A0A075B7F7_HUMAN Loading...

NBPF member 14

AlphaFold DB , UniProt , Accession A0A075B7F7, Species HUMAN (Homo sapiens, Human), Gene NBPF14, Length 77 aa.

						>A0A075B7F7_HUMAN|A0A075B7F7|NBPF14
MVVSAGPWSSEKAEMNILEINETLRPQLAEKKQQFRNLKEKCFLTQLAGFLANQQKKYKYEECKDLIKFMLRNERQF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.9	Low	64	Low	234 Å²	234	121.5 Å²	121.5	100%	1.153	73%	0.731	S	S	*	*				0	102	0	-158.8	-175.8	-117.9	0	0	106.4
2	V	51.7	Low	65.8	Low	136 Å²	136	120.3 Å²	120.3	82%	0.824	71%	0.709	S	S	*	*			trans	-84.8	113.2	179.6	174.3	0	0	0	0	106.8	S4	V2-S4 PolarHBondContact O-N 3.39Å
3	V	53.1	Low	67.3	Low	131 Å²	131	114 Å²	114	79%	0.794	68%	0.678	S	S	*	*			trans	-75.8	94.1	173.7	179.9	0	0	0	0	106.6	A5	V3-A5 PolarHBondContact O-N 3.3Å
4	S	59.2	Low	68.8	Low	105 Å²	105	114.4 Å²	114.4	73%	0.734	67%	0.67	S	S	*	*			trans	-65	105.3	166.1	-72	0	0	0	0	107.6	V2 G6	V2-S4 PolarHBondContact O-N 3.39Å; S4-G6 PolarHBondContact O-N 3.06Å
5	A	62.8	Low	70.3	Confident	97 Å²	97	114.7 Å²	114.7	80%	0.802	66%	0.664	S	S	*	*			trans	-65.2	90.5	161.9	0	0	0	0	0	106.8	V3	V3-A5 PolarHBondContact O-N 3.3Å
6	G	63.9	Low	71.5	Confident	51 Å²	51	110.9 Å²	110.9	53%	0.526	64%	0.641	S	S	.	*			trans	-55.4	154.9	173.2	0	0	0	0	0	110.3	S4 W8	S4-G6 PolarHBondContact O-N 3.06Å; G6-W8 PolarHBondContact O-N 3.32Å; G6-W8 VanDerWaalsContact O-N 3.15Å
7	P	65.3	Low	72.7	Confident	133 Å²	133	110.3 Å²	110.3	86%	0.864	63%	0.633	S	S	*	*			trans	-52.5	128.4	177.6	-3.7	10	0	0	0	108.3	S9	P7-S9 PolarHBondContact O-N 2.95Å
8	W	63.1	Low	73.9	Confident	148 Å²	148	110.3 Å²	110.3	56%	0.561	63%	0.63	S	S	*	*			trans	-45.7	130.6	174.9	-152.7	-60.7	0	0	0	108.4	G6 S10 K12 N16	G6-W8 PolarHBondContact O-N 3.32Å; G6-W8 VanDerWaalsContact O-N 3.15Å; W8-S10 PolarHBondContact O-N 2.97Å; W8-K12 HydrophobicContact CZ2-CD 4.3Å; W8-K12 VanDerWaalsContact NE1-CE 3.26Å; W8-N16 WeakPolarHBondContact CZ2-ND2 3.12Å
9	S	73.3	Confident	74.9	Confident	71 Å²	71	110.9 Å²	110.9	50%	0.497	63%	0.627	S	S	.	*			trans	-53.7	136.5	-178.6	60.1	0	0	0	0	109.7	P7 E11 K12 A13	P7-S9 PolarHBondContact O-N 2.95Å; S9-E11 PolarHBondContact O-N 3.14Å; S9-E11 VanDerWaalsContact O-N 3.11Å; S9-K12 PolarHBondContact O-N 3.23Å; S9-K12 WeakPolarHBondContact OG-CB 3.04Å; S9-A13 PolarHBondContact O-N 3.22Å; S9-A13 VanDerWaalsContact O-N 3.08Å
10	S	76.6	Confident	75.9	Confident	88 Å²	88	110.3 Å²	110.3	62%	0.615	62%	0.621	S	S	*	*	H	α-helix	trans	-50.9	-41.1	-174.5	55.2	0	0	0	0	111.9	W8 K12 A13 E14	W8-S10 PolarHBondContact O-N 2.97Å; S10-K12 PolarHBondContact O-N 3.49Å; S10-A13 WeakPolarHBondContact O-CB 3.45Å; S10-A13 PolarHBondContact O-N 2.89Å; S10-A13 VanDerWaalsContact O-N 3.13Å; S10-E14 WeakPolarHBondContact O-CG 3.41Å; S10-E14 PolarHBondContact O-N 3.46Å
11	E	82.1	Confident	76.8	Confident	143 Å²	143	108.6 Å²	108.6	67%	0.668	61%	0.61	S	S	*	*	H	α-helix	trans	-62.1	-38.8	179.3	-157	165.5	-149.3	0	0	113.2	S9 M15	S9-E11 PolarHBondContact O-N 3.14Å; S9-E11 VanDerWaalsContact O-N 3.11Å; E11-M15 WeakPolarHBondContact O-CB 3.49Å; E11-M15 PolarHBondContact O-N 3.18Å
12	K	85.2	Confident	78.8	Confident	107 Å²	107	104.3 Å²	104.3	47%	0.465	59%	0.588	S	S	.	*	H	α-helix	trans	-79.3	-22.6	177.5	-166	-171.2	162	-163.3	0	111.5	W8 S9 S10 N16	W8-K12 HydrophobicContact CZ2-CD 4.3Å; W8-K12 VanDerWaalsContact NE1-CE 3.26Å; S9-K12 PolarHBondContact O-N 3.23Å; S9-K12 WeakPolarHBondContact OG-CB 3.04Å; S10-K12 PolarHBondContact O-N 3.49Å; K12-N16 PolarHBondContact O-N 2.96Å; K12-N16 PolarHBondContact O-ND2 3.12Å
13	A	86.4	Confident	80.9	Confident	38 Å²	38	101.2 Å²	101.2	31%	0.314	57%	0.569	S	S	.	*	H	α-helix	trans	-73.9	-41.8	169.2	0	0	0	0	0	111.8	S9 S10 N16 I17	S9-A13 PolarHBondContact O-N 3.22Å; S9-A13 VanDerWaalsContact O-N 3.08Å; S10-A13 WeakPolarHBondContact O-CB 3.45Å; S10-A13 PolarHBondContact O-N 2.89Å; S10-A13 VanDerWaalsContact O-N 3.13Å; A13-N16 PolarHBondContact O-N 3.02Å; A13-I17 WeakPolarHBondContact O-CG1 3.41Å; A13-I17 PolarHBondContact O-N 3.45Å; A13-I17 VanDerWaalsContact O-N 3.1Å
14	E	87.4	Confident	83	Confident	120 Å²	120	99 Å²	99	56%	0.561	55%	0.552	S	S	*	*	H	α-helix	trans	-62.7	-42.4	176.2	-74.2	171.5	-158	0	0	112.1	S10 N16 I17 L18	S10-E14 WeakPolarHBondContact O-CG 3.41Å; S10-E14 PolarHBondContact O-N 3.46Å; E14-N16 PolarHBondContact O-N 3.43Å; E14-I17 PolarHBondContact O-N 3.04Å; E14-L18 PolarHBondContact O-N 3.35Å
15	M	91.1	Very high	84.8	Confident	118 Å²	118	103.1 Å²	103.1	58%	0.581	55%	0.552	S	S	*	*	H	α-helix	trans	-62.3	-42.9	176.7	-160.5	-176.8	-40	0	0	112.3	E11 I17 L18 E19	E11-M15 WeakPolarHBondContact O-CB 3.49Å; E11-M15 PolarHBondContact O-N 3.18Å; M15-I17 VanDerWaalsContact C-N 3.31Å; M15-I17 PolarHBondContact O-N 2.64Å; M15-L18 PolarHBondContact O-N 3.45Å; M15-E19 PolarHBondContact O-N 3.49Å
16	N	89.6	Confident	86.4	Confident	55 Å²	55	102.2 Å²	102.2	29%	0.294	54%	0.538	S	S	.	.	H	α-helix	trans	-61.9	-38.9	174.9	-73.9	-12.8	0	0	0	111.9	W8 K12 A13 E14 L18 I20	W8-N16 WeakPolarHBondContact CZ2-ND2 3.12Å; K12-N16 PolarHBondContact O-N 2.96Å; K12-N16 PolarHBondContact O-ND2 3.12Å; A13-N16 PolarHBondContact O-N 3.02Å; E14-N16 PolarHBondContact O-N 3.43Å; N16-L18 VanDerWaalsContact C-N 3.34Å; N16-I20 WeakPolarHBondContact O-CB 3.38Å; N16-I20 WeakPolarHBondContact O-CD1 3.47Å; N16-I20 VanDerWaalsContact O-CG1 3.23Å; N16-I20 WeakPolarHBondContact O-CG1 3.46Å; N16-I20 PolarHBondContact O-N 3.29Å
17	I	92.7	Very high	88	Confident	100 Å²	100	104.7 Å²	104.7	51%	0.513	54%	0.535	S	S	.	.	H	α-helix	trans	-66.1	-38.7	177.6	-69.6	165.4	0	0	0	110.9	A13 E14 M15 N21	A13-I17 WeakPolarHBondContact O-CG1 3.41Å; A13-I17 PolarHBondContact O-N 3.45Å; A13-I17 VanDerWaalsContact O-N 3.1Å; E14-I17 PolarHBondContact O-N 3.04Å; M15-I17 VanDerWaalsContact C-N 3.31Å; M15-I17 PolarHBondContact O-N 2.64Å; I17-N21 WeakPolarHBondContact O-CB 2.93Å; I17-N21 PolarHBondContact O-N 2.87Å; I17-N21 PolarHBondContact O-ND2 3.43Å
18	L	94.6	Very high	89.5	Confident	110 Å²	110	103 Å²	103	58%	0.576	52%	0.519	S	S	*	.	H	α-helix	trans	-65.6	-47.4	176.4	-74.9	170.2	0	0	0	111.5	E14 M15 N16 I20 N21 E22	E14-L18 PolarHBondContact O-N 3.35Å; M15-L18 PolarHBondContact O-N 3.45Å; N16-L18 VanDerWaalsContact C-N 3.34Å; L18-I20 PolarHBondContact O-N 3.45Å; L18-N21 PolarHBondContact O-N 2.99Å; L18-N21 VanDerWaalsContact O-N 3.11Å; L18-E22 WeakPolarHBondContact O-CG 3.28Å; L18-E22 PolarHBondContact O-N 3.03Å
19	E	92.9	Very high	91.1	Very high	122 Å²	122	98.6 Å²	98.6	57%	0.57	51%	0.514	S	S	*	.	H	α-helix	trans	-59.6	-44.4	177.9	-172.1	179.1	-174.2	0	0	111.8	M15 N21 E22 T23	M15-E19 PolarHBondContact O-N 3.49Å; E19-N21 VanDerWaalsContact C-N 3.34Å; E19-N21 PolarHBondContact O-N 3.38Å; E19-E22 PolarHBondContact O-N 3.46Å; E19-T23 WeakPolarHBondContact O-CG2 3.36Å; E19-T23 PolarHBondContact O-N 3.19Å; E19-T23 VanDerWaalsContact O-N 3.09Å; E19-T23 PolarHBondContact O-OG1 3.42Å
20	I	94.6	Very high	92.3	Very high	98 Å²	98	100.4 Å²	100.4	50%	0.503	52%	0.515	S	S	.	.	H	α-helix	trans	-62.3	-42.6	175	-68.2	166.7	0	0	0	110.8	N16 L18 E22 T23 L24	N16-I20 WeakPolarHBondContact O-CB 3.38Å; N16-I20 WeakPolarHBondContact O-CD1 3.47Å; N16-I20 VanDerWaalsContact O-CG1 3.23Å; N16-I20 WeakPolarHBondContact O-CG1 3.46Å; N16-I20 PolarHBondContact O-N 3.29Å; L18-I20 PolarHBondContact O-N 3.45Å; I20-E22 PolarHBondContact O-N 2.9Å; I20-T23 PolarHBondContact O-N 3.04Å; I20-T23 PolarHBondContact O-OG1 3.28Å; I20-L24 HydrophobicContact CG2-CD1 3.69Å; I20-L24 HydrophobicContact CG2-CG 4.19Å; I20-L24 WeakPolarHBondContact O-CB 3.47Å; I20-L24 VanDerWaalsContact O-CG 3.27Å; I20-L24 WeakPolarHBondContact O-CG 3.46Å; I20-L24 PolarHBondContact O-N 3Å
21	N	94.7	Very high	93.2	Very high	75 Å²	75	102.2 Å²	102.2	40%	0.401	51%	0.511	S	S	.	.	H	α-helix	trans	-65.1	-39.4	178.1	-88.6	-54.2	0	0	0	112.8	I17 L18 E19 T23 L24 R25	I17-N21 WeakPolarHBondContact O-CB 2.93Å; I17-N21 PolarHBondContact O-N 2.87Å; I17-N21 PolarHBondContact O-ND2 3.43Å; L18-N21 PolarHBondContact O-N 2.99Å; L18-N21 VanDerWaalsContact O-N 3.11Å; E19-N21 VanDerWaalsContact C-N 3.34Å; E19-N21 PolarHBondContact O-N 3.38Å; N21-T23 VanDerWaalsContact C-N 3.29Å; N21-T23 PolarHBondContact O-N 3.49Å; N21-L24 PolarHBondContact O-N 3.31Å; N21-R25 WeakPolarHBondContact O-CG 3.45Å; N21-R25 PolarHBondContact O-N 3.41Å; N21-R25 VanDerWaalsContact O-N 3.11Å
22	E	95.4	Very high	94	Very high	145 Å²	145	100.8 Å²	100.8	68%	0.678	50%	0.503	S	S	*	.	H	α-helix	trans	-63.8	-36	177	-74.6	-173.3	166.1	0	0	112	L18 E19 I20 P26	L18-E22 WeakPolarHBondContact O-CG 3.28Å; L18-E22 PolarHBondContact O-N 3.03Å; E19-E22 PolarHBondContact O-N 3.46Å; I20-E22 PolarHBondContact O-N 2.9Å; E22-P26 WeakPolarHBondContact O-CD 3.4Å
23	T	95.6	Very high	94.6	Very high	70 Å²	70	99.7 Å²	99.7	43%	0.429	50%	0.499	S	S	.	.	H	α-helix	trans	-77.3	-31.7	176.2	61	0	0	0	0	113.5	E19 I20 N21 P26 Q27	E19-T23 WeakPolarHBondContact O-CG2 3.36Å; E19-T23 PolarHBondContact O-N 3.19Å; E19-T23 VanDerWaalsContact O-N 3.09Å; E19-T23 PolarHBondContact O-OG1 3.42Å; I20-T23 PolarHBondContact O-N 3.04Å; I20-T23 PolarHBondContact O-OG1 3.28Å; N21-T23 VanDerWaalsContact C-N 3.29Å; N21-T23 PolarHBondContact O-N 3.49Å; T23-P26 WeakPolarHBondContact O-CD 3.44Å; T23-P26 WeakPolarHBondContact O-CG 3.41Å; T23-Q27 WeakPolarHBondContact O-CG 3.34Å; T23-Q27 PolarHBondContact O-NE2 3.18Å
24	L	96.8	Very high	95.1	Very high	86 Å²	86	101.4 Å²	101.4	45%	0.45	50%	0.501	S	S	.	.	H	α-helix	trans	-76.4	-33	-179.5	-74	176	0	0	0	113.3	I20 N21 Q27 L28	I20-L24 HydrophobicContact CG2-CD1 3.69Å; I20-L24 HydrophobicContact CG2-CG 4.19Å; I20-L24 WeakPolarHBondContact O-CB 3.47Å; I20-L24 VanDerWaalsContact O-CG 3.27Å; I20-L24 WeakPolarHBondContact O-CG 3.46Å; I20-L24 PolarHBondContact O-N 3Å; N21-L24 PolarHBondContact O-N 3.31Å; L24-Q27 PolarHBondContact O-N 2.99Å; L24-L28 WeakPolarHBondContact O-CB 3.33Å; L24-L28 PolarHBondContact O-N 2.92Å
25	R	96.4	Very high	95.6	Very high	191 Å²	191	102.6 Å²	102.6	72%	0.721	51%	0.505	S	S	*	.	H	α-helix	trans	-55.3	-51.9	178.5	-79.9	179	179.8	-164.4	2.6	114.1	N21 L28 A29	N21-R25 WeakPolarHBondContact O-CG 3.45Å; N21-R25 PolarHBondContact O-N 3.41Å; N21-R25 VanDerWaalsContact O-N 3.11Å; R25-L28 PolarHBondContact O-N 3.12Å; R25-A29 PolarHBondContact O-N 3.4Å; R25-A29 VanDerWaalsContact O-N 3.08Å
26	P	96.4	Very high	95.9	Very high	78 Å²	78	103.1 Å²	103.1	51%	0.506	50%	0.5	S	S	.	.	H	α-helix	trans	-66.4	-39.5	177.9	24.7	-32.8	0	0	0	111.9	E22 T23 L28 A29 E30	E22-P26 WeakPolarHBondContact O-CD 3.4Å; T23-P26 WeakPolarHBondContact O-CD 3.44Å; T23-P26 WeakPolarHBondContact O-CG 3.41Å; P26-L28 VanDerWaalsContact C-N 3.31Å; P26-L28 PolarHBondContact O-N 2.96Å; P26-A29 WeakPolarHBondContact O-CB 3.5Å; P26-A29 PolarHBondContact O-N 2.9Å; P26-A29 VanDerWaalsContact O-N 3.15Å; P26-E30 WeakPolarHBondContact O-CB 3.37Å; P26-E30 PolarHBondContact O-N 2.88Å
27	Q	97	Very high	96.3	Very high	102 Å²	102	103.7 Å²	103.7	48%	0.477	50%	0.503	S	S	.	.	H	α-helix	trans	-59.5	-42.1	175.8	-70.5	179.6	58.4	0	0	111.7	T23 L24 E30 K31	T23-Q27 WeakPolarHBondContact O-CG 3.34Å; T23-Q27 PolarHBondContact O-NE2 3.18Å; L24-Q27 PolarHBondContact O-N 2.99Å; Q27-E30 PolarHBondContact O-N 3.45Å; Q27-K31 WeakPolarHBondContact O-CB 3.49Å; Q27-K31 VanDerWaalsContact O-CG 3.23Å; Q27-K31 WeakPolarHBondContact O-CG 3.46Å; Q27-K31 PolarHBondContact O-N 3.24Å
28	L	97.4	Very high	96.5	Very high	98 Å²	98	104.6 Å²	104.6	51%	0.513	51%	0.508	S	S	.	.	H	α-helix	trans	-64.8	-41.5	176.5	-178.6	61.6	0	0	0	111.7	L24 R25 P26 E30 K31 K32	L24-L28 WeakPolarHBondContact O-CB 3.33Å; L24-L28 PolarHBondContact O-N 2.92Å; R25-L28 PolarHBondContact O-N 3.12Å; P26-L28 VanDerWaalsContact C-N 3.31Å; P26-L28 PolarHBondContact O-N 2.96Å; L28-E30 VanDerWaalsContact C-N 3.35Å; L28-K31 PolarHBondContact O-N 3.06Å; L28-K32 HydrophobicContact CG-CD 4.4Å; L28-K32 WeakPolarHBondContact O-CB 3.38Å; L28-K32 VanDerWaalsContact O-CG 3.31Å; L28-K32 WeakPolarHBondContact O-CG 3.34Å; L28-K32 PolarHBondContact O-N 2.78Å
29	A	96.7	Very high	96.6	Very high	56 Å²	56	105 Å²	105	46%	0.463	51%	0.505	S	S	.	.	H	α-helix	trans	-63	-43.3	176.8	0	0	0	0	0	111.4	R25 P26 K32 Q33	R25-A29 PolarHBondContact O-N 3.4Å; R25-A29 VanDerWaalsContact O-N 3.08Å; P26-A29 WeakPolarHBondContact O-CB 3.5Å; P26-A29 PolarHBondContact O-N 2.9Å; P26-A29 VanDerWaalsContact O-N 3.15Å; A29-K32 PolarHBondContact O-N 2.93Å; A29-Q33 PolarHBondContact O-N 3.41Å
30	E	97.8	Very high	96.8	Very high	109 Å²	109	104.8 Å²	104.8	51%	0.509	50%	0.504	S	S	.	.	H	α-helix	trans	-61.7	-49.3	176	-168.8	-168.8	164.1	0	0	111.3	P26 Q27 L28 K32 Q33 Q34	P26-E30 WeakPolarHBondContact O-CB 3.37Å; P26-E30 PolarHBondContact O-N 2.88Å; Q27-E30 PolarHBondContact O-N 3.45Å; L28-E30 VanDerWaalsContact C-N 3.35Å; E30-K32 VanDerWaalsContact C-N 3.32Å; E30-K32 PolarHBondContact O-N 3.04Å; E30-Q33 WeakPolarHBondContact O-CB 3.49Å; E30-Q33 PolarHBondContact O-N 3.04Å; E30-Q34 WeakPolarHBondContact O-CG 3.47Å; E30-Q34 PolarHBondContact O-N 3.44Å; E30-Q34 PolarHBondContact OE1-NE2 3.34Å
31	K	97.2	Very high	96.9	Very high	125 Å²	125	106.9 Å²	106.9	54%	0.543	51%	0.51	S	S	.	.	H	α-helix	trans	-62.4	-38.7	179.1	-68.2	-71	163.6	-162.7	0	112.2	Q27 L28 Q33 Q34 F35	Q27-K31 WeakPolarHBondContact O-CB 3.49Å; Q27-K31 VanDerWaalsContact O-CG 3.23Å; Q27-K31 WeakPolarHBondContact O-CG 3.46Å; Q27-K31 PolarHBondContact O-N 3.24Å; L28-K31 PolarHBondContact O-N 3.06Å; K31-Q33 VanDerWaalsContact C-N 3.31Å; K31-Q33 PolarHBondContact O-N 3.48Å; K31-Q34 PolarHBondContact O-N 2.93Å; K31-F35 WeakPolarHBondContact O-CB 3.34Å; K31-F35 PolarHBondContact O-N 3.4Å
32	K	97.8	Very high	97	Very high	114 Å²	114	106.4 Å²	106.4	50%	0.496	51%	0.512	S	S	.	.	H	α-helix	trans	-60.4	-41.6	172.6	-79	176.8	178.3	179	0	111.7	L28 A29 E30 F35 R36	L28-K32 HydrophobicContact CG-CD 4.4Å; L28-K32 WeakPolarHBondContact O-CB 3.38Å; L28-K32 VanDerWaalsContact O-CG 3.31Å; L28-K32 WeakPolarHBondContact O-CG 3.34Å; L28-K32 PolarHBondContact O-N 2.78Å; A29-K32 PolarHBondContact O-N 2.93Å; E30-K32 VanDerWaalsContact C-N 3.32Å; E30-K32 PolarHBondContact O-N 3.04Å; K32-F35 PolarHBondContact O-N 3.22Å; K32-R36 PolarHBondContact O-N 3.35Å; K32-R36 VanDerWaalsContact O-N 3.13Å
33	Q	97.8	Very high	97.1	Very high	83 Å²	83	105 Å²	105	39%	0.388	50%	0.504	S	S	.	.	H	α-helix	trans	-68.9	-43	177.2	-169.9	59	28.7	0	0	112	A29 E30 K31 F35 R36 N37	A29-Q33 PolarHBondContact O-N 3.41Å; E30-Q33 WeakPolarHBondContact O-CB 3.49Å; E30-Q33 PolarHBondContact O-N 3.04Å; K31-Q33 VanDerWaalsContact C-N 3.31Å; K31-Q33 PolarHBondContact O-N 3.48Å; Q33-F35 VanDerWaalsContact C-N 3.28Å; Q33-F35 PolarHBondContact O-N 3.49Å; Q33-R36 PolarHBondContact O-N 3.24Å; Q33-R36 VanDerWaalsContact OE1-NE 3.07Å; Q33-N37 PolarHBondContact NE2-OD1 3.39Å; Q33-N37 VanDerWaalsContact NE2-OD1 3.08Å; Q33-N37 PolarHBondContact O-N 3Å; Q33-N37 PolarHBondContact O-OD1 3.22Å
34	Q	98.1	Very high	97.1	Very high	75 Å²	75	107.2 Å²	107.2	35%	0.35	51%	0.512	S	S	.	.	H	α-helix	trans	-57.2	-42.9	174.7	-71.9	177.9	-4.6	0	0	111.3	E30 K31 N37 L38	E30-Q34 WeakPolarHBondContact O-CG 3.47Å; E30-Q34 PolarHBondContact O-N 3.44Å; E30-Q34 PolarHBondContact OE1-NE2 3.34Å; K31-Q34 PolarHBondContact O-N 2.93Å; Q34-N37 PolarHBondContact O-N 2.92Å; Q34-L38 WeakPolarHBondContact O-CD1 3.42Å; Q34-L38 PolarHBondContact O-N 3.29Å
35	F	97.7	Very high	97.1	Very high	145 Å²	145	108 Å²	108	64%	0.636	52%	0.521	S	S	*	.	H	α-helix	trans	-63	-43.2	177.3	-173.5	-100.1	0	0	0	112.6	K31 K32 Q33 L38 K39	K31-F35 WeakPolarHBondContact O-CB 3.34Å; K31-F35 PolarHBondContact O-N 3.4Å; K32-F35 PolarHBondContact O-N 3.22Å; Q33-F35 VanDerWaalsContact C-N 3.28Å; Q33-F35 PolarHBondContact O-N 3.49Å; F35-L38 PolarHBondContact O-N 3.01Å; F35-K39 WeakPolarHBondContact O-CB 3.49Å; F35-K39 PolarHBondContact O-N 3.05Å
36	R	97.4	Very high	97.2	Very high	129 Å²	129	104.5 Å²	104.5	49%	0.487	51%	0.513	S	S	.	.	H	α-helix	trans	-59.6	-47.9	174.2	-76.5	-171.4	-76.6	-107.5	3	111.8	K32 Q33 L38 K39 E40	K32-R36 PolarHBondContact O-N 3.35Å; K32-R36 VanDerWaalsContact O-N 3.13Å; Q33-R36 PolarHBondContact O-N 3.24Å; Q33-R36 VanDerWaalsContact OE1-NE 3.07Å; R36-L38 VanDerWaalsContact C-N 3.33Å; R36-L38 PolarHBondContact O-N 3.27Å; R36-K39 WeakPolarHBondContact O-CB 3.11Å; R36-K39 PolarHBondContact O-N 2.93Å; R36-K39 VanDerWaalsContact O-N 3.16Å; R36-E40 PolarHBondContact O-N 3.21Å
37	N	97.2	Very high	97.2	Very high	67 Å²	67	105.4 Å²	105.4	36%	0.358	51%	0.512	S	S	.	.	H	α-helix	trans	-61.6	-40.7	178.6	-67.8	-0.1	0	0	0	112	Q33 Q34 E40 K41	Q33-N37 PolarHBondContact NE2-OD1 3.39Å; Q33-N37 VanDerWaalsContact NE2-OD1 3.08Å; Q33-N37 PolarHBondContact O-N 3Å; Q33-N37 PolarHBondContact O-OD1 3.22Å; Q34-N37 PolarHBondContact O-N 2.92Å; N37-E40 PolarHBondContact O-N 3.43Å; N37-K41 WeakPolarHBondContact O-CG 3.49Å; N37-K41 PolarHBondContact O-N 3.03Å
38	L	97.4	Very high	97.2	Very high	118 Å²	118	103.2 Å²	103.2	62%	0.618	51%	0.512	S	S	*	.	H	α-helix	trans	-63.7	-42.4	175.5	-106.9	75.5	0	0	0	111.7	Q34 F35 R36 K41 C42	Q34-L38 WeakPolarHBondContact O-CD1 3.42Å; Q34-L38 PolarHBondContact O-N 3.29Å; F35-L38 PolarHBondContact O-N 3.01Å; R36-L38 VanDerWaalsContact C-N 3.33Å; R36-L38 PolarHBondContact O-N 3.27Å; L38-K41 PolarHBondContact O-N 2.83Å; L38-C42 WeakPolarHBondContact O-CB 3.36Å; L38-C42 PolarHBondContact O-N 3.3Å
39	K	97.3	Very high	97.1	Very high	118 Å²	118	100.1 Å²	100.1	51%	0.513	50%	0.504	S	S	.	.	H	α-helix	trans	-60.8	-45.7	178.5	-176.5	172	177.9	177.2	0	111	F35 R36 C42 F43	F35-K39 WeakPolarHBondContact O-CB 3.49Å; F35-K39 PolarHBondContact O-N 3.05Å; R36-K39 WeakPolarHBondContact O-CB 3.11Å; R36-K39 PolarHBondContact O-N 2.93Å; R36-K39 VanDerWaalsContact O-N 3.16Å; K39-C42 WeakPolarHBondContact O-CB 3.45Å; K39-C42 PolarHBondContact O-N 3.31Å; K39-F43 HydrophobicContact CD-CE2 4.16Å; K39-F43 HydrophobicContact CG-CD2 3.9Å; K39-F43 HydrophobicContact CG-CE2 3.53Å; K39-F43 WeakPolarHBondContact O-CD2 3.35Å; K39-F43 PolarHBondContact O-N 2.85Å
40	E	96.5	Very high	97.1	Very high	118 Å²	118	103 Å²	103	55%	0.551	51%	0.506	S	S	*	.	H	α-helix	trans	-60.5	-47.9	175.1	-72.5	173.8	-169.3	0	0	112.3	R36 N37 C42 F43 L44	R36-E40 PolarHBondContact O-N 3.21Å; N37-E40 PolarHBondContact O-N 3.43Å; E40-C42 VanDerWaalsContact C-N 3.29Å; E40-C42 PolarHBondContact O-N 3.41Å; E40-F43 PolarHBondContact O-N 3.48Å; E40-L44 WeakPolarHBondContact O-CG 3.36Å; E40-L44 PolarHBondContact O-N 3.46Å
41	K	96.9	Very high	97	Very high	143 Å²	143	102.4 Å²	102.4	62%	0.622	51%	0.506	S	S	*	.	H	α-helix	trans	-60	-39	176.8	-73.9	179.4	179.3	-175.3	0	112.7	N37 L38 L44 T45	N37-K41 WeakPolarHBondContact O-CG 3.49Å; N37-K41 PolarHBondContact O-N 3.03Å; L38-K41 PolarHBondContact O-N 2.83Å; K41-L44 PolarHBondContact O-N 3.08Å; K41-T45 WeakPolarHBondContact O-CB 3.47Å; K41-T45 PolarHBondContact O-N 2.98Å; K41-T45 PolarHBondContact O-OG1 2.93Å
42	C	96.9	Very high	96.9	Very high	65 Å²	65	98.5 Å²	98.5	44%	0.439	50%	0.497	S	S	.	.	H	α-helix	trans	-62.4	-48.4	176.2	-174	0	0	0	0	110.6	L38 K39 E40 L44 T45 Q46	L38-C42 WeakPolarHBondContact O-CB 3.36Å; L38-C42 PolarHBondContact O-N 3.3Å; K39-C42 WeakPolarHBondContact O-CB 3.45Å; K39-C42 PolarHBondContact O-N 3.31Å; E40-C42 VanDerWaalsContact C-N 3.29Å; E40-C42 PolarHBondContact O-N 3.41Å; C42-L44 PolarHBondContact O-N 3.36Å; C42-T45 PolarHBondContact O-N 3.2Å; C42-Q46 WeakPolarHBondContact O-CG 3.41Å; C42-Q46 PolarHBondContact O-N 3.36Å
43	F	96.3	Very high	96.7	Very high	115 Å²	115	98 Å²	98	50%	0.504	50%	0.5	S	S	.	.	H	α-helix	trans	-61.1	-43.7	176.9	-79.2	-61.5	0	0	0	113	K39 E40 T45 Q46 L47	K39-F43 HydrophobicContact CD-CE2 4.16Å; K39-F43 HydrophobicContact CG-CD2 3.9Å; K39-F43 HydrophobicContact CG-CE2 3.53Å; K39-F43 WeakPolarHBondContact O-CD2 3.35Å; K39-F43 PolarHBondContact O-N 2.85Å; E40-F43 PolarHBondContact O-N 3.48Å; F43-T45 VanDerWaalsContact C-N 3.31Å; F43-T45 PolarHBondContact O-N 3.39Å; F43-Q46 PolarHBondContact O-N 2.91Å; F43-L47 WeakPolarHBondContact O-CB 3.5Å; F43-L47 PolarHBondContact O-N 2.89Å
44	L	96.9	Very high	96.4	Very high	116 Å²	116	98.9 Å²	98.9	61%	0.607	50%	0.504	S	S	*	.	H	α-helix	trans	-61.3	-41.9	177.3	-71.5	173.3	0	0	0	111.7	E40 K41 C42 L47 A48	E40-L44 WeakPolarHBondContact O-CG 3.36Å; E40-L44 PolarHBondContact O-N 3.46Å; K41-L44 PolarHBondContact O-N 3.08Å; C42-L44 PolarHBondContact O-N 3.36Å; L44-L47 PolarHBondContact O-N 3.4Å; L44-A48 WeakPolarHBondContact O-CB 3.5Å; L44-A48 PolarHBondContact O-N 3.16Å
45	T	96.9	Very high	96	Very high	103 Å²	103	100.7 Å²	100.7	63%	0.632	51%	0.512	S	S	*	.	H	α-helix	trans	-64.3	-44	176.4	-55.3	0	0	0	0	111.7	K41 C42 F43 A48 G49	K41-T45 WeakPolarHBondContact O-CB 3.47Å; K41-T45 PolarHBondContact O-N 2.98Å; K41-T45 PolarHBondContact O-OG1 2.93Å; C42-T45 PolarHBondContact O-N 3.2Å; F43-T45 VanDerWaalsContact C-N 3.31Å; F43-T45 PolarHBondContact O-N 3.39Å; T45-A48 PolarHBondContact O-N 3.13Å; T45-G49 PolarHBondContact O-N 2.88Å
46	Q	96.9	Very high	95.7	Very high	118 Å²	118	100.7 Å²	100.7	55%	0.551	51%	0.512	S	S	*	.	H	α-helix	trans	-62.5	-44.2	176.4	-73.3	177.5	-1.9	0	0	111.7	C42 F43 G49 F50	C42-Q46 WeakPolarHBondContact O-CG 3.41Å; C42-Q46 PolarHBondContact O-N 3.36Å; F43-Q46 PolarHBondContact O-N 2.91Å; Q46-G49 PolarHBondContact O-N 3.32Å; Q46-F50 WeakPolarHBondContact O-CB 3.44Å; Q46-F50 PolarHBondContact O-N 2.96Å
47	L	97.1	Very high	95.5	Very high	96 Å²	96	102 Å²	102	50%	0.503	52%	0.521	S	S	.	.	H	α-helix	trans	-62.7	-45.1	177.3	-176	65.5	0	0	0	111.2	F43 L44 G49 F50 L51	F43-L47 WeakPolarHBondContact O-CB 3.5Å; F43-L47 PolarHBondContact O-N 2.89Å; L44-L47 PolarHBondContact O-N 3.4Å; L47-G49 VanDerWaalsContact C-N 3.33Å; L47-G49 PolarHBondContact O-N 3.35Å; L47-F50 WeakPolarHBondContact O-CB 3.41Å; L47-F50 PolarHBondContact O-N 3Å; L47-L51 HydrophobicContact CG-CD1 4.21Å; L47-L51 WeakPolarHBondContact O-CG 3.49Å; L47-L51 PolarHBondContact O-N 2.88Å
48	A	96.9	Very high	95	Very high	57 Å²	57	105.7 Å²	105.7	47%	0.471	53%	0.531	S	S	.	.	H	α-helix	trans	-60.4	-42.8	175.6	0	0	0	0	0	111.8	L44 T45 L51 A52	L44-A48 WeakPolarHBondContact O-CB 3.5Å; L44-A48 PolarHBondContact O-N 3.16Å; T45-A48 PolarHBondContact O-N 3.13Å; A48-L51 PolarHBondContact O-N 3.39Å; A48-A52 WeakPolarHBondContact O-CB 3.31Å; A48-A52 PolarHBondContact O-N 2.96Å
49	G	96.5	Very high	94.6	Very high	33 Å²	33	105.5 Å²	105.5	34%	0.34	53%	0.525	S	S	.	.	H	α-helix	trans	-62	-42.7	174.8	0	0	0	0	0	112.7	T45 Q46 L47 A52 N53	T45-G49 PolarHBondContact O-N 2.88Å; Q46-G49 PolarHBondContact O-N 3.32Å; L47-G49 VanDerWaalsContact C-N 3.33Å; L47-G49 PolarHBondContact O-N 3.35Å; G49-A52 PolarHBondContact O-N 3.42Å; G49-N53 WeakPolarHBondContact O-CB 3.42Å; G49-N53 VanDerWaalsContact O-CG 3.23Å; G49-N53 PolarHBondContact O-N 2.96Å; G49-N53 PolarHBondContact O-ND2 3.49Å
50	F	95.8	Very high	94.2	Very high	117 Å²	117	107.4 Å²	107.4	51%	0.513	53%	0.53	S	S	.	.	H	α-helix	trans	-61.8	-47.7	175.5	178.8	-97.8	0	0	0	112	Q46 L47 A52 N53 Q54	Q46-F50 WeakPolarHBondContact O-CB 3.44Å; Q46-F50 PolarHBondContact O-N 2.96Å; L47-F50 WeakPolarHBondContact O-CB 3.41Å; L47-F50 PolarHBondContact O-N 3Å; F50-A52 PolarHBondContact O-N 3.15Å; F50-N53 PolarHBondContact O-N 3.47Å; F50-Q54 HydrophobicContact CD1-CG 4.31Å; F50-Q54 HydrophobicContact CE1-CG 3.89Å; F50-Q54 HydrophobicContact CE2-CG 4.49Å; F50-Q54 HydrophobicContact CZ-CG 3.99Å; F50-Q54 PolarHBondContact O-N 3.36Å
51	L	95.4	Very high	93.9	Very high	96 Å²	96	105.2 Å²	105.2	50%	0.503	52%	0.52	S	S	.	.	H	α-helix	trans	-62.5	-42.8	178.4	-70.5	172.7	0	0	0	111.9	L47 A48 N53 Q54 Q55	L47-L51 HydrophobicContact CG-CD1 4.21Å; L47-L51 WeakPolarHBondContact O-CG 3.49Å; L47-L51 PolarHBondContact O-N 2.88Å; A48-L51 PolarHBondContact O-N 3.39Å; L51-N53 VanDerWaalsContact C-N 3.3Å; L51-N53 PolarHBondContact O-N 3.37Å; L51-Q54 PolarHBondContact O-N 3.05Å; L51-Q55 PolarHBondContact O-N 2.84Å
52	A	95	Very high	93.5	Very high	42 Å²	42	102.9 Å²	102.9	35%	0.347	51%	0.511	S	S	.	.	H	α-helix	trans	-61.1	-39.9	175.8	0	0	0	0	0	111.9	A48 G49 F50 Q55 K56	A48-A52 WeakPolarHBondContact O-CB 3.31Å; A48-A52 PolarHBondContact O-N 2.96Å; G49-A52 PolarHBondContact O-N 3.42Å; F50-A52 PolarHBondContact O-N 3.15Å; A52-Q55 PolarHBondContact O-N 3.46Å; A52-K56 WeakPolarHBondContact O-CG 3.38Å; A52-K56 PolarHBondContact O-N 3.08Å
53	N	93.4	Very high	93.1	Very high	104 Å²	104	103.3 Å²	103.3	56%	0.556	51%	0.514	S	S	*	.	H	α-helix	trans	-66.6	-41.7	175.7	-71.9	-20.4	0	0	0	112	G49 F50 L51 K56 K57	G49-N53 WeakPolarHBondContact O-CB 3.42Å; G49-N53 VanDerWaalsContact O-CG 3.23Å; G49-N53 PolarHBondContact O-N 2.96Å; G49-N53 PolarHBondContact O-ND2 3.49Å; F50-N53 PolarHBondContact O-N 3.47Å; L51-N53 VanDerWaalsContact C-N 3.3Å; L51-N53 PolarHBondContact O-N 3.37Å; N53-K56 PolarHBondContact O-N 3.48Å; N53-K57 PolarHBondContact O-N 2.92Å
54	Q	91.8	Very high	93	Very high	102 Å²	102	102.6 Å²	102.6	48%	0.477	51%	0.511	S	S	.	.	H	α-helix	trans	-62.2	-43.8	174.6	-74.6	-160.9	-33.8	0	0	112	F50 L51 K56 K57 Y58	F50-Q54 HydrophobicContact CD1-CG 4.31Å; F50-Q54 HydrophobicContact CE1-CG 3.89Å; F50-Q54 HydrophobicContact CE2-CG 4.49Å; F50-Q54 HydrophobicContact CZ-CG 3.99Å; F50-Q54 PolarHBondContact O-N 3.36Å; L51-Q54 PolarHBondContact O-N 3.05Å; Q54-K56 VanDerWaalsContact C-N 3.34Å; Q54-K56 PolarHBondContact O-N 3.38Å; Q54-K57 PolarHBondContact O-N 2.9Å; Q54-Y58 PolarHBondContact O-N 3.38Å
55	Q	90.7	Very high	92.8	Very high	113 Å²	113	101.2 Å²	101.2	53%	0.528	50%	0.504	S	S	.	.	H	α-helix	trans	-61.8	-42.5	177.8	-169	-174.5	20.7	0	0	111.8	L51 A52 Y58 K59	L51-Q55 PolarHBondContact O-N 2.84Å; A52-Q55 PolarHBondContact O-N 3.46Å; Q55-Y58 PolarHBondContact O-N 3.06Å; Q55-K59 WeakPolarHBondContact O-CG 2.94Å; Q55-K59 PolarHBondContact O-N 3.34Å
56	K	91.4	Very high	92.5	Very high	145 Å²	145	101.1 Å²	101.1	63%	0.63	50%	0.499	S	S	*	.	H	α-helix	trans	-61.6	-43.7	175.1	-75.2	177.4	-179.4	179.5	0	111.8	A52 N53 Q54 K59 Y60	A52-K56 WeakPolarHBondContact O-CG 3.38Å; A52-K56 PolarHBondContact O-N 3.08Å; N53-K56 PolarHBondContact O-N 3.48Å; Q54-K56 VanDerWaalsContact C-N 3.34Å; Q54-K56 PolarHBondContact O-N 3.38Å; K56-K59 PolarHBondContact O-N 2.87Å; K56-Y60 WeakPolarHBondContact O-CB 3.38Å; K56-Y60 PolarHBondContact O-N 3.06Å
57	K	91.8	Very high	92.3	Very high	155 Å²	155	100.4 Å²	100.4	67%	0.674	50%	0.498	S	S	*	.	H	α-helix	trans	-61.8	-44.6	177.8	-174	179.7	178.9	-177.6	0	111.7	N53 Q54 Y60 E61	N53-K57 PolarHBondContact O-N 2.92Å; Q54-K57 PolarHBondContact O-N 2.9Å; K57-Y60 WeakPolarHBondContact O-CB 3.23Å; K57-Y60 PolarHBondContact O-N 3.33Å; K57-E61 PolarHBondContact O-N 3.48Å
58	Y	86.6	Confident	92.1	Very high	146 Å²	146	103 Å²	103	57%	0.573	51%	0.506	S	S	*	.	H	α-helix	trans	-62.2	-49.3	178.4	-178.3	-101.1	0	0	0	111.9	Q54 Q55 Y60 E61 E62	Q54-Y58 PolarHBondContact O-N 3.38Å; Q55-Y58 PolarHBondContact O-N 3.06Å; Y58-Y60 VanDerWaalsContact C-N 3.26Å; Y58-Y60 PolarHBondContact O-N 2.87Å; Y58-E61 PolarHBondContact O-N 3.11Å; Y58-E61 VanDerWaalsContact O-N 3.12Å; Y58-E62 HydrophobicContact CD1-CG 4.27Å; Y58-E62 HydrophobicContact CE1-CG 3.79Å; Y58-E62 WeakPolarHBondContact CE1-OE1 3.45Å; Y58-E62 WeakPolarHBondContact CE1-OE2 3.43Å; Y58-E62 HydrophobicContact CE2-CG 4.39Å; Y58-E62 VanDerWaalsContact CZ-CD 3.48Å; Y58-E62 PolarHBondContact O-N 2.87Å; Y58-E62 PolarHBondContact OH-OE1 3Å
59	K	89.1	Confident	91.9	Very high	114 Å²	114	106.2 Å²	106.2	50%	0.496	51%	0.509	S	S	.	.	H	α-helix	trans	-57.7	-38.3	175.3	-72.9	179.6	177.5	-177.6	0	112.8	Q55 K56 C63	Q55-K59 WeakPolarHBondContact O-CG 2.94Å; Q55-K59 PolarHBondContact O-N 3.34Å; K56-K59 PolarHBondContact O-N 2.87Å; K59-C63 WeakPolarHBondContact O-CB 3.38Å; K59-C63 PolarHBondContact O-N 3.41Å; K59-C63 PolarHBondContact O-SG 3.37Å; K59-C63 VanDerWaalsContact O-SG 3.41Å
60	Y	89.8	Confident	91.5	Very high	158 Å²	158	109.6 Å²	109.6	62%	0.62	52%	0.517	S	S	*	.	H	α-helix	trans	-64.2	-44.2	176.8	178	-97.1	0	0	0	111.9	K56 K57 Y58 C63 K64	K56-Y60 WeakPolarHBondContact O-CB 3.38Å; K56-Y60 PolarHBondContact O-N 3.06Å; K57-Y60 WeakPolarHBondContact O-CB 3.23Å; K57-Y60 PolarHBondContact O-N 3.33Å; Y58-Y60 VanDerWaalsContact C-N 3.26Å; Y58-Y60 PolarHBondContact O-N 2.87Å; Y60-C63 PolarHBondContact O-N 3.11Å; Y60-K64 HydrophobicContact CE1-CD 4.29Å; Y60-K64 WeakPolarHBondContact O-CB 3.45Å; Y60-K64 PolarHBondContact O-N 3.46Å
61	E	90.5	Very high	91.3	Very high	72 Å²	72	108.1 Å²	108.1	34%	0.336	51%	0.514	S	S	.	.	H	α-helix	trans	-67.8	-41.3	179.2	-153.3	66	-158.9	0	0	111.4	K57 Y58 C63 K64 D65	K57-E61 PolarHBondContact O-N 3.48Å; Y58-E61 PolarHBondContact O-N 3.11Å; Y58-E61 VanDerWaalsContact O-N 3.12Å; E61-C63 PolarHBondContact O-N 3.37Å; E61-K64 WeakPolarHBondContact O-CB 3.39Å; E61-K64 PolarHBondContact O-N 3.33Å; E61-K64 IonicContact OE1-NZ 3.64Å; E61-K64 PolarHBondContact OE1-NZ 2.99Å; E61-K64 IonicContact OE2-NZ 2.78Å; E61-D65 PolarHBondContact O-N 3.23Å
62	E	88.6	Confident	91.1	Very high	93 Å²	93	111.9 Å²	111.9	44%	0.435	52%	0.521	S	S	.	.	H	α-helix	trans	-58	-46.9	173.3	-74.3	-173.4	143.9	0	0	112.3	Y58 K64 D65 L66	Y58-E62 HydrophobicContact CD1-CG 4.27Å; Y58-E62 HydrophobicContact CE1-CG 3.79Å; Y58-E62 WeakPolarHBondContact CE1-OE1 3.45Å; Y58-E62 WeakPolarHBondContact CE1-OE2 3.43Å; Y58-E62 HydrophobicContact CE2-CG 4.39Å; Y58-E62 VanDerWaalsContact CZ-CD 3.48Å; Y58-E62 PolarHBondContact O-N 2.87Å; Y58-E62 PolarHBondContact OH-OE1 3Å; E62-K64 VanDerWaalsContact C-N 3.31Å; E62-K64 PolarHBondContact O-N 3.09Å; E62-D65 PolarHBondContact O-N 3.45Å; E62-L66 WeakPolarHBondContact O-CB 3.44Å; E62-L66 PolarHBondContact O-N 3.06Å
63	C	87.8	Confident	90.5	Very high	74 Å²	74	112.3 Å²	112.3	50%	0.5	52%	0.518	S	S	.	.	H	α-helix	trans	-61	-41.3	176.4	-78.6	0	0	0	0	111.9	K59 Y60 E61 L66 I67	K59-C63 WeakPolarHBondContact O-CB 3.38Å; K59-C63 PolarHBondContact O-N 3.41Å; K59-C63 PolarHBondContact O-SG 3.37Å; K59-C63 VanDerWaalsContact O-SG 3.41Å; Y60-C63 PolarHBondContact O-N 3.11Å; E61-C63 PolarHBondContact O-N 3.37Å; C63-L66 PolarHBondContact O-N 3.03Å; C63-I67 VanDerWaalsContact O-CG1 3.28Å; C63-I67 WeakPolarHBondContact O-CG1 3.27Å; C63-I67 PolarHBondContact O-N 2.98Å
64	K	93.3	Very high	89.7	Confident	100 Å²	100	113.6 Å²	113.6	44%	0.435	52%	0.521	S	S	.	.	H	α-helix	trans	-65.3	-41.7	178.9	177.1	-177.9	162.8	-149	0	111.7	Y60 E61 E62 I67 K68	Y60-K64 HydrophobicContact CE1-CD 4.29Å; Y60-K64 WeakPolarHBondContact O-CB 3.45Å; Y60-K64 PolarHBondContact O-N 3.46Å; E61-K64 WeakPolarHBondContact O-CB 3.39Å; E61-K64 PolarHBondContact O-N 3.33Å; E61-K64 IonicContact OE1-NZ 3.64Å; E61-K64 PolarHBondContact OE1-NZ 2.99Å; E61-K64 IonicContact OE2-NZ 2.78Å; E62-K64 VanDerWaalsContact C-N 3.31Å; E62-K64 PolarHBondContact O-N 3.09Å; K64-I67 PolarHBondContact O-N 3.1Å; K64-K68 WeakPolarHBondContact O-CB 3.37Å; K64-K68 PolarHBondContact O-N 3.39Å
65	D	92.7	Very high	88.9	Confident	88 Å²	88	118.9 Å²	118.9	47%	0.471	54%	0.536	S	S	.	.	H	α-helix	trans	-66.8	-40.5	176.8	-75.8	-22.5	0	0	0	111.8	E61 E62 K68 F69	E61-D65 PolarHBondContact O-N 3.23Å; E62-D65 PolarHBondContact O-N 3.45Å; D65-K68 PolarHBondContact O-N 3.42Å; D65-F69 WeakPolarHBondContact O-CB 3.45Å; D65-F69 PolarHBondContact O-N 3.49Å
66	L	92.4	Very high	87.7	Confident	101 Å²	101	120.1 Å²	120.1	53%	0.529	54%	0.542	S	S	.	.	H	α-helix	trans	-60.9	-48.2	174.8	179.9	63	0	0	0	111.7	E62 C63 K68 F69 M70	E62-L66 WeakPolarHBondContact O-CB 3.44Å; E62-L66 PolarHBondContact O-N 3.06Å; C63-L66 PolarHBondContact O-N 3.03Å; L66-K68 VanDerWaalsContact C-N 3.29Å; L66-K68 PolarHBondContact O-N 3.01Å; L66-F69 WeakPolarHBondContact O-CB 3.34Å; L66-F69 PolarHBondContact O-N 2.99Å; L66-M70 HydrophobicContact CD1-CG 4.47Å; L66-M70 HydrophobicContact CG-SD 4.43Å; L66-M70 WeakPolarHBondContact O-CG 3.23Å; L66-M70 PolarHBondContact O-N 3.33Å
67	I	91.9	Very high	85.9	Confident	102 Å²	102	124.7 Å²	124.7	52%	0.523	56%	0.562	S	S	.	*	H	α-helix	trans	-58.7	-44.1	176.9	-70.1	165.4	0	0	0	110.4	C63 K64 F69 M70 L71	C63-I67 VanDerWaalsContact O-CG1 3.28Å; C63-I67 WeakPolarHBondContact O-CG1 3.27Å; C63-I67 PolarHBondContact O-N 2.98Å; K64-I67 PolarHBondContact O-N 3.1Å; I67-F69 VanDerWaalsContact C-N 3.33Å; I67-F69 PolarHBondContact O-N 3.21Å; I67-M70 PolarHBondContact O-N 2.94Å; I67-L71 HydrophobicContact CG2-CD1 3.93Å; I67-L71 HydrophobicContact CG2-CG 4.39Å; I67-L71 WeakPolarHBondContact O-CG 3.45Å; I67-L71 PolarHBondContact O-N 3.38Å
68	K	92.4	Very high	85.6	Confident	152 Å²	152	123.2 Å²	123.2	66%	0.661	56%	0.557	S	S	*	*	H	α-helix	trans	-63.3	-39.2	178.7	-170.2	178.3	-179.2	-176.4	0	112.1	K64 D65 L66 R72	K64-K68 WeakPolarHBondContact O-CB 3.37Å; K64-K68 PolarHBondContact O-N 3.39Å; D65-K68 PolarHBondContact O-N 3.42Å; L66-K68 VanDerWaalsContact C-N 3.29Å; L66-K68 PolarHBondContact O-N 3.01Å; K68-R72 PolarHBondContact O-N 2.89Å
69	F	92.3	Very high	85.6	Confident	124 Å²	124	121.9 Å²	121.9	54%	0.544	56%	0.556	S	S	.	*	H	α-helix	trans	-63.4	-47.6	174.8	178	-103.6	0	0	0	111.6	D65 L66 I67 R72 N73	D65-F69 WeakPolarHBondContact O-CB 3.45Å; D65-F69 PolarHBondContact O-N 3.49Å; L66-F69 WeakPolarHBondContact O-CB 3.34Å; L66-F69 PolarHBondContact O-N 2.99Å; I67-F69 VanDerWaalsContact C-N 3.33Å; I67-F69 PolarHBondContact O-N 3.21Å; F69-R72 PolarHBondContact O-N 3.08Å; F69-N73 WeakPolarHBondContact CD1-ND2 3.33Å; F69-N73 WeakPolarHBondContact CE1-ND2 3.4Å; F69-N73 WeakPolarHBondContact CZ-ND2 3.44Å; F69-N73 PolarHBondContact O-N 3.13Å; F69-N73 VanDerWaalsContact O-N 3.12Å; F69-N73 PolarHBondContact O-ND2 2.87Å
70	M	89.9	Confident	85.4	Confident	104 Å²	104	122.4 Å²	122.4	51%	0.512	56%	0.559	S	S	.	*	H	α-helix	trans	-60.5	-48.5	178.6	-67.1	-175.4	80.5	0	0	112	L66 I67 R72 N73 E74	L66-M70 HydrophobicContact CD1-CG 4.47Å; L66-M70 HydrophobicContact CG-SD 4.43Å; L66-M70 WeakPolarHBondContact O-CG 3.23Å; L66-M70 PolarHBondContact O-N 3.33Å; I67-M70 PolarHBondContact O-N 2.94Å; M70-R72 PolarHBondContact O-N 3.41Å; M70-N73 PolarHBondContact O-N 3.11Å; M70-N73 VanDerWaalsContact O-N 3.14Å; M70-E74 PolarHBondContact O-N 3.07Å
71	L	91.4	Very high	85.1	Confident	85 Å²	85	120.3 Å²	120.3	45%	0.445	56%	0.556	S	S	.	*	H	α-helix	trans	-60.7	-30.9	177.8	-72.5	173.2	0	0	0	113.3	I67 R75	I67-L71 HydrophobicContact CG2-CD1 3.93Å; I67-L71 HydrophobicContact CG2-CG 4.39Å; I67-L71 WeakPolarHBondContact O-CG 3.45Å; I67-L71 PolarHBondContact O-N 3.38Å; L71-R75 WeakPolarHBondContact O-CG 3.47Å
72	R	89.8	Confident	84.8	Confident	175 Å²	175	123.3 Å²	123.3	66%	0.66	57%	0.569	S	S	*	*	H	α-helix	trans	-72.1	-41.8	177	-166.4	179.8	-150.9	-135	3.6	111.2	K68 F69 M70 R75 Q76	K68-R72 PolarHBondContact O-N 2.89Å; F69-R72 PolarHBondContact O-N 3.08Å; M70-R72 PolarHBondContact O-N 3.41Å; R72-R75 PolarHBondContact O-N 3.29Å; R72-Q76 WeakPolarHBondContact O-CG 3.43Å
73	N	82.8	Confident	84.5	Confident	52 Å²	52	125.3 Å²	125.3	28%	0.278	58%	0.578	S	S	.	*	H	α-helix	trans	-69.7	-39.3	180	-64.4	-20.6	0	0	0	111.4	F69 M70 R75 Q76 F77	F69-N73 WeakPolarHBondContact CD1-ND2 3.33Å; F69-N73 WeakPolarHBondContact CE1-ND2 3.4Å; F69-N73 WeakPolarHBondContact CZ-ND2 3.44Å; F69-N73 PolarHBondContact O-N 3.13Å; F69-N73 VanDerWaalsContact O-N 3.12Å; F69-N73 PolarHBondContact O-ND2 2.87Å; M70-N73 PolarHBondContact O-N 3.11Å; M70-N73 VanDerWaalsContact O-N 3.14Å; N73-R75 VanDerWaalsContact C-N 3.26Å; N73-R75 PolarHBondContact O-N 3.15Å; N73-Q76 PolarHBondContact O-N 3.33Å; N73-F77 WeakPolarHBondContact O-CD2 3.39Å
74	E	77.4	Confident	84.3	Confident	131 Å²	131	129 Å²	129	61%	0.612	58%	0.584	S	S	*	*	H	α-helix	trans	-61	-31.2	176.3	-76.4	-177.5	176.7	0	0	113.5	M70 Q76	M70-E74 PolarHBondContact O-N 3.07Å; E74-Q76 VanDerWaalsContact C-N 3.29Å; E74-Q76 PolarHBondContact O-N 3.04Å
75	R	73.5	Confident	83.6	Confident	212 Å²	212	131.2 Å²	131.2	80%	0.8	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.5	-7.9	176.2	-68.3	-175.5	-160	-171.9	3.6	114.3	L71 R72 N73	L71-R75 WeakPolarHBondContact O-CG 3.47Å; R72-R75 PolarHBondContact O-N 3.29Å; N73-R75 VanDerWaalsContact C-N 3.26Å; N73-R75 PolarHBondContact O-N 3.15Å
76	Q	66.5	Low	82.8	Confident	140 Å²	140	134.8 Å²	134.8	65%	0.654	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.3	-7.2	179.8	-71.1	-174	-16.3	0	0	113	R72 N73 E74	R72-Q76 WeakPolarHBondContact O-CG 3.43Å; N73-Q76 PolarHBondContact O-N 3.33Å; E74-Q76 VanDerWaalsContact C-N 3.29Å; E74-Q76 PolarHBondContact O-N 3.04Å
77	F	53.5	Low	81.9	Confident	240 Å²	240	137.9 Å²	137.9	100%	1.053	61%	0.613	S	S	*	*			trans	-99.2	0	168	-74.2	-81.7	0	0	0	110.3	N73	N73-F77 WeakPolarHBondContact O-CD2 3.39Å

Retrieved 77 of 77 residues in 48.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).