A0A075B7C1_HUMAN Loading...

TATA-box binding protein associated factor 15

AlphaFold DB , UniProt , Accession A0A075B7C1, Species HUMAN (Homo sapiens, Human), Gene TAF15, Length 102 aa.

						>A0A075B7C1_HUMAN|A0A075B7C1|TAF15
SGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRSSCSSKRPRTWDGSCCTVVAVSLLDLTRHPSTPGSLVCAHMPHISDPVSFFPELQQFSDSPPAVVPP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	S	44.3	Very low	47.8	Very low	177 Å²	177	123.7 Å²	123.7	100%	1.238	85%	0.851	S	S	*	*				0	110.5	0	29.4	0	0	0	0	108.1
2	G	42.4	Very low	48.1	Very low	78 Å²	78	118.6 Å²	118.6	80%	0.804	83%	0.833	S	S	*	*			trans	-83.8	168	175.4	0	0	0	0	0	112.3
3	G	39.9	Very low	48.3	Very low	79 Å²	79	127.9 Å²	127.9	81%	0.814	84%	0.841	S	S	*	*			trans	178	70.8	176	0	0	0	0	0	111
4	Y	49.3	Very low	48.2	Very low	217 Å²	217	123.5 Å²	123.5	85%	0.851	83%	0.83	S	S	*	*			trans	-76.8	156.8	171.2	43.9	-89.8	0	0	0	110.8
5	G	44.7	Very low	48.7	Very low	81 Å²	81	119.6 Å²	119.6	84%	0.835	82%	0.819	S	S	*	*			trans	101.8	105.5	139.3	0	0	0	0	0	116.2
6	G	45.7	Very low	49.6	Very low	60 Å²	60	121.6 Å²	121.6	62%	0.619	82%	0.819	S	S	*	*			trans	-174.9	82.8	131.6	0	0	0	0	0	111.9
7	D	58.3	Low	49.8	Very low	142 Å²	142	129.2 Å²	129.2	76%	0.759	83%	0.826	S	S	*	*				61.1	83	105.9	77.1	-91.6	0	0	0	112.5
8	R	61.1	Low	49.7	Very low	242 Å²	242	126.3 Å²	126.3	91%	0.913	83%	0.825	S	S	*	*				23.9	109	111.6	-56.3	-170.2	-156.3	171.6	6.6	114.2
9	S	51.8	Low	49.6	Very low	125 Å²	125	124.3 Å²	124.3	87%	0.874	83%	0.829	S	S	*	*			trans	-170.3	134.7	143.4	-89.1	0	0	0	0	114
10	G	45.7	Very low	49.4	Very low	83 Å²	83	121.6 Å²	121.6	86%	0.856	82%	0.823	S	S	*	*			trans	87	111.2	159.2	0	0	0	0	0	113.4
11	G	43	Very low	49.4	Very low	77 Å²	77	126.5 Å²	126.5	79%	0.794	83%	0.826	S	S	*	*			cis	120.5	117.1	42.5	0	0	0	0	0	105.5
12	G	50.6	Low	49.5	Very low	62 Å²	62	121.9 Å²	121.9	64%	0.639	81%	0.807	S	S	*	*			trans	-68.5	-178.9	176.3	0	0	0	0	0	113
13	Y	51.3	Low	49.5	Very low	240 Å²	240	121.4 Å²	121.4	94%	0.941	80%	0.801	S	S	*	*			trans	73.9	136.1	164.7	76.8	-99.2	0	0	0	119.8
14	G	46.4	Very low	50.6	Low	66 Å²	66	124.8 Å²	124.8	68%	0.68	80%	0.801	S	S	*	*			trans	110.9	80.2	179.1	0	0	0	0	0	110.7
15	G	56.2	Low	50.8	Low	65 Å²	65	126.2 Å²	126.2	67%	0.67	81%	0.805	S	S	*	*				74.6	150.7	54.4	0	0	0	0	0	109.4
16	D	62.5	Low	51	Low	152 Å²	152	126.5 Å²	126.5	81%	0.813	81%	0.808	S	S	*	*			trans	87	40.7	158.5	-25.2	-49.6	0	0	0	119.2
17	R	52.8	Low	50.8	Low	250 Å²	250	126.6 Å²	126.6	94%	0.943	81%	0.809	S	S	*	*	S	Bend	trans	-138.4	84	141.7	-68.5	-164.4	-172.4	161.3	6.5	111.9
18	G	48.3	Very low	50.2	Low	78 Å²	78	129.5 Å²	129.5	80%	0.804	81%	0.811	S	S	*	*			trans	46.6	106.6	152.7	0	0	0	0	0	116.3
19	G	47.6	Very low	49.2	Very low	88 Å²	88	121.3 Å²	121.3	91%	0.907	80%	0.802	S	S	*	*				85.6	85.6	62.3	0	0	0	0	0	109
20	G	45.5	Very low	48.8	Very low	69 Å²	69	119 Å²	119	71%	0.711	80%	0.798	S	S	*	*			trans	-174.7	74.6	178.9	0	0	0	0	0	110.1
21	Y	50.3	Low	48.9	Very low	226 Å²	226	123.2 Å²	123.2	89%	0.886	79%	0.793	S	S	*	*			trans	-50.6	147	169.3	47	-87.4	0	0	0	111.6
22	G	46	Very low	49.2	Very low	80 Å²	80	129.1 Å²	129.1	83%	0.825	80%	0.802	S	S	*	*			trans	104.8	104.9	152.6	0	0	0	0	0	114.2
23	G	42.9	Very low	48.7	Very low	67 Å²	67	129.8 Å²	129.8	69%	0.691	81%	0.809	S	S	*	*			trans	158.5	42.4	157.7	0	0	0	0	0	115.5	R25	G23-R25 VanDerWaalsContact O-N 3.14Å; G23-R25 PolarHBondContact O-N 3.41Å
24	D	62.2	Low	48.2	Very low	151 Å²	151	121.8 Å²	121.8	81%	0.807	80%	0.799	S	S	*	*			trans	-42.5	123.1	151.5	-58.7	-96.3	0	0	0	109.3
25	R	52.9	Low	48.3	Very low	246 Å²	246	130.2 Å²	130.2	93%	0.928	81%	0.81	S	S	*	*	S	Bend	trans	99.6	108.8	167.3	-53	168.6	-164.6	162	5	116.7	G23	G23-R25 VanDerWaalsContact O-N 3.14Å; G23-R25 PolarHBondContact O-N 3.41Å
26	G	50.1	Low	48.2	Very low	88 Å²	88	132.8 Å²	132.8	91%	0.907	82%	0.818	S	S	*	*			trans	117.8	107	143.1	0	0	0	0	0	113.7
27	G	41.3	Very low	47.4	Very low	62 Å²	62	129.1 Å²	129.1	64%	0.639	81%	0.805	S	S	*	*			trans	175.3	76	171.1	0	0	0	0	0	111.8	G29	G27-G29 VanDerWaalsContact O-N 3.14Å; G27-G29 PolarHBondContact O-N 3.17Å
28	Y	45.8	Very low	47.1	Very low	202 Å²	202	118.1 Å²	118.1	79%	0.792	77%	0.766	S	S	*	*			trans	-27.9	114.8	163.6	49	-84.2	0	0	0	111.7
29	G	39.8	Very low	47.1	Very low	71 Å²	71	119.2 Å²	119.2	73%	0.732	76%	0.761	S	S	*	*			trans	-59.9	148.5	166.1	0	0	0	0	0	110.5	G27	G27-G29 VanDerWaalsContact O-N 3.14Å; G27-G29 PolarHBondContact O-N 3.17Å
30	G	44	Very low	47.1	Very low	76 Å²	76	120.4 Å²	120.4	78%	0.784	76%	0.755	S	S	*	*			trans	76.4	85	152.4	0	0	0	0	0	116.1
31	K	47.4	Very low	47.3	Very low	172 Å²	172	126.7 Å²	126.7	75%	0.748	76%	0.763	S	S	*	*			trans	-159	88	133.6	50.9	-165.4	-180	-162	0	109.5
32	M	49.4	Very low	47.1	Very low	201 Å²	201	123.3 Å²	123.3	99%	0.99	75%	0.749	S	S	*	*			trans	-57.2	133.4	149.4	-75.5	164.4	170.3	0	0	107.7
33	G	39.5	Very low	47.2	Very low	76 Å²	76	123.8 Å²	123.8	78%	0.784	74%	0.737	S	S	*	*			trans	137.5	111	164.1	0	0	0	0	0	113.7
34	G	40.7	Very low	47.6	Very low	72 Å²	72	127.7 Å²	127.7	74%	0.742	73%	0.731	S	S	*	*			trans	87.2	95.4	142.5	0	0	0	0	0	115.4
35	R	49.1	Very low	47.2	Very low	242 Å²	242	122.7 Å²	122.7	91%	0.913	71%	0.706	S	S	*	*	S	Bend	trans	-42.4	136.5	154.7	-65.9	163.4	167.6	-173.7	-6.4	110.9
36	S	53.1	Low	46.9	Very low	120 Å²	120	124.3 Å²	124.3	84%	0.839	71%	0.713	S	S	*	*			trans	72.9	77	156	-39.1	0	0	0	0	118.2
37	S	46.9	Very low	47	Very low	75 Å²	75	125.8 Å²	125.8	52%	0.524	70%	0.7	S	S	.	*	S	Bend	trans	-159	86.5	155.9	48.3	0	0	0	0	112.5	R44	S37-R44 PolarHBondContact O-NH2 3.21Å
38	C	45.3	Very low	47.4	Very low	18 Å²	18	125 Å²	125	12%	0.122	69%	0.692	C	S	.	*			trans	51.3	96	167.1	-13.5	0	0	0	0	114.5	S40 C50	C38-S40 PolarHBondContact O-N 3.48Å; C38-C50 PolarHBondContact SG-SG 3.26Å; C38-C50 CovalentContact SG-SG 2.05Å; C38-C50 WeakPolarHBondContact SG-CB 3.11Å; C38-C50 VanDerWaalsContact SG-CA 3.51Å; C38-C50 PolarHBondContact N-SG 3.13Å; C38-C50 WeakPolarHBondContact CB-SG 3.13Å; C38-C50 HydrophobicContact CB-CB 3.98Å; C38-C50 VanDerWaalsContact CA-SG 3.56Å
39	S	48.7	Very low	47.6	Very low	101 Å²	101	117.4 Å²	117.4	71%	0.706	67%	0.668	S	S	*	*			trans	-45.9	130.4	167.9	179.4	0	0	0	0	109.5	K41 R42	S39-K41 PolarHBondContact O-N 3.2Å; S39-R42 PolarHBondContact O-N 3.13Å
40	S	48.2	Very low	48.1	Very low	113 Å²	113	117 Å²	117	79%	0.79	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.7	25	-159.9	-46.3	0	0	0	0	117.1	C38	C38-S40 PolarHBondContact O-N 3.48Å
41	K	49.2	Very low	48.4	Very low	201 Å²	201	114.1 Å²	114.1	87%	0.874	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-122.9	9.7	177.5	-75.3	178.9	177.4	171.3	0	113.2	S39	S39-K41 PolarHBondContact O-N 3.2Å
42	R	46.8	Very low	48.6	Very low	156 Å²	156	108.8 Å²	108.8	59%	0.589	60%	0.603	S	S	*	*	S	Bend	trans	-113.6	140.1	173.6	-61.6	-171.4	-156.7	-99.4	3	111	S39 R44	S39-R42 PolarHBondContact O-N 3.13Å; R42-R44 PolarHBondContact O-N 2.99Å
43	P	48.5	Very low	48.5	Very low	90 Å²	90	102.6 Å²	102.6	58%	0.584	58%	0.576	S	S	*	*	P	Polyproline II helix	trans	-57.4	135.7	170.4	-17.4	29.2	0	0	0	109.9
44	R	51.1	Low	48.9	Very low	148 Å²	148	102.2 Å²	102.2	56%	0.558	56%	0.559	S	S	*	*	B	Isolated β-bridge	trans	-94	142.4	171.3	-72.6	-178	163.6	149.6	-3.5	108.6	S37 R42	S37-R44 PolarHBondContact O-NH2 3.21Å; R42-R44 PolarHBondContact O-N 2.99Å
45	T	52.8	Low	49	Very low	47 Å²	47	102.6 Å²	102.6	29%	0.288	56%	0.555	S	S	.	*	P	Polyproline II helix	trans	-70.8	162.7	165.1	34.7	0	0	0	0	110.7	D47 G48 S49 C51	T45-D47 WeakPolarHBondContact CB-OD1 3.39Å; T45-D47 PolarHBondContact O-N 3.09Å; T45-D47 VanDerWaalsContact O-N 3.17Å; T45-D47 PolarHBondContact OG1-OD1 3.15Å; T45-G48 PolarHBondContact O-N 3.34Å; T45-S49 PolarHBondContact OG1-N 3.3Å; T45-S49 PolarHBondContact OG1-O 3.01Å; T45-S49 PolarHBondContact N-O 3.14Å; T45-C51 WeakPolarHBondContact CG2-SG 3.13Å
46	W	47.8	Very low	48.8	Very low	279 Å²	279	96.6 Å²	96.6	100%	1.057	55%	0.545	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.4	-23.3	179.3	-85.8	66.4	0	0	0	113.7	G48	W46-G48 VanDerWaalsContact C-N 3.35Å
47	D	51.2	Low	48.1	Very low	119 Å²	119	95.2 Å²	95.2	64%	0.636	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.3	-1.3	175.4	69.9	-14	0	0	0	113.9	T45 S49	T45-D47 WeakPolarHBondContact CB-OD1 3.39Å; T45-D47 PolarHBondContact O-N 3.09Å; T45-D47 VanDerWaalsContact O-N 3.17Å; T45-D47 PolarHBondContact OG1-OD1 3.15Å; D47-S49 VanDerWaalsContact C-N 3.31Å; D47-S49 PolarHBondContact O-N 3.26Å; D47-S49 WeakPolarHBondContact OD1-CB 3.17Å; D47-S49 PolarHBondContact OD1-N 3.11Å
48	G	50.2	Low	48	Very low	46 Å²	46	98.3 Å²	98.3	47%	0.474	55%	0.545	S	S	.	.	S	Bend	trans	79.1	7.6	-178	0	0	0	0	0	115	T45 W46	T45-G48 PolarHBondContact O-N 3.34Å; W46-G48 VanDerWaalsContact C-N 3.35Å
49	S	50.2	Low	47.9	Very low	43 Å²	43	105.1 Å²	105.1	30%	0.301	58%	0.579	S	S	.	*			trans	-77.1	150.1	174.7	-164.7	0	0	0	0	112.4	T45 D47 C51	T45-S49 PolarHBondContact OG1-N 3.3Å; T45-S49 PolarHBondContact OG1-O 3.01Å; T45-S49 PolarHBondContact N-O 3.14Å; D47-S49 VanDerWaalsContact C-N 3.31Å; D47-S49 PolarHBondContact O-N 3.26Å; D47-S49 WeakPolarHBondContact OD1-CB 3.17Å; D47-S49 PolarHBondContact OD1-N 3.11Å; S49-C51 PolarHBondContact O-N 3.14Å
50	C	50.1	Low	47.7	Very low	62 Å²	62	106.1 Å²	106.1	42%	0.419	58%	0.577	S	S	.	*	B	Isolated β-bridge	trans	-84.6	113.5	-179.6	-54.5	0	0	0	0	110.2	C38	C38-C50 PolarHBondContact SG-SG 3.26Å; C38-C50 CovalentContact SG-SG 2.05Å; C38-C50 WeakPolarHBondContact SG-CB 3.11Å; C38-C50 VanDerWaalsContact SG-CA 3.51Å; C38-C50 PolarHBondContact N-SG 3.13Å; C38-C50 WeakPolarHBondContact CB-SG 3.13Å; C38-C50 HydrophobicContact CB-CB 3.98Å; C38-C50 VanDerWaalsContact CA-SG 3.56Å
51	C	49.3	Very low	47.3	Very low	15 Å²	15	107.6 Å²	107.6	10%	0.101	58%	0.575	C	S	.	*			trans	-81.4	133.8	171.4	-73.3	0	0	0	0	111.5	T45 S49	T45-C51 WeakPolarHBondContact CG2-SG 3.13Å; S49-C51 PolarHBondContact O-N 3.14Å
52	T	51.7	Low	47	Very low	61 Å²	61	104.1 Å²	104.1	37%	0.374	57%	0.571	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-90.7	113.9	163.2	59.4	0	0	0	0	107.5	V54	T52-V54 VanDerWaalsContact C-N 3.35Å; T52-V54 PolarHBondContact O-N 2.91Å
53	V	48.2	Very low	46.9	Very low	70 Å²	70	106.1 Å²	106.1	42%	0.424	58%	0.578	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-69.9	99.8	169.6	-178.5	0	0	0	0	106.1	A55 L71	V53-A55 PolarHBondContact O-N 2.67Å; V53-L71 HydrophobicContact CG1-CD2 3.61Å
54	V	47.8	Very low	46.2	Very low	69 Å²	69	109.7 Å²	109.7	42%	0.418	59%	0.587	S	S	.	*			trans	-78.7	103	168.2	-177.9	0	0	0	0	105.7	T52 V56 M76	T52-V54 VanDerWaalsContact C-N 3.35Å; T52-V54 PolarHBondContact O-N 2.91Å; V54-V56 VanDerWaalsContact C-N 3.27Å; V54-V56 HydrophobicContact CG1-CG2 4.28Å; V54-V56 PolarHBondContact O-N 2.87Å; V54-M76 HydrophobicContact CG2-CE 3.82Å
55	A	42.8	Very low	45.7	Very low	79 Å²	79	108.9 Å²	108.9	65%	0.653	60%	0.601	S	S	*	*			trans	-66.1	94.3	165.6	0	0	0	0	0	107.2	V53 S57	V53-A55 PolarHBondContact O-N 2.67Å; A55-S57 PolarHBondContact O-N 3.25Å; A55-S57 VanDerWaalsContact C-N 3.29Å
56	V	44.8	Very low	45	Very low	116 Å²	116	110.9 Å²	110.9	70%	0.703	62%	0.617	S	S	*	*			trans	-64.5	98.5	170.6	179.5	0	0	0	0	106.3	V54 L58	V54-V56 VanDerWaalsContact C-N 3.27Å; V54-V56 HydrophobicContact CG1-CG2 4.28Å; V54-V56 PolarHBondContact O-N 2.87Å; V56-L58 PolarHBondContact O-N 3.33Å; V56-L58 VanDerWaalsContact O-N 3.09Å
57	S	37.6	Very low	44.6	Very low	91 Å²	91	103.3 Å²	103.3	64%	0.636	60%	0.602	S	S	*	*			trans	-72.9	102	179.2	-66.4	0	0	0	0	108.6	A55 L59	A55-S57 PolarHBondContact O-N 3.25Å; A55-S57 VanDerWaalsContact C-N 3.29Å; S57-L59 PolarHBondContact O-N 3.46Å
58	L	44.8	Very low	44.1	Very low	141 Å²	141	104.2 Å²	104.2	74%	0.738	61%	0.614	S	S	*	*	S	Bend	trans	51.5	37.5	141.2	-61.5	171.4	0	0	0	118.3	V56 L61	V56-L58 PolarHBondContact O-N 3.33Å; V56-L58 VanDerWaalsContact O-N 3.09Å; L58-L61 HydrophobicContact CD2-CD1 3.87Å
59	L	44.7	Very low	43.7	Very low	160 Å²	160	105.4 Å²	105.4	84%	0.838	63%	0.626	S	S	*	*	S	Bend	trans	-116	-6.3	165.8	-99.2	88.9	0	0	0	115.5	S57	S57-L59 PolarHBondContact O-N 3.46Å
60	D	43.6	Very low	43.3	Very low	123 Å²	123	108 Å²	108	66%	0.658	64%	0.644	S	S	*	*			trans	-117.7	37	179.8	-148.8	6.2	0	0	0	113.1	T62	D60-T62 PolarHBondContact O-N 3.2Å
61	L	39.9	Very low	43	Very low	144 Å²	144	111.4 Å²	111.4	75%	0.754	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.5	11.9	174.6	-117.1	94.9	0	0	0	113.6	L58	L58-L61 HydrophobicContact CD2-CD1 3.87Å
62	T	43.2	Very low	42.9	Very low	127 Å²	127	114.3 Å²	114.3	78%	0.779	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111.1	3.3	-173.6	51.5	0	0	0	0	115.4	D60	D60-T62 PolarHBondContact O-N 3.2Å
63	R	43.8	Very low	42.4	Very low	198 Å²	198	115.2 Å²	115.2	75%	0.747	68%	0.683	S	S	*	*	S	Bend	trans	-117	-17	179.2	-87.9	-173.7	178.2	-162.2	-0	118.9
64	H	35.3	Very low	42.4	Very low	165 Å²	165	113.5 Å²	113.5	76%	0.764	68%	0.676	S	S	*	*			trans	-146	113.4	177.6	-68.5	-71.3	0	0	0	113.1	S66	H64-S66 VanDerWaalsContact C-N 3.34Å; H64-S66 PolarHBondContact O-N 2.99Å
65	P	39.5	Very low	42.1	Very low	132 Å²	132	116.9 Å²	116.9	86%	0.857	69%	0.687	S	S	*	*			trans	-90.3	66.1	177.9	37.3	-32	0	0	0	109.9
66	S	39.2	Very low	42.1	Very low	89 Å²	89	118.3 Å²	118.3	62%	0.622	68%	0.682	S	S	*	*			trans	-172.8	80.8	171.9	53.3	0	0	0	0	111.7	H64	H64-S66 VanDerWaalsContact C-N 3.34Å; H64-S66 PolarHBondContact O-N 2.99Å
67	T	39.1	Very low	42	Very low	120 Å²	120	117.2 Å²	117.2	74%	0.736	68%	0.677	S	S	*	*			trans	161.1	125.2	135.2	34.6	0	0	0	0	109.9	G69	T67-G69 PolarHBondContact O-N 3.01Å
68	P	39.7	Very low	42.1	Very low	137 Å²	137	121.7 Å²	121.7	89%	0.89	69%	0.687	S	S	*	*	S	Bend	trans	-78.2	120.6	167.3	31	-26.8	0	0	0	108.3
69	G	42.4	Very low	42	Very low	72 Å²	72	120.8 Å²	120.8	74%	0.742	68%	0.682	S	S	*	*			trans	105.8	39.2	159.2	0	0	0	0	0	118.1	T67 L71	T67-G69 PolarHBondContact O-N 3.01Å; G69-L71 PolarHBondContact O-N 3.39Å; G69-L71 VanDerWaalsContact O-N 3.13Å
70	S	41.3	Very low	41.9	Very low	96 Å²	96	117.8 Å²	117.8	67%	0.671	67%	0.674	S	S	*	*			trans	-75.2	99.3	163.8	53.3	0	0	0	0	110.5	V72	S70-V72 PolarHBondContact O-N 3.17Å; S70-V72 VanDerWaalsContact O-N 3.15Å
71	L	44.7	Very low	41.5	Very low	135 Å²	135	117.6 Å²	117.6	71%	0.707	67%	0.673	S	S	*	*			trans	-73.5	97.5	165.2	-73.7	166.8	0	0	0	108	V53 G69 C73	V53-L71 HydrophobicContact CG1-CD2 3.61Å; G69-L71 PolarHBondContact O-N 3.39Å; G69-L71 VanDerWaalsContact O-N 3.13Å; L71-C73 PolarHBondContact O-N 2.95Å
72	V	46.6	Very low	41.5	Very low	76 Å²	76	116.5 Å²	116.5	46%	0.461	68%	0.675	S	S	.	*			trans	-77.2	110.4	174.8	-176.9	0	0	0	0	108.7	S70 A74 L89	S70-V72 PolarHBondContact O-N 3.17Å; S70-V72 VanDerWaalsContact O-N 3.15Å; V72-A74 PolarHBondContact O-N 2.52Å; V72-L89 HydrophobicContact CG1-CD2 4.31Å
73	C	42	Very low	41.5	Very low	79 Å²	79	117 Å²	117	53%	0.534	68%	0.677	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-76.6	97.8	167.9	-79	0	0	0	0	108.9	L71	L71-C73 PolarHBondContact O-N 2.95Å
74	A	48.6	Very low	41.4	Very low	35 Å²	35	111.8 Å²	111.8	29%	0.289	67%	0.671	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-82.1	115.4	167.8	0	0	0	0	0	109	V72 M76	V72-A74 PolarHBondContact O-N 2.52Å; A74-M76 PolarHBondContact O-N 3.41Å; A74-M76 VanDerWaalsContact O-N 3.17Å
75	H	41.5	Very low	41.7	Very low	140 Å²	140	113.3 Å²	113.3	65%	0.648	68%	0.676	S	S	*	*			trans	-68.2	107.9	164.3	-172.8	90.1	0	0	0	107.5	P77	H75-P77 WeakPolarHBondContact O-CD 3.33Å
76	M	41.4	Very low	41.7	Very low	109 Å²	109	116.2 Å²	116.2	54%	0.537	68%	0.675	S	S	.	*			trans	-85.2	111.1	172.5	-70.2	-147.8	174.7	0	0	108.8	V54 A74	V54-M76 HydrophobicContact CG2-CE 3.82Å; A74-M76 PolarHBondContact O-N 3.41Å; A74-M76 VanDerWaalsContact O-N 3.17Å
77	P	42.6	Very low	42.1	Very low	93 Å²	93	116.9 Å²	116.9	60%	0.604	68%	0.678	S	S	*	*			trans	-63.3	142.2	164.5	28.2	-31.8	0	0	0	108.1	H75 I79	H75-P77 WeakPolarHBondContact O-CD 3.33Å; P77-I79 PolarHBondContact O-N 3.23Å; P77-I79 WeakPolarHBondContact O-CG1 3.22Å
78	H	40.8	Very low	42.2	Very low	185 Å²	185	119.1 Å²	119.1	86%	0.856	68%	0.68	S	S	*	*			trans	-54.1	104.9	179.9	-153.3	-89	0	0	0	109.1	S80	H78-S80 PolarHBondContact O-N 3.02Å
79	I	42.2	Very low	42.5	Very low	121 Å²	121	118.4 Å²	118.4	62%	0.621	67%	0.668	S	S	*	*			trans	-69.8	103.1	-174	-62.6	171.4	0	0	0	108.2	P77	P77-I79 PolarHBondContact O-N 3.23Å; P77-I79 WeakPolarHBondContact O-CG1 3.22Å
80	S	43.4	Very low	42.7	Very low	98 Å²	98	122.1 Å²	122.1	69%	0.685	67%	0.666	S	S	*	*	S	Bend	trans	-92.6	-19.3	159.7	-54.2	0	0	0	0	111.5	H78	H78-S80 PolarHBondContact O-N 3.02Å
81	D	33.6	Very low	42.6	Very low	119 Å²	119	125.6 Å²	125.6	64%	0.636	67%	0.671	S	S	*	*			trans	-139.9	122.7	-173.9	-63	-57.7	0	0	0	111.8	V83	D81-V83 PolarHBondContact O-N 2.05Å
82	P	40.2	Very low	42.5	Very low	121 Å²	121	128.1 Å²	128.1	79%	0.786	68%	0.677	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.1	18.7	-169.9	33.6	-35.2	0	0	0	116.4
83	V	44.6	Very low	42.1	Very low	137 Å²	137	129.4 Å²	129.4	83%	0.83	69%	0.69	S	S	*	*	T	Hydrogen-bonded Turn	trans	-124.4	6.7	-169.4	-169	0	0	0	0	115.2	D81	D81-V83 PolarHBondContact O-N 2.05Å
84	S	40	Very low	42.1	Very low	89 Å²	89	133.4 Å²	133.4	62%	0.622	71%	0.706	S	S	*	*			trans	-149.3	120.8	175.9	43.5	0	0	0	0	107
85	F	41.8	Very low	41.6	Very low	197 Å²	197	136.8 Å²	136.8	86%	0.864	73%	0.727	S	S	*	*			cis	-175.7	159.4	45.9	-146.5	-113.9	0	0	0	107.6
86	F	40.5	Very low	41.8	Very low	192 Å²	192	135.1 Å²	135.1	84%	0.842	73%	0.729	S	S	*	*			trans	-48.3	132.1	174.2	-84.7	-107.4	0	0	0	112.6	E88	F86-E88 PolarHBondContact O-N 2.91Å
87	P	46.3	Very low	42	Very low	103 Å²	103	135.9 Å²	135.9	67%	0.669	74%	0.742	S	S	*	*			trans	-75.1	113	170.4	29.2	-29.6	0	0	0	109.2	L89	P87-L89 PolarHBondContact O-N 3.17Å; P87-L89 VanDerWaalsContact O-N 3.08Å
88	E	41.6	Very low	42.1	Very low	167 Å²	167	135.8 Å²	135.8	78%	0.78	75%	0.749	S	S	*	*			trans	-61.2	106.5	162	-169.8	175.6	118.2	0	0	107.6	F86 Q90	F86-E88 PolarHBondContact O-N 2.91Å; E88-Q90 VanDerWaalsContact C-N 3.35Å; E88-Q90 PolarHBondContact O-N 3.46Å
89	L	47.3	Very low	42.7	Very low	122 Å²	122	133.6 Å²	133.6	64%	0.639	75%	0.749	S	S	*	*			trans	-72.4	86.2	-179.1	-70	170.4	0	0	0	109.8	V72 P87 Q91	V72-L89 HydrophobicContact CG1-CD2 4.31Å; P87-L89 PolarHBondContact O-N 3.17Å; P87-L89 VanDerWaalsContact O-N 3.08Å; L89-Q91 VanDerWaalsContact C-N 3.35Å; L89-Q91 PolarHBondContact O-N 3.08Å
90	Q	45.9	Very low	43.1	Very low	150 Å²	150	133.8 Å²	133.8	70%	0.701	76%	0.755	S	S	*	*			trans	-72.8	93.3	163.7	-82.6	178.6	-2.9	0	0	109	E88 F92	E88-Q90 VanDerWaalsContact C-N 3.35Å; E88-Q90 PolarHBondContact O-N 3.46Å; Q90-F92 PolarHBondContact O-N 2.94Å; Q90-F92 VanDerWaalsContact O-N 3.11Å
91	Q	39.1	Very low	43.2	Very low	169 Å²	169	134.2 Å²	134.2	79%	0.79	76%	0.756	S	S	*	*			trans	-65.3	104	169.4	-73.5	177.4	5.2	0	0	109.2	L89 S93	L89-Q91 VanDerWaalsContact C-N 3.35Å; L89-Q91 PolarHBondContact O-N 3.08Å; Q91-S93 PolarHBondContact O-N 3.25Å
92	F	42.5	Very low	44.1	Very low	188 Å²	188	138.3 Å²	138.3	83%	0.825	79%	0.788	S	S	*	*			trans	-78	98.6	162.7	-101.7	-94.9	0	0	0	108.1	Q90 D94	Q90-F92 PolarHBondContact O-N 2.94Å; Q90-F92 VanDerWaalsContact O-N 3.11Å; F92-D94 PolarHBondContact O-N 3.5Å
93	S	38.7	Very low	44.3	Very low	104 Å²	104	139.2 Å²	139.2	73%	0.727	79%	0.788	S	S	*	*			trans	-71.9	102.6	169	-72.4	0	0	0	0	109.5	Q91 S95	Q91-S93 PolarHBondContact O-N 3.25Å; S93-S95 VanDerWaalsContact C-N 3.31Å; S93-S95 PolarHBondContact O-N 2.97Å
94	D	41.2	Very low	44.3	Very low	162 Å²	162	139.3 Å²	139.3	87%	0.866	79%	0.786	S	S	*	*			trans	-68.2	90.8	162.2	-91.7	-45	0	0	0	108.6	F92 P96	F92-D94 PolarHBondContact O-N 3.5Å; D94-P96 WeakPolarHBondContact O-CD 3.49Å
95	S	38	Very low	44.6	Very low	107 Å²	107	142.1 Å²	142.1	75%	0.748	80%	0.795	S	S	*	*			trans	-95	107.5	166.1	-156.4	0	0	0	0	108	S93	S93-S95 VanDerWaalsContact C-N 3.31Å; S93-S95 PolarHBondContact O-N 2.97Å
96	P	46.7	Very low	44.7	Very low	104 Å²	104	138.8 Å²	138.8	68%	0.675	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-68.1	142.3	166.3	27.9	-31.6	0	0	0	108.7	D94 A98	D94-P96 WeakPolarHBondContact O-CD 3.49Å; P96-A98 PolarHBondContact O-N 2.89Å; P96-A98 VanDerWaalsContact O-N 3.13Å
97	P	44.8	Very low	45	Very low	125 Å²	125	135.5 Å²	135.5	81%	0.812	79%	0.788	S	S	*	*	P	Polyproline II helix	trans	-60.1	123.4	173.2	25	-31.8	0	0	0	108.9	V99	P97-V99 PolarHBondContact O-N 3.03Å
98	A	44.3	Very low	44.9	Very low	91 Å²	91	137.7 Å²	137.7	75%	0.752	80%	0.796	S	S	*	*	P	Polyproline II helix	trans	-55.9	116.4	-179.2	0	0	0	0	0	110.8	P96 V100	P96-A98 PolarHBondContact O-N 2.89Å; P96-A98 VanDerWaalsContact O-N 3.13Å; A98-V100 PolarHBondContact O-N 3.37Å
99	V	53.5	Low	45.1	Very low	140 Å²	140	135.6 Å²	135.6	85%	0.848	80%	0.797	S	S	*	*			trans	-80	108.1	159.8	179.4	0	0	0	0	106.3	P97	P97-V99 PolarHBondContact O-N 3.03Å
100	V	51.5	Low	45	Very low	124 Å²	124	136.6 Å²	136.6	75%	0.752	81%	0.809	S	S	*	*			trans	-77.1	129.4	176.6	-178.7	0	0	0	0	109.1	A98	A98-V100 PolarHBondContact O-N 3.37Å
101	P	45.6	Very low	44.9	Very low	108 Å²	108	135.5 Å²	135.5	70%	0.701	82%	0.818	S	S	*	*			trans	-107.5	163.8	164.5	37.4	-28.5	0	0	0	111.6
102	P	52.7	Low	45.4	Very low	204 Å²	204	132.5 Å²	132.5	100%	1.325	82%	0.821	S	S	*	*			cis	-98.4	0	-10.4	37.3	-31	0	0	0	114.3

Retrieved 102 of 102 residues in 57.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).