; K56-Y92 HydrophobicContact CG-CD1 4.42Å; K56-Y92 HydrophobicContact CG-CE1 4.02Å; K56-Y92 HydrophobicContact CG-CE2 4.23Å
57	E	95.8	Very high	94.9	Very high	121 Å²	121	70.6 Å²	70.6	57%	0.565	39%	0.394	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.1	134	177.8	-167	162.9	162.4	0	0	111.1	A59 T91 R93	E57-A59 PolarHBondContact O-N 2.81Å; E57-T91 PolarHBondContact N-O 3.33Å; E57-R93 IonicContact OE2-CZ 2.83Å; E57-R93 IonicContact OE2-NH1 2.81Å; E57-R93 PolarHBondContact OE2-NH1 2.87Å; E57-R93 IonicContact OE2-NH2 3.94Å
58	G	91.5	Very high	95	Very high	86 Å²	86	68.3 Å²	68.3	89%	0.887	38%	0.383	S	S	*	.	T	Hydrogen-bonded Turn	trans	71.8	6.5	-177.7	0	0	0	0	0	115.7	K56	K56-G58 PolarHBondContact O-N 3.45Å
59	A	90.4	Very high	95.2	Very high	48 Å²	48	70.4 Å²	70.4	40%	0.397	39%	0.388	S	S	.	.			trans	-75.9	132.5	176.8	0	0	0	0	0	111.9	K56 E57 H61	K56-A59 HydrophobicContact CB-CB 4.04Å; K56-A59 VanDerWaalsContact O-CB 3.3Å; K56-A59 WeakPolarHBondContact O-CB 3.49Å; K56-A59 PolarHBondContact O-N 3.13Å; E57-A59 PolarHBondContact O-N 2.81Å; A59-H61 VanDerWaalsContact C-N 3.31Å
60	A	87.1	Confident	95.2	Very high	104 Å²	104	76.9 Å²	76.9	86%	0.86	41%	0.413	S	S	*	.			trans	-78.5	-17.4	172.2	0	0	0	0	0	113.1
61	H	85.9	Confident	95	Very high	159 Å²	159	74.2 Å²	74.2	74%	0.736	41%	0.408	S	S	*	.	S	Bend	trans	-80.4	149.9	-177.8	-57.7	97.4	0	0	0	111.4	A59	A59-H61 VanDerWaalsContact C-N 3.31Å
62	P	88.9	Confident	94.6	Very high	105 Å²	105	77.9 Å²	77.9	68%	0.682	44%	0.439	S	S	*	.	P	Polyproline II helix	trans	-55.4	152.3	172.6	-24.3	33.9	0	0	0	112.5
63	P	93.8	Very high	94.4	Very high	49 Å²	49	84.5 Å²	84.5	32%	0.318	47%	0.47	S	S	.	.	P	Polyproline II helix	trans	-58.8	141.2	174.3	23.6	-32.4	0	0	0	111.3	L14 L53 L54 T55 R65	L14-P63 HydrophobicContact CD1-CG 3.93Å; L53-P63 HydrophobicContact CB-CB 4.39Å; L53-P63 HydrophobicContact CD2-CB 4.3Å; L53-P63 HydrophobicContact CD2-CG 4.09Å; L54-P63 WeakPolarHBondContact O-CA 3.4Å; T55-P63 HydrophobicContact CG2-CB 3.83Å; P63-R65 PolarHBondContact O-N 2.84Å
64	L	96.3	Very high	94.3	Very high	105 Å²	105	86.6 Å²	86.6	55%	0.55	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.9	129.6	170.2	-65.5	175.5	0	0	0	108.5	L53 L54 F79	L53-L64 CarbonylContact C-O 3.52Å; L53-L64 WeakPolarHBondContact CA-O 3.17Å; L54-L64 HydrophobicContact CB-CB 4.38Å; L54-L64 PolarHBondContact N-O 2.92Å; L54-L64 PolarHBondContact O-N 2.98Å; L64-F79 HydrophobicContact CB-CD1 3.96Å; L64-F79 HydrophobicContact CB-CE1 3.95Å; L64-F79 HydrophobicContact CD1-CD1 4.48Å; L64-F79 WeakPolarHBondContact O-CE1 3.46Å
65	R	96.8	Very high	94.3	Very high	111 Å²	111	89.4 Å²	89.4	42%	0.419	49%	0.49	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	125.2	-177.9	-176.4	174.9	179.3	-167.8	-2	110.6	T51 F52 L53 P63	T51-R65 HydrophobicContact CG2-CG 4.28Å; T51-R65 PolarHBondContact OG1-NE 2.9Å; T51-R65 VanDerWaalsContact OG1-NE 3.13Å; T51-R65 PolarHBondContact OG1-NH2 2.7Å; T51-R65 VanDerWaalsContact OG1-NH2 3.11Å; F52-R65 WeakPolarHBondContact O-CA 3.35Å; L53-R65 HydrophobicContact CG-CB 4.31Å; L53-R65 HydrophobicContact CG-CG 4.13Å; P63-R65 PolarHBondContact O-N 2.84Å
66	L	98.1	Very high	94.3	Very high	69 Å²	69	88.9 Å²	88.9	36%	0.361	48%	0.484	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128	148.1	178.1	-67.4	-179.9	0	0	0	111	T51 F52 A77 E78 F79	T51-L66 CarbonylContact C-O 3.55Å; T51-L66 WeakPolarHBondContact CA-O 3.22Å; T51-L66 WeakPolarHBondContact CB-O 3.36Å; F52-L66 PolarHBondContact N-O 2.68Å; F52-L66 PolarHBondContact O-N 2.8Å; L66-A77 HydrophobicContact CB-CB 4.1Å; L66-E78 WeakPolarHBondContact CD1-O 3.43Å; L66-F79 HydrophobicContact CB-CE1 3.99Å; L66-F79 HydrophobicContact CB-CZ 4.08Å; L66-F79 HydrophobicContact CD1-CD1 3.49Å; L66-F79 VanDerWaalsContact CD1-CD1 3.49Å; L66-F79 HydrophobicContact CD1-CD2 4.45Å; L66-F79 HydrophobicContact CD1-CE1 3.61Å; L66-F79 HydrophobicContact CD1-CG 3.95Å; L66-F79 HydrophobicContact CD1-CZ 4.15Å; L66-F79 HydrophobicContact CG-CD1 3.93Å; L66-F79 HydrophobicContact CG-CE1 3.58Å; L66-F79 HydrophobicContact CG-CZ 4.17Å
67	R	97.7	Very high	94.4	Very high	185 Å²	185	86.2 Å²	86.2	70%	0.698	47%	0.473	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-69.3	137.1	172.5	-169.2	176	-179.7	-178.8	-1.2	109.3
68	S	97.5	Very high	94.5	Very high	18 Å²	18	85 Å²	85	13%	0.126	47%	0.468	C	S	.	.			trans	-70.8	144.9	174.6	62	0	0	0	0	111	M49 F50 Q76	M49-S68 PolarHBondContact O-OG 2.87Å; F50-S68 PolarHBondContact O-N 2.77Å; F50-S68 PolarHBondContact O-OG 3.21Å; F50-S68 VanDerWaalsContact O-OG 3.11Å; S68-Q76 CarbonylContact C-O 3.59Å; S68-Q76 WeakPolarHBondContact CA-O 2.98Å
69	M	97.5	Very high	94.8	Very high	114 Å²	114	81.2 Å²	81.2	56%	0.562	43%	0.427	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-110.2	146.6	165	-61.4	-171.4	-62.2	0	0	109.3	Y75 Q76	M69-Y75 CarbonylContact O-C 3.57Å; M69-Y75 WeakPolarHBondContact O-CA 3.4Å; M69-Q76 PolarHBondContact N-O 2.88Å; M69-Q76 PolarHBondContact O-N 2.92Å
70	Y	96.3	Very high	95.1	Very high	142 Å²	142	83.1 Å²	83.1	56%	0.557	44%	0.435	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.2	122.3	173.3	-175.1	-106.6	0	0	0	109.6	K74 Y75	Y70-K74 WeakPolarHBondContact CA-O 3.48Å; Y70-K74 WeakPolarHBondContact CD2-O 3.45Å; Y70-Y75 HydrophobicContact CD2-CD1 4.24Å; Y70-Y75 AromaticContact CD2-CD2 3.95Å; Y70-Y75 HydrophobicContact CD2-CD2 3.95Å; Y70-Y75 HydrophobicContact CD2-CE1 4.05Å; Y70-Y75 AromaticContact CD2-CE2 3.72Å; Y70-Y75 HydrophobicContact CD2-CE2 3.72Å; Y70-Y75 HydrophobicContact CD2-CG 4.19Å; Y70-Y75 AromaticContact CD2-CZ 3.77Å; Y70-Y75 HydrophobicContact CE2-CD2 4.29Å; Y70-Y75 AromaticContact CE2-CE2 3.88Å; Y70-Y75 HydrophobicContact CE2-CE2 3.88Å
71	G	93.1	Very high	95.4	Very high	23 Å²	23	78.9 Å²	78.9	24%	0.237	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-159.3	148.2	-178.3	0	0	0	0	0	111.1	H73 K74	G71-H73 PolarHBondContact O-N 3.44Å; G71-H73 VanDerWaalsContact O-N 3.09Å; G71-K74 PolarHBondContact N-O 3Å; G71-K74 PolarHBondContact O-N 3.02Å
72	A	90.9	Very high	95.7	Very high	86 Å²	86	75.1 Å²	75.1	71%	0.711	39%	0.389	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.8	38.5	-178.8	0	0	0	0	0	114.1	K74	A72-K74 PolarHBondContact O-N 2.75Å
73	H	93.6	Very high	95.9	Very high	140 Å²	140	74 Å²	74	65%	0.648	38%	0.382	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.8	20.2	-177	-53.4	90.4	0	0	0	115.7	W46 G71	W46-H73 VanDerWaalsContact CE3-O 3.32Å; W46-H73 HydrophobicContact CZ3-CB 4.18Å; W46-H73 WeakPolarHBondContact CZ3-O 3.47Å; G71-H73 PolarHBondContact O-N 3.44Å; G71-H73 VanDerWaalsContact O-N 3.09Å
74	K	96.8	Very high	96	Very high	48 Å²	48	71.7 Å²	71.7	21%	0.209	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	156.2	177.4	-66.6	-177.4	-179.8	-177.5	0	111.4	Q44 W46 Y70 G71 A72	Q44-K74 HydrophobicContact CB-CD 4.24Å; W46-K74 HydrophobicContact CD2-CG 4.06Å; W46-K74 HydrophobicContact CE3-CG 3.83Å; W46-K74 HydrophobicContact CH2-CG 4.26Å; W46-K74 HydrophobicContact CZ2-CD 4.42Å; W46-K74 HydrophobicContact CZ2-CG 4.47Å; W46-K74 HydrophobicContact CZ3-CG 3.93Å; Y70-K74 WeakPolarHBondContact CA-O 3.48Å; Y70-K74 WeakPolarHBondContact CD2-O 3.45Å; G71-K74 PolarHBondContact N-O 3Å; G71-K74 PolarHBondContact O-N 3.02Å; A72-K74 PolarHBondContact O-N 2.75Å
75	Y	98	Very high	95.9	Very high	64 Å²	64	69.1 Å²	69.1	25%	0.251	36%	0.356	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.6	129.7	165.1	-65.9	-96.7	0	0	0	108.2	Q44 S45 P48 F52 M69 Y70	Q44-Y75 CarbonylContact C-O 3.47Å; Q44-Y75 VanDerWaalsContact CA-O 3.24Å; Q44-Y75 WeakPolarHBondContact CA-O 3.45Å; S45-Y75 PolarHBondContact N-O 3.45Å; S45-Y75 PolarHBondContact O-N 2.75Å; P48-Y75 VanDerWaalsContact CA-CE2 3.46Å; P48-Y75 HydrophobicContact CB-CE1 4.19Å; P48-Y75 HydrophobicContact CB-CE2 3.89Å; P48-Y75 HydrophobicContact CG-CE2 3.84Å; F52-Y75 WeakPolarHBondContact CZ-O 3.42Å; M69-Y75 CarbonylContact O-C 3.57Å; M69-Y75 WeakPolarHBondContact O-CA 3.4Å; Y70-Y75 HydrophobicContact CD2-CD1 4.24Å; Y70-Y75 AromaticContact CD2-CD2 3.95Å; Y70-Y75 HydrophobicContact CD2-CD2 3.95Å; Y70-Y75 HydrophobicContact CD2-CE1 4.05Å; Y70-Y75 AromaticContact CD2-CE2 3.72Å; Y70-Y75 HydrophobicContact CD2-CE2 3.72Å; Y70-Y75 HydrophobicContact CD2-CG 4.19Å; Y70-Y75 AromaticContact CD2-CZ 3.77Å; Y70-Y75 HydrophobicContact CE2-CD2 4.29Å; Y70-Y75 AromaticContact CE2-CE2 3.88Å; Y70-Y75 HydrophobicContact CE2-CE2 3.88Å
76	Q	97.9	Very high	95.8	Very high	31 Å²	31	68.4 Å²	68.4	15%	0.145	37%	0.368	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.6	156.4	-174.3	64.1	-176.4	31.8	0	0	113.8	L42 C43 Q44 S68 M69	L42-Q76 HydrophobicContact CD1-CB 4Å; L42-Q76 HydrophobicContact CD1-CG 4.49Å; C43-Q76 CarbonylContact O-C 3.48Å; C43-Q76 WeakPolarHBondContact O-CA 3.49Å; Q44-Q76 HydrophobicContact CB-CB 4.36Å; Q44-Q76 HydrophobicContact CG-CB 3.86Å; S68-Q76 CarbonylContact C-O 3.59Å; S68-Q76 WeakPolarHBondContact CA-O 2.98Å; M69-Q76 PolarHBondContact N-O 2.88Å; M69-Q76 PolarHBondContact O-N 2.92Å
77	A	98.2	Very high	95.5	Very high	2 Å²	2	68.5 Å²	68.5	2%	0.017	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.4	135.8	168.3	0	0	0	0	0	110.4	C43 F52 L66 F79	C43-A77 PolarHBondContact N-O 2.78Å; C43-A77 PolarHBondContact O-N 3.03Å; F52-A77 HydrophobicContact CB-CB 3.83Å; F52-A77 HydrophobicContact CD2-CB 3.7Å; F52-A77 HydrophobicContact CG-CB 4.15Å; L66-A77 HydrophobicContact CB-CB 4.1Å; A77-F79 HydrophobicContact CB-CE2 3.92Å; A77-F79 HydrophobicContact CB-CZ 4.3Å
78	E	98.1	Very high	95.4	Very high	97 Å²	97	62.4 Å²	62.4	45%	0.453	36%	0.358	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	124.6	177.4	-72.7	174.9	-155.3	0	0	109.8	T40 L42 L66 P80	T40-E78 HydrophobicContact CG2-CB 3.82Å; T40-E78 HydrophobicContact CG2-CG 4.05Å; L42-E78 HydrophobicContact CD1-CG 3.68Å; L66-E78 WeakPolarHBondContact CD1-O 3.43Å; E78-P80 WeakPolarHBondContact O-CD 3.44Å
79	F	97.9	Very high	95.3	Very high	5 Å²	5	63.1 Å²	63.1	2%	0.022	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.6	90.5	176.4	-62.3	-93.7	0	0	0	108.6	L41 C43 F52 L54 L64 L66 A77	L41-F79 HydrophobicContact CB-CB 4.23Å; L41-F79 PolarHBondContact N-O 2.89Å; L41-F79 PolarHBondContact O-N 2.95Å; C43-F79 HydrophobicContact CB-CE2 4.21Å; F52-F79 HydrophobicContact CB-CE2 4.23Å; F52-F79 HydrophobicContact CB-CZ 4.11Å; L54-F79 HydrophobicContact CB-CD1 3.81Å; L54-F79 HydrophobicContact CB-CD2 4.16Å; L54-F79 HydrophobicContact CB-CE1 3.71Å; L54-F79 HydrophobicContact CB-CE2 4.08Å; L54-F79 HydrophobicContact CB-CG 4.03Å; L54-F79 HydrophobicContact CB-CZ 3.86Å; L54-F79 HydrophobicContact CD2-CB 3.71Å; L54-F79 HydrophobicContact CD2-CD1 4.05Å; L54-F79 HydrophobicContact CD2-CD2 4.26Å; L54-F79 HydrophobicContact CD2-CG 3.76Å; L54-F79 HydrophobicContact CG-CG 4.45Å; L64-F79 HydrophobicContact CB-CD1 3.96Å; L64-F79 HydrophobicContact CB-CE1 3.95Å; L64-F79 HydrophobicContact CD1-CD1 4.48Å; L64-F79 WeakPolarHBondContact O-CE1 3.46Å; L66-F79 HydrophobicContact CB-CE1 3.99Å; L66-F79 HydrophobicContact CB-CZ 4.08Å; L66-F79 HydrophobicContact CD1-CD1 3.49Å; L66-F79 VanDerWaalsContact CD1-CD1 3.49Å; L66-F79 HydrophobicContact CD1-CD2 4.45Å; L66-F79 HydrophobicContact CD1-CE1 3.61Å; L66-F79 HydrophobicContact CD1-CG 3.95Å; L66-F79 HydrophobicContact CD1-CZ 4.15Å; L66-F79 HydrophobicContact CG-CD1 3.93Å; L66-F79 HydrophobicContact CG-CE1 3.58Å; L66-F79 HydrophobicContact CG-CZ 4.17Å; A77-F79 HydrophobicContact CB-CE2 3.92Å; A77-F79 HydrophobicContact CB-CZ 4.3Å
80	P	96.9	Very high	95.3	Very high	88 Å²	88	58.8 Å²	58.8	57%	0.571	35%	0.349	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.2	140.4	178.5	30.1	-34.8	0	0	0	111.2	E78	E78-P80 WeakPolarHBondContact O-CD 3.44Å
81	M	94.4	Very high	95.3	Very high	15 Å²	15	53.8 Å²	53.8	7%	0.074	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129	112.2	174.3	-64.1	-177.2	-67.3	0	0	108.1	V39 L41 V84 L114	V39-M81 HydrophobicContact CB-CE 4.11Å; V39-M81 HydrophobicContact CG1-CE 3.63Å; V39-M81 PolarHBondContact N-O 2.81Å; V39-M81 PolarHBondContact O-N 2.82Å; L41-M81 HydrophobicContact CD1-CE 3.39Å; L41-M81 HydrophobicContact CD1-SD 4.19Å; L41-M81 HydrophobicContact CG-CE 3.73Å; M81-V84 HydrophobicContact CB-CG1 3.99Å; M81-L114 HydrophobicContact CE-CD2 3.71Å
82	S	91.8	Very high	95.6	Very high	81 Å²	81	53.3 Å²	53.3	57%	0.566	33%	0.325	S	S	*	.			trans	-157.2	128.9	-175.9	-173.4	0	0	0	0	110.8
83	P	93.5	Very high	96	Very high	81 Å²	81	52.7 Å²	52.7	53%	0.526	30%	0.304	S	S	.	.	S	Bend	cis	-71.4	144.1	-15.7	29.3	-32.1	0	0	0	111.5
84	V	95.1	Very high	96.2	Very high	0 Å²	0	46 Å²	46	0%	0	27%	0.273	C	S	.	.			trans	-73.3	150.4	172.5	-59.9	0	0	0	0	111.4	V33 T34 S35 G36 E37 V39 M81 V116	V33-V84 HydrophobicContact CG2-CG2 3.95Å; T34-V84 VanDerWaalsContact O-CG2 3.27Å; T34-V84 WeakPolarHBondContact O-CG2 3.3Å; S35-V84 PolarHBondContact OG-O 2.83Å; G36-V84 PolarHBondContact N-O 2.79Å; E37-V84 HydrophobicContact CB-CG2 4.26Å; E37-V84 WeakPolarHBondContact O-CG2 3.04Å; E37-V84 PolarHBondContact O-N 2.92Å; V39-V84 HydrophobicContact CB-CG1 3.82Å; V39-V84 HydrophobicContact CG2-CG1 3.68Å; M81-V84 HydrophobicContact CB-CG1 3.99Å; V84-V116 HydrophobicContact CG2-CG1 4.23Å
85	T	94.4	Very high	96.3	Very high	52 Å²	52	45.4 Å²	45.4	32%	0.319	27%	0.27	S	S	.	.			trans	-139.4	170.8	178.9	65.6	0	0	0	0	109.1	A87 H88	T85-A87 PolarHBondContact O-N 3.41Å; T85-A87 VanDerWaalsContact O-N 3.11Å; T85-H88 PolarHBondContact N-ND1 2.83Å; T85-H88 WeakPolarHBondContact O-CB 3.19Å; T85-H88 PolarHBondContact O-N 2.83Å; T85-H88 PolarHBondContact OG1-CE1 3.27Å; T85-H88 PolarHBondContact OG1-ND1 2.95Å
86	S	93.1	Very high	96.3	Very high	96 Å²	96	42.4 Å²	42.4	67%	0.671	26%	0.258	S	S	*	.	G	3₁₀ helix	trans	-54.9	-30	176	57.8	0	0	0	0	113.4	H88 A89	S86-H88 PolarHBondContact O-N 2.79Å; S86-A89 WeakPolarHBondContact O-CB 3.4Å; S86-A89 PolarHBondContact O-N 2.96Å
87	A	92.9	Very high	96.3	Very high	71 Å²	71	40.9 Å²	40.9	59%	0.587	25%	0.251	S	S	*	.	G	3₁₀ helix	trans	-63.8	-20	174.9	0	0	0	0	0	113.5	K56 T85	K56-A87 PolarHBondContact NZ-O 2.89Å; T85-A87 PolarHBondContact O-N 3.41Å; T85-A87 VanDerWaalsContact O-N 3.11Å
88	H	94.9	Very high	96.1	Very high	56 Å²	56	46.2 Å²	46.2	26%	0.259	27%	0.27	S	S	.	.	G	3₁₀ helix	trans	-85.2	-13.3	175.2	-59.9	89.6	0	0	0	112.7	T85 S86 Y92	T85-H88 PolarHBondContact N-ND1 2.83Å; T85-H88 WeakPolarHBondContact O-CB 3.19Å; T85-H88 PolarHBondContact O-N 2.83Å; T85-H88 PolarHBondContact OG1-CE1 3.27Å; T85-H88 PolarHBondContact OG1-ND1 2.95Å; S86-H88 PolarHBondContact O-N 2.79Å; H88-Y92 WeakPolarHBondContact O-CE2 3.09Å; H88-Y92 PolarHBondContact O-OH 2.88Å
89	A	95.8	Very high	95.9	Very high	34 Å²	34	45.6 Å²	45.6	28%	0.281	28%	0.277	S	S	.	.			trans	-67.9	139.6	177.3	0	0	0	0	0	111.6	K56 S86 L114 V116	K56-A89 WeakPolarHBondContact CE-O 3.41Å; K56-A89 PolarHBondContact NZ-O 2.76Å; S86-A89 WeakPolarHBondContact O-CB 3.4Å; S86-A89 PolarHBondContact O-N 2.96Å; A89-L114 CarbonylContact C-O 3.58Å; A89-L114 VanDerWaalsContact CA-O 3.25Å; A89-L114 WeakPolarHBondContact CA-O 3.27Å; A89-V116 HydrophobicContact CB-CB 4.22Å; A89-V116 HydrophobicContact CB-CG2 4.06Å
90	G	96.7	Very high	95.7	Very high	22 Å²	22	50.3 Å²	50.3	23%	0.227	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	148.4	-172.6	175.6	0	0	0	0	0	113.9	Y92 L114	G90-Y92 WeakPolarHBondContact O-CD2 3.36Å; G90-L114 PolarHBondContact N-O 3.47Å; G90-L114 PolarHBondContact O-N 3.16Å
91	T	98.4	Very high	95.5	Very high	37 Å²	37	49 Å²	49	23%	0.227	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93	124.8	-177.3	-50.2	0	0	0	0	111.4	K56 E57 P111 L112	K56-T91 WeakPolarHBondContact CA-O 3.31Å; E57-T91 PolarHBondContact N-O 3.33Å; T91-P111 HydrophobicContact CG2-CB 3.64Å; T91-L112 CarbonylContact C-O 3.53Å; T91-L112 WeakPolarHBondContact CA-O 3.23Å
92	Y	98.4	Very high	95.4	Very high	14 Å²	14	50.1 Å²	50.1	6%	0.055	31%	0.307	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	146.1	179.4	-69.4	-94.8	0	0	0	111.4	L41 L54 T55 K56 H88 G90 P111 L112 L114	L41-Y92 HydrophobicContact CD1-CD1 3.67Å; L41-Y92 HydrophobicContact CD1-CD2 4.18Å; L41-Y92 HydrophobicContact CD1-CE1 3.95Å; L41-Y92 HydrophobicContact CD1-CE2 4.47Å; L41-Y92 HydrophobicContact CD1-CG 3.78Å; L54-Y92 HydrophobicContact CD1-CD1 4.15Å; L54-Y92 HydrophobicContact CD2-CD1 4.03Å; L54-Y92 HydrophobicContact CD2-CE1 4.34Å; L54-Y92 HydrophobicContact CG-CD1 4.01Å; T55-Y92 VanDerWaalsContact O-CA 3.31Å; T55-Y92 WeakPolarHBondContact O-CA 3.49Å; K56-Y92 HydrophobicContact CB-CD1 4.01Å; K56-Y92 HydrophobicContact CB-CE1 3.74Å; K56-Y92 HydrophobicContact CD-CE1 4.36Å; K56-Y92 HydrophobicContact CD-CE2 4.48Å; K56-Y92 HydrophobicContact CG-CD1 4.42Å; K56-Y92 HydrophobicContact CG-CE1 4.02Å; K56-Y92 HydrophobicContact CG-CE2 4.23Å; H88-Y92 WeakPolarHBondContact O-CE2 3.09Å; H88-Y92 PolarHBondContact O-OH 2.88Å; G90-Y92 WeakPolarHBondContact O-CD2 3.36Å; Y92-P111 WeakPolarHBondContact O-CA 3.36Å; Y92-L112 PolarHBondContact N-O 3.26Å; Y92-L112 PolarHBondContact O-N 3.16Å; Y92-L114 HydrophobicContact CD2-CB 4.14Å; Y92-L114 HydrophobicContact CE2-CB 3.95Å; Y92-L114 HydrophobicContact CE2-CD2 4.19Å
93	R	98.6	Very high	95.6	Very high	72 Å²	72	51.5 Å²	51.5	27%	0.272	30%	0.301	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.9	148.1	169.3	-70.5	179.9	179.7	84.6	-2.5	109.2	T55 E57 Y95 P111	T55-R93 PolarHBondContact N-O 2.96Å; T55-R93 PolarHBondContact O-N 2.7Å; T55-R93 PolarHBondContact OG1-O 2.89Å; T55-R93 VanDerWaalsContact OG1-O 3.13Å; E57-R93 IonicContact OE2-CZ 2.83Å; E57-R93 IonicContact OE2-NH1 2.81Å; E57-R93 PolarHBondContact OE2-NH1 2.87Å; E57-R93 IonicContact OE2-NH2 3.94Å; R93-Y95 HydrophobicContact CB-CE2 4.2Å; R93-P111 HydrophobicContact CG-CB 4.4Å
94	C	98.2	Very high	95.8	Very high	0 Å²	0	50.2 Å²	50.2	0%	0	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	153.9	173.4	82.9	0	0	0	0	113.1	L25 C43 L53 L54 S109	L25-C94 HydrophobicContact CD1-CB 4.12Å; L25-C94 HydrophobicContact CD2-CB 4.47Å; C43-C94 HydrophobicContact CB-CB 3.61Å; C43-C94 WeakPolarHBondContact CB-SG 3.46Å; C43-C94 WeakPolarHBondContact SG-CB 3.26Å; C43-C94 CovalentContact SG-SG 2.04Å; C43-C94 PolarHBondContact SG-SG 2.91Å; L53-C94 CarbonylContact O-C 3.51Å; L53-C94 WeakPolarHBondContact O-CA 3.21Å; L53-C94 WeakPolarHBondContact O-CB 3.49Å; L54-C94 HydrophobicContact CD1-CB 4.26Å; C94-S109 PolarHBondContact N-OG 2.91Å; C94-S109 PolarHBondContact O-N 2.92Å
95	Y	98.5	Very high	95.9	Very high	36 Å²	36	50.7 Å²	50.7	14%	0.141	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.7	146.6	-178.3	-58.2	-98.3	0	0	0	109.8	A16 F52 L53 T55 R93 L105 P108	A16-Y95 HydrophobicContact CB-CD1 4.37Å; A16-Y95 HydrophobicContact CB-CE1 3.85Å; F52-Y95 CarbonylContact C-O 3.59Å; F52-Y95 VanDerWaalsContact CA-O 3.26Å; F52-Y95 WeakPolarHBondContact CA-O 3.09Å; F52-Y95 WeakPolarHBondContact CD1-O 3.22Å; L53-Y95 PolarHBondContact N-O 2.8Å; L53-Y95 PolarHBondContact O-N 2.68Å; T55-Y95 HydrophobicContact CG2-CD2 4.33Å; T55-Y95 HydrophobicContact CG2-CE2 3.97Å; T55-Y95 WeakPolarHBondContact OG1-CE2 3.38Å; R93-Y95 HydrophobicContact CB-CE2 4.2Å; Y95-L105 HydrophobicContact CD1-CB 4.15Å; Y95-L105 HydrophobicContact CD1-CD1 4.11Å; Y95-L105 HydrophobicContact CG-CB 4.47Å; Y95-L105 HydrophobicContact CG-CD1 3.99Å; Y95-P108 HydrophobicContact CD1-CB 4.3Å; Y95-P108 HydrophobicContact CE1-CB 3.54Å; Y95-P108 HydrophobicContact CE1-CG 4.3Å
96	G	98	Very high	96.1	Very high	0 Å²	0	48.2 Å²	48.2	0%	0	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98	149.8	168.1	0	0	0	0	0	111.6	L105 S106	G96-L105 CarbonylContact O-C 3.52Å; G96-L105 WeakPolarHBondContact O-CA 3.33Å; G96-S106 PolarHBondContact N-OG 3.22Å; G96-S106 PolarHBondContact O-N 2.89Å
97	S	97.6	Very high	96.3	Very high	0 Å²	0	47.4 Å²	47.4	0%	0	26%	0.262	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.3	156.6	168.2	70	0	0	0	0	112.2	F50 T51	F50-S97 PolarHBondContact N-O 3.11Å; T51-S97 PolarHBondContact N-O 3.13Å; T51-S97 PolarHBondContact O-N 2.86Å; T51-S97 PolarHBondContact OG1-OG 2.84Å
98	R	95.6	Very high	96.6	Very high	113 Å²	113	45.6 Å²	45.6	43%	0.426	24%	0.244	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	155.7	-179.6	-69.7	178.5	170.5	-175.2	-0.3	110.5	I19 S100 N101	I19-R98 HydrophobicContact CD1-CG 4Å; R98-S100 PolarHBondContact O-N 2.04Å; R98-N101 CarbonylContact O-C 3.55Å
99	S	94	Very high	96.8	Very high	85 Å²	85	43 Å²	43	59%	0.594	23%	0.232	S	C	*	.	T	Hydrogen-bonded Turn	trans	-65.6	-28.1	176.7	52.7	0	0	0	0	113
100	S	93.8	Very high	96.9	Very high	103 Å²	103	46.9 Å²	46.9	72%	0.72	24%	0.244	S	C	*	.	T	Hydrogen-bonded Turn	trans	-67	-34.6	-178.5	54.5	0	0	0	0	113.5	R98	R98-S100 PolarHBondContact O-N 2.04Å
101	N	92.3	Very high	97	Very high	60 Å²	60	48.9 Å²	48.9	32%	0.321	25%	0.253	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.2	101.2	174.8	-166.6	-28.5	0	0	0	110.1	R98 Y103 L104	R98-N101 CarbonylContact O-C 3.55Å; N101-Y103 PolarHBondContact O-N 2.96Å; N101-Y103 PolarHBondContact OD1-N 2.87Å; N101-Y103 VanDerWaalsContact OD1-N 3.16Å; N101-L104 HydrophobicContact CB-CD1 4.1Å; N101-L104 HydrophobicContact CB-CG 4.16Å; N101-L104 WeakPolarHBondContact ND2-CD1 3.19Å; N101-L104 PolarHBondContact O-N 3.04Å
102	P	92.1	Very high	97	Very high	39 Å²	39	48 Å²	48	25%	0.253	25%	0.247	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-74.3	-12.4	-175.4	30.7	-35.6	0	0	0	113.9
103	Y	95.6	Very high	97	Very high	111 Å²	111	53.5 Å²	53.5	44%	0.435	27%	0.274	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.3	-11.7	-179.6	-56.3	-76.4	0	0	0	113.2	D12 L14 I15 N101	D12-Y103 HydrophobicContact CB-CE1 4.21Å; L14-Y103 WeakPolarHBondContact CA-O 3.37Å; L14-Y103 HydrophobicContact CD2-CD1 4.06Å; I15-Y103 PolarHBondContact N-O 3.17Å; N101-Y103 PolarHBondContact O-N 2.96Å; N101-Y103 PolarHBondContact OD1-N 2.87Å; N101-Y103 VanDerWaalsContact OD1-N 3.16Å
104	L	97.2	Very high	97	Very high	54 Å²	54	50.2 Å²	50.2	28%	0.283	26%	0.261	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.5	126.8	177.3	-55.2	-177	0	0	0	109.8	I15 Q18 N101	I15-L104 HydrophobicContact CB-CD2 4.12Å; I15-L104 HydrophobicContact CG1-CD2 4.37Å; Q18-L104 HydrophobicContact CB-CB 3.9Å; Q18-L104 HydrophobicContact CB-CD1 4.46Å; Q18-L104 HydrophobicContact CB-CD2 4.36Å; Q18-L104 HydrophobicContact CB-CG 4.44Å; Q18-L104 HydrophobicContact CG-CB 4.38Å; Q18-L104 HydrophobicContact CG-CD2 4Å; N101-L104 HydrophobicContact CB-CD1 4.1Å; N101-L104 HydrophobicContact CB-CG 4.16Å; N101-L104 WeakPolarHBondContact ND2-CD1 3.19Å; N101-L104 PolarHBondContact O-N 3.04Å
105	L	98.2	Very high	96.9	Very high	9 Å²	9	53 Å²	53	5%	0.047	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	159.5	-175.8	-53.1	-175.4	0	0	0	111.4	L14 I15 G17 Q18 I19 L53 Y95 G96	L14-L105 HydrophobicContact CB-CD1 3.78Å; L14-L105 HydrophobicContact CB-CG 4.12Å; L14-L105 HydrophobicContact CD1-CD1 4.11Å; I15-L105 PolarHBondContact O-N 3.15Å; G17-L105 PolarHBondContact N-O 3.34Å; Q18-L105 PolarHBondContact N-O 3.47Å; I19-L105 PolarHBondContact N-O 2.86Å; I19-L105 VanDerWaalsContact N-O 3.14Å; L53-L105 HydrophobicContact CD1-CD2 3.74Å; L53-L105 HydrophobicContact CD2-CD1 4.38Å; L53-L105 HydrophobicContact CD2-CD2 4.04Å; Y95-L105 HydrophobicContact CD1-CB 4.15Å; Y95-L105 HydrophobicContact CD1-CD1 4.11Å; Y95-L105 HydrophobicContact CG-CB 4.47Å; Y95-L105 HydrophobicContact CG-CD1 3.99Å; G96-L105 CarbonylContact O-C 3.52Å; G96-L105 WeakPolarHBondContact O-CA 3.33Å
106	S	98.3	Very high	96.8	Very high	0 Å²	0	52.3 Å²	52.3	0%	0	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.4	176.3	168.5	73.6	0	0	0	0	112.9	G17 I19 D21 P23 G96	G17-S106 PolarHBondContact N-O 3.49Å; I19-S106 CarbonylContact O-C 3.47Å; I19-S106 VanDerWaalsContact O-CA 3.32Å; I19-S106 WeakPolarHBondContact O-CA 3.29Å; D21-S106 WeakPolarHBondContact O-CB 3.49Å; P23-S106 WeakPolarHBondContact CD-OG 3.36Å; G96-S106 PolarHBondContact N-OG 3.22Å; G96-S106 PolarHBondContact O-N 2.89Å
107	H	98.3	Very high	96.5	Very high	80 Å²	80	54.9 Å²	54.9	37%	0.37	30%	0.296	S	S	.	.	P	Polyproline II helix	trans	-60	149.4	159.4	-74.4	-74.6	0	0	0	110.1	I19 D21 R22 P23	I19-H107 PolarHBondContact O-N 2.99Å; D21-H107 PolarHBondContact O-N 2.79Å; D21-H107 VanDerWaalsContact O-N 3.16Å; R22-H107 HydrophobicContact CB-CB 4.28Å; R22-H107 HydrophobicContact CG-CB 4.04Å; P23-H107 VanDerWaalsContact CD-O 3.31Å; P23-H107 WeakPolarHBondContact CD-O 3.21Å
108	P	98.3	Very high	95.5	Very high	33 Å²	33	57.9 Å²	57.9	21%	0.214	33%	0.326	C	S	.	.	P	Polyproline II helix	trans	-64	145.8	174.8	25.8	-33	0	0	0	110.6	R22 Y95	R22-P108 VanDerWaalsContact CG-O 3.27Å; R22-P108 WeakPolarHBondContact CG-O 3.38Å; R22-P108 PolarHBondContact NE-O 3.14Å; Y95-P108 HydrophobicContact CD1-CB 4.3Å; Y95-P108 HydrophobicContact CE1-CB 3.54Å; Y95-P108 HydrophobicContact CE1-CG 4.3Å
109	S	98.7	Very high	94	Very high	1 Å²	1	61.3 Å²	61.3	1%	0.007	35%	0.347	C	S	.	.	P	Polyproline II helix	trans	-55.9	167.5	163.3	73.2	0	0	0	0	111.8	P23 L25 C94	P23-S109 WeakPolarHBondContact O-CA 3.32Å; P23-S109 WeakPolarHBondContact O-CB 3.39Å; L25-S109 WeakPolarHBondContact CB-OG 3.33Å; C94-S109 PolarHBondContact N-OG 2.91Å; C94-S109 PolarHBondContact O-N 2.92Å
110	E	98.4	Very high	92.1	Very high	115 Å²	115	58.6 Å²	58.6	54%	0.537	33%	0.333	S	S	.	.	P	Polyproline II helix	trans	-58.1	145.2	160.5	-67.3	-55.2	135.8	0	0	110	R22	R22-E110 IonicContact CZ-OE1 3.83Å; R22-E110 IonicContact NE-OE1 2.98Å; R22-E110 IonicContact NH1-OE1 2.76Å; R22-E110 PolarHBondContact NH1-OE1 3.24Å; R22-E110 IonicContact NH2-OE1 3.93Å; R22-E110 PolarHBondContact NH2-OE1 3.26Å
111	P	98.4	Very high	89.9	Confident	64 Å²	64	58 Å²	58	42%	0.416	33%	0.334	S	S	.	.	P	Polyproline II helix	trans	-67.5	142.5	179.1	27.5	-32.5	0	0	0	111.1	T91 Y92 R93	T91-P111 HydrophobicContact CG2-CB 3.64Å; Y92-P111 WeakPolarHBondContact O-CA 3.36Å; R93-P111 HydrophobicContact CG-CB 4.4Å
112	L	98.6	Very high	87.9	Confident	20 Å²	20	59.8 Å²	59.8	11%	0.105	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	115.5	174.4	-172.2	155	0	0	0	109.3	L25 V27 L41 T91 Y92	L25-L112 HydrophobicContact CD2-CB 3.79Å; L25-L112 HydrophobicContact CG-CB 4.12Å; L25-L112 HydrophobicContact CG-CD1 4.02Å; V27-L112 HydrophobicContact CB-CD1 3.78Å; V27-L112 HydrophobicContact CB-CD2 4.11Å; V27-L112 HydrophobicContact CG1-CD1 3.83Å; V27-L112 HydrophobicContact CG1-CD2 4.13Å; V27-L112 HydrophobicContact CG1-CG 4.41Å; L41-L112 HydrophobicContact CD2-CD1 4.07Å; L41-L112 HydrophobicContact CD2-CD2 3.75Å; L41-L112 HydrophobicContact CD2-CG 4.49Å; T91-L112 CarbonylContact C-O 3.53Å; T91-L112 WeakPolarHBondContact CA-O 3.23Å; Y92-L112 PolarHBondContact N-O 3.26Å; Y92-L112 PolarHBondContact O-N 3.16Å
113	E	98.3	Very high	86.1	Confident	129 Å²	129	62.8 Å²	62.8	60%	0.603	36%	0.363	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.9	120.5	175.1	-170.6	175	-170.1	0	0	110.3	P31 V115	P31-E113 WeakPolarHBondContact CB-O 3.16Å; E113-V115 HydrophobicContact CG-CG2 4.33Å
114	L	97.8	Very high	84.1	Confident	2 Å²	2	62.4 Å²	62.4	1%	0.01	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.6	121.8	172.6	-174.8	73.3	0	0	0	109.1	V27 P31 V33 V39 M81 A89 G90 Y92 V116	V27-L114 HydrophobicContact CG2-CD1 4.17Å; P31-L114 CarbonylContact O-C 3.53Å; P31-L114 WeakPolarHBondContact O-CA 3.43Å; P31-L114 WeakPolarHBondContact O-CD1 3.48Å; V33-L114 HydrophobicContact CG2-CD1 4.31Å; V39-L114 HydrophobicContact CG1-CD1 4.15Å; V39-L114 HydrophobicContact CG2-CD1 4.5Å; M81-L114 HydrophobicContact CE-CD2 3.71Å; A89-L114 CarbonylContact C-O 3.58Å; A89-L114 VanDerWaalsContact CA-O 3.25Å; A89-L114 WeakPolarHBondContact CA-O 3.27Å; G90-L114 PolarHBondContact N-O 3.47Å; G90-L114 PolarHBondContact O-N 3.16Å; Y92-L114 HydrophobicContact CD2-CB 4.14Å; Y92-L114 HydrophobicContact CE2-CB 3.95Å; Y92-L114 HydrophobicContact CE2-CD2 4.19Å; L114-V116 HydrophobicContact CD2-CG2 4.42Å; L114-V116 HydrophobicContact CG-CG2 4.41Å
115	V	97.3	Very high	81.8	Confident	59 Å²	59	65.6 Å²	65.6	36%	0.358	39%	0.385	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.2	127.1	176.8	-177.4	0	0	0	0	108.7	P31 T32 V33 E113	P31-V115 PolarHBondContact O-N 2.92Å; T32-V115 WeakPolarHBondContact CA-O 3.44Å; T32-V115 HydrophobicContact CG2-CB 4.37Å; T32-V115 HydrophobicContact CG2-CG1 4.45Å; V33-V115 PolarHBondContact N-O 2.81Å; E113-V115 HydrophobicContact CG-CG2 4.33Å
116	V	95.9	Very high	79.3	Confident	22 Å²	22	68.9 Å²	68.9	13%	0.133	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	117.6	177.2	-173.8	0	0	0	0	108.9	V33 V84 A89 L114	V33-V116 HydrophobicContact CG2-CG2 4.08Å; V33-V116 CarbonylContact O-C 3.6Å; V33-V116 WeakPolarHBondContact O-CA 3.24Å; V84-V116 HydrophobicContact CG2-CG1 4.23Å; A89-V116 HydrophobicContact CB-CB 4.22Å; A89-V116 HydrophobicContact CB-CG2 4.06Å; L114-V116 HydrophobicContact CD2-CG2 4.42Å; L114-V116 HydrophobicContact CG-CG2 4.41Å
117	S	92.3	Very high	77.1	Confident	54 Å²	54	76 Å²	76	38%	0.378	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.8	151.5	179.8	-61.5	0	0	0	0	111.9	V33 T34 S35	V33-S117 PolarHBondContact O-N 3.37Å; T34-S117 CarbonylContact C-O 3.49Å; T34-S117 WeakPolarHBondContact CA-O 3.45Å; S35-S117 PolarHBondContact N-O 2.85Å
118	G	76.9	Confident	74.8	Confident	62 Å²	62	77.6 Å²	77.6	64%	0.639	45%	0.453	S	S	*	.	S	Bend	trans	92.5	141.2	172.8	0	0	0	0	0	114	G120	G118-G120 PolarHBondContact O-N 3.18Å
119	E	63.7	Low	72.6	Confident	185 Å²	185	83.9 Å²	83.9	86%	0.864	48%	0.477	S	S	*	.			trans	-65	113.2	161.2	-90.7	158.9	134	0	0	106.9	A121	E119-A121 PolarHBondContact O-N 3.1Å
120	G	54.3	Low	70.3	Confident	29 Å²	29	86 Å²	86	30%	0.299	50%	0.5	S	S	.	.			trans	-48	134.4	157.1	0	0	0	0	0	106.6	S35 G118 D122	S35-G120 WeakPolarHBondContact OG-CA 3.38Å; G118-G120 PolarHBondContact O-N 3.18Å; G120-D122 PolarHBondContact O-N 2.96Å
121	A	47.8	Very low	68.1	Low	90 Å²	90	86.5 Å²	86.5	74%	0.744	51%	0.51	S	S	*	.			trans	-56.6	95.6	170.3	0	0	0	0	0	106.8	E119 P123	E119-A121 PolarHBondContact O-N 3.1Å; A121-P123 VanDerWaalsContact O-CD 3.29Å; A121-P123 WeakPolarHBondContact O-CD 3.38Å; A121-P123 VanDerWaalsContact O-N 3.1Å
122	D	49.3	Very low	66.2	Low	98 Å²	98	91.1 Å²	91.1	52%	0.524	53%	0.53	S	S	.	.			trans	-56	118.9	166.4	-80	-28.9	0	0	0	104.1	G120 V124 H125 S126	G120-D122 PolarHBondContact O-N 2.96Å; D122-V124 PolarHBondContact O-N 2.73Å; D122-H125 HydrophobicContact CB-CB 4.24Å; D122-H125 PolarHBondContact O-N 3.11Å; D122-S126 PolarHBondContact O-N 2.81Å
123	P	55.2	Low	63.8	Low	101 Å²	101	92.9 Å²	92.9	66%	0.656	55%	0.553	S	S	*	*	H	α-helix	trans	-56.8	-25.3	-178.1	17.9	-27.8	0	0	0	111.1	A121 E127	A121-P123 VanDerWaalsContact O-CD 3.29Å; A121-P123 WeakPolarHBondContact O-CD 3.38Å; A121-P123 VanDerWaalsContact O-N 3.1Å; P123-E127 PolarHBondContact O-N 3.45Å
124	V	54	Low	61.3	Low	103 Å²	103	93.7 Å²	93.7	62%	0.624	56%	0.562	S	S	*	*	H	α-helix	trans	-65	-37.2	174.2	-173.9	0	0	0	0	112.9	D122	D122-V124 PolarHBondContact O-N 2.73Å
125	H	47.1	Very low	59.1	Low	121 Å²	121	102.2 Å²	102.2	56%	0.56	60%	0.602	S	S	*	*	H	α-helix	trans	-86.3	-21.1	-176.9	-131.6	-68.2	0	0	0	113	D122 K129	D122-H125 HydrophobicContact CB-CB 4.24Å; D122-H125 PolarHBondContact O-N 3.11Å; H125-K129 PolarHBondContact O-N 2.75Å
126	S	47.3	Very low	56.5	Low	78 Å²	78	109.8 Å²	109.8	55%	0.545	63%	0.629	S	S	.	*	H	α-helix	trans	-72.3	-39.8	173.2	-168.1	0	0	0	0	111.9	D122 L128 K129 G130	D122-S126 PolarHBondContact O-N 2.81Å; S126-L128 PolarHBondContact O-N 2.81Å; S126-K129 PolarHBondContact O-N 2.85Å; S126-G130 PolarHBondContact O-N 3.34Å; S126-G130 VanDerWaalsContact O-N 3.15Å
127	E	51	Low	54	Low	151 Å²	151	112.3 Å²	112.3	71%	0.706	66%	0.66	S	S	*	*	H	α-helix	trans	-62.3	-42	175.3	-79.1	-165.1	133	0	0	112.2	P123 K129 G130 V131	P123-E127 PolarHBondContact O-N 3.45Å; E127-K129 VanDerWaalsContact C-N 3.34Å; E127-K129 PolarHBondContact O-N 2.89Å; E127-G130 PolarHBondContact O-N 2.9Å; E127-G130 VanDerWaalsContact O-N 3.17Å; E127-V131 WeakPolarHBondContact O-CG2 3.41Å; E127-V131 PolarHBondContact O-N 3.09Å; E127-V131 VanDerWaalsContact O-N 3.16Å
128	L	49.5	Very low	51.2	Low	112 Å²	112	118.2 Å²	118.2	59%	0.586	68%	0.682	S	S	*	*	H	α-helix	trans	-64.7	-33.9	178.7	-81.1	153.6	0	0	0	113.3	S126 L132	S126-L128 PolarHBondContact O-N 2.81Å; L128-L132 PolarHBondContact O-N 3.47Å
129	K	53.3	Low	49.1	Very low	165 Å²	165	123 Å²	123	72%	0.717	69%	0.692	S	S	*	*	H	α-helix	trans	-72.8	-31.4	174.1	-79.1	-170	177	-179.9	0	112.8	H125 S126 E127 V131	H125-K129 PolarHBondContact O-N 2.75Å; S126-K129 PolarHBondContact O-N 2.85Å; E127-K129 VanDerWaalsContact C-N 3.34Å; E127-K129 PolarHBondContact O-N 2.89Å; K129-V131 VanDerWaalsContact C-N 3.33Å
130	G	49.4	Very low	48.3	Very low	47 Å²	47	123.2 Å²	123.2	49%	0.485	71%	0.71	S	S	.	*	H	α-helix	trans	-69.4	-28.5	174.5	0	0	0	0	0	113.7	S126 E127	S126-G130 PolarHBondContact O-N 3.34Å; S126-G130 VanDerWaalsContact O-N 3.15Å; E127-G130 PolarHBondContact O-N 2.9Å; E127-G130 VanDerWaalsContact O-N 3.17Å
131	V	53.3	Low	48	Very low	124 Å²	124	128 Å²	128	75%	0.752	73%	0.73	S	S	*	*	H	α-helix	trans	-79	-30.9	179.4	176.8	0	0	0	0	112.6	E127 K129	E127-V131 WeakPolarHBondContact O-CG2 3.41Å; E127-V131 PolarHBondContact O-N 3.09Å; E127-V131 VanDerWaalsContact O-N 3.16Å; K129-V131 VanDerWaalsContact C-N 3.33Å
132	L	57	Low	48	Very low	162 Å²	162	129.9 Å²	129.9	85%	0.848	73%	0.729	S	S	*	*	S	Bend	trans	-90.9	-4.9	-175.8	-157.1	66.2	0	0	0	114.3	L128	L128-L132 PolarHBondContact O-N 3.47Å
133	G	48.5	Very low	47.9	Very low	57 Å²	57	131.7 Å²	131.7	59%	0.588	74%	0.741	S	S	*	*	S	Bend	trans	-90.3	-3.8	-173.4	0	0	0	0	0	116.9
134	N	45.5	Very low	47.5	Very low	145 Å²	145	133.5 Å²	133.5	78%	0.775	75%	0.746	S	S	*	*			trans	-111.8	31.1	-164.3	-66.7	5.8	0	0	0	115.2
135	E	51.4	Low	47.1	Very low	182 Å²	182	135.4 Å²	135.4	85%	0.85	75%	0.753	S	S	*	*			trans	-126.9	94.8	163.9	-90.9	-166.4	85.1	0	0	110.2
136	K	44	Very low	47.1	Very low	217 Å²	217	136.4 Å²	136.4	94%	0.943	77%	0.766	S	S	*	*			trans	-174	113.1	138.4	-102.6	164.3	-169.5	-172.4	0	112.5
137	G	42.4	Very low	47.1	Very low	76 Å²	76	140.6 Å²	140.6	78%	0.784	78%	0.782	S	S	*	*			trans	103.2	95.9	140.5	0	0	0	0	0	115.9
138	E	35.1	Very low	46.7	Very low	177 Å²	177	139.8 Å²	139.8	83%	0.827	79%	0.788	S	S	*	*			trans	-163.9	126.4	131.4	-159.5	73.9	104.8	0	0	109.2
139	L	32	Very low	46.5	Very low	164 Å²	164	142.1 Å²	142.1	86%	0.859	81%	0.805	S	S	*	*			trans	-173.2	149	141.1	-97.7	137.9	0	0	0	109.9
140	P	46.3	Very low	45.9	Very low	189 Å²	189	140 Å²	140	100%	1.227	81%	0.813	S	S	*	*			trans	-82.3	0	-144.9	33.7	-38.5	0	0	0	116

Retrieved 140 of 140 residues in 69.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).