A0A075BJF8_DROME Loading...

Stonewall

AlphaFold DB , UniProt , Accession A0A075BJF8, Species DROME (Drosophila melanogaster, Fruit fly), Gene stwl, Length 49 aa.

						>A0A075BJF8_DROME|A0A075BJF8|stwl
MSAASEVNLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGES
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.6	Low	88.9	Confident	178 Å²	178	83.1 Å²	83.1	88%	0.877	48%	0.484	S	S	*	.				0	157.1	0	-85.8	178.2	-96.2	0	0	107.6	E6 L9	M1-E6 HydrophobicContact CB-CG 4.24Å; M1-L9 HydrophobicContact SD-CD1 3.98Å
2	S	88.1	Confident	89.6	Confident	64 Å²	64	85.7 Å²	85.7	45%	0.448	49%	0.494	S	S	.	.			trans	-77.6	153.5	172.3	70.5	0	0	0	0	109.4	A4 S5 E6	S2-A4 PolarHBondContact O-N 2.86Å; S2-S5 WeakPolarHBondContact O-CA 3.45Å; S2-S5 WeakPolarHBondContact O-CB 3.06Å; S2-S5 PolarHBondContact O-N 3.15Å; S2-S5 PolarHBondContact OG-N 2.76Å; S2-S5 VanDerWaalsContact OG-N 3.13Å; S2-S5 PolarHBondContact OG-OG 3.29Å; S2-E6 PolarHBondContact O-N 3.44Å; S2-E6 VanDerWaalsContact O-N 3.12Å
3	A	84.4	Confident	90.1	Very high	73 Å²	73	91.2 Å²	91.2	60%	0.603	50%	0.501	S	S	*	.	H	α-helix	trans	-55	-36.3	174.1	0	0	0	0	0	111.8	S5 E6 V7	A3-S5 PolarHBondContact O-N 2.82Å; A3-E6 PolarHBondContact O-N 3.38Å; A3-V7 WeakPolarHBondContact O-CG2 3.5Å; A3-V7 PolarHBondContact O-N 3.03Å
4	A	87.1	Confident	90.5	Very high	60 Å²	60	85.2 Å²	85.2	50%	0.496	47%	0.469	S	S	.	.	H	α-helix	trans	-63.4	-38.6	174.5	0	0	0	0	0	112.6	S2 E6 N8	S2-A4 PolarHBondContact O-N 2.86Å; A4-E6 VanDerWaalsContact C-N 3.34Å; A4-N8 VanDerWaalsContact O-CB 3.31Å; A4-N8 WeakPolarHBondContact O-CB 3.27Å; A4-N8 PolarHBondContact O-N 2.72Å; A4-N8 PolarHBondContact O-ND2 3.24Å
5	S	92.3	Very high	91	Very high	50 Å²	50	81.5 Å²	81.5	35%	0.35	45%	0.45	S	S	.	.	H	α-helix	trans	-65.4	-37.8	175	-62.9	0	0	0	0	112	S2 A3 L9	S2-S5 WeakPolarHBondContact O-CA 3.45Å; S2-S5 WeakPolarHBondContact O-CB 3.06Å; S2-S5 PolarHBondContact O-N 3.15Å; S2-S5 PolarHBondContact OG-N 2.76Å; S2-S5 VanDerWaalsContact OG-N 3.13Å; S2-S5 PolarHBondContact OG-OG 3.29Å; A3-S5 PolarHBondContact O-N 2.82Å; S5-L9 WeakPolarHBondContact O-CB 3.48Å; S5-L9 VanDerWaalsContact O-CG 3.24Å; S5-L9 WeakPolarHBondContact O-CG 2.92Å; S5-L9 PolarHBondContact O-N 2.95Å
6	E	90.8	Very high	91.4	Very high	104 Å²	104	84.6 Å²	84.6	49%	0.486	46%	0.46	S	S	.	.	H	α-helix	trans	-67.3	-46.7	178.7	-72.2	169.3	-172.7	0	0	111.6	M1 S2 A3 A4 N8 L9 M10	M1-E6 HydrophobicContact CB-CG 4.24Å; S2-E6 PolarHBondContact O-N 3.44Å; S2-E6 VanDerWaalsContact O-N 3.12Å; A3-E6 PolarHBondContact O-N 3.38Å; A4-E6 VanDerWaalsContact C-N 3.34Å; E6-N8 PolarHBondContact O-N 2.71Å; E6-L9 PolarHBondContact O-N 3.49Å; E6-M10 WeakPolarHBondContact O-CG 3.23Å; E6-M10 PolarHBondContact O-N 2.98Å
7	V	91.1	Very high	91.7	Very high	79 Å²	79	86.9 Å²	86.9	48%	0.479	47%	0.465	S	S	.	.	H	α-helix	trans	-61.4	-43.5	175.4	173.6	0	0	0	0	111.4	A3 L9 M10 L11	A3-V7 WeakPolarHBondContact O-CG2 3.5Å; A3-V7 PolarHBondContact O-N 3.03Å; V7-L9 VanDerWaalsContact C-N 3.33Å; V7-L9 PolarHBondContact O-N 3.07Å; V7-M10 PolarHBondContact O-N 2.97Å; V7-L11 PolarHBondContact O-N 3.03Å
8	N	93.3	Very high	92.1	Very high	89 Å²	89	84.2 Å²	84.2	48%	0.476	45%	0.449	S	S	.	.	H	α-helix	trans	-64.1	-38.4	177.6	-72.9	-19	0	0	0	112.2	A4 E6 L11 L12	A4-N8 VanDerWaalsContact O-CB 3.31Å; A4-N8 WeakPolarHBondContact O-CB 3.27Å; A4-N8 PolarHBondContact O-N 2.72Å; A4-N8 PolarHBondContact O-ND2 3.24Å; E6-N8 PolarHBondContact O-N 2.71Å; N8-L11 PolarHBondContact O-N 3Å; N8-L12 VanDerWaalsContact O-CG 3.3Å; N8-L12 WeakPolarHBondContact O-CG 3.42Å; N8-L12 PolarHBondContact O-N 2.95Å
9	L	94.6	Very high	92.3	Very high	72 Å²	72	82.7 Å²	82.7	38%	0.377	44%	0.443	S	S	.	.	H	α-helix	trans	-66.1	-40	175.6	-77.6	171.9	0	0	0	111.7	M1 S5 E6 V7 R13	M1-L9 HydrophobicContact SD-CD1 3.98Å; S5-L9 WeakPolarHBondContact O-CB 3.48Å; S5-L9 VanDerWaalsContact O-CG 3.24Å; S5-L9 WeakPolarHBondContact O-CG 2.92Å; S5-L9 PolarHBondContact O-N 2.95Å; E6-L9 PolarHBondContact O-N 3.49Å; V7-L9 VanDerWaalsContact C-N 3.33Å; V7-L9 PolarHBondContact O-N 3.07Å; L9-R13 WeakPolarHBondContact O-CB 3.28Å; L9-R13 VanDerWaalsContact O-CG 3.26Å; L9-R13 WeakPolarHBondContact O-CG 3.44Å; L9-R13 PolarHBondContact O-N 3.25Å
10	M	94.3	Very high	92.6	Very high	78 Å²	78	79.1 Å²	79.1	38%	0.384	43%	0.425	S	S	.	.	H	α-helix	trans	-61.1	-48.8	173.7	-72.8	177.4	66.8	0	0	110.9	E6 V7 L12 R13 S14	E6-M10 WeakPolarHBondContact O-CG 3.23Å; E6-M10 PolarHBondContact O-N 2.98Å; V7-M10 PolarHBondContact O-N 2.97Å; M10-L12 PolarHBondContact O-N 2.98Å; M10-R13 PolarHBondContact O-N 2.71Å; M10-S14 PolarHBondContact O-N 2.84Å; M10-S14 PolarHBondContact O-OG 2.55Å
11	L	95.5	Very high	92.8	Very high	67 Å²	67	76.6 Å²	76.6	35%	0.351	41%	0.412	S	S	.	.	H	α-helix	trans	-56	-48.9	177.1	177.1	63.1	0	0	0	112.3	V7 N8 R13 S14 V15 V42 V46	V7-L11 PolarHBondContact O-N 3.03Å; N8-L11 PolarHBondContact O-N 3Å; L11-R13 PolarHBondContact O-N 2.94Å; L11-S14 PolarHBondContact O-N 3.36Å; L11-V15 HydrophobicContact CD1-CG2 4.22Å; L11-V15 WeakPolarHBondContact O-CG2 3.16Å; L11-V15 PolarHBondContact O-N 3.18Å; L11-V42 HydrophobicContact CD1-CG1 3.64Å; L11-V46 HydrophobicContact CB-CG2 4.44Å; L11-V46 HydrophobicContact CD1-CG2 4.3Å
12	L	96.7	Very high	94.2	Very high	114 Å²	114	73.7 Å²	73.7	60%	0.597	39%	0.392	S	S	*	.	H	α-helix	trans	-63.5	-40.5	-179.3	-72.1	172	0	0	0	112.1	N8 M10 S14 V15 E16	N8-L12 VanDerWaalsContact O-CG 3.3Å; N8-L12 WeakPolarHBondContact O-CG 3.42Å; N8-L12 PolarHBondContact O-N 2.95Å; M10-L12 PolarHBondContact O-N 2.98Å; L12-S14 VanDerWaalsContact C-N 3.34Å; L12-S14 PolarHBondContact O-N 3.01Å; L12-V15 PolarHBondContact O-N 3.13Å; L12-E16 WeakPolarHBondContact O-CB 3.35Å; L12-E16 PolarHBondContact O-N 3.49Å
13	R	96.3	Very high	94.7	Very high	158 Å²	158	73 Å²	73	60%	0.596	38%	0.383	S	S	*	.	H	α-helix	trans	-64.4	-37.5	175.9	-74.7	172.2	176.6	176.4	0.2	112.4	L9 M10 L11	L9-R13 WeakPolarHBondContact O-CB 3.28Å; L9-R13 VanDerWaalsContact O-CG 3.26Å; L9-R13 WeakPolarHBondContact O-CG 3.44Å; L9-R13 PolarHBondContact O-N 3.25Å; M10-R13 PolarHBondContact O-N 2.71Å; L11-R13 PolarHBondContact O-N 2.94Å
14	S	96.6	Very high	95.3	Very high	7 Å²	7	79.2 Å²	79.2	5%	0.049	39%	0.391	C	S	.	.	H	α-helix	trans	-69.9	-41.6	176	-66.5	0	0	0	0	111.7	M10 L11 L12 K17 E45	M10-S14 PolarHBondContact O-N 2.84Å; M10-S14 PolarHBondContact O-OG 2.55Å; L11-S14 PolarHBondContact O-N 3.36Å; L12-S14 VanDerWaalsContact C-N 3.34Å; L12-S14 PolarHBondContact O-N 3.01Å; S14-K17 PolarHBondContact O-N 2.89Å; S14-E45 WeakPolarHBondContact CA-OE2 3.45Å; S14-E45 VanDerWaalsContact CB-OE2 3.23Å; S14-E45 WeakPolarHBondContact CB-OE2 3.38Å; S14-E45 WeakPolarHBondContact OG-CB 3.48Å; S14-E45 PolarHBondContact OG-OE2 3.32Å
15	V	97.4	Very high	95.8	Very high	30 Å²	30	82.2 Å²	82.2	18%	0.182	40%	0.404	C	S	.	.	H	α-helix	trans	-64.9	-38.4	176	170.4	0	0	0	0	111.9	L11 L12 K17 Q18 L21 Y22 W39 V42	L11-V15 HydrophobicContact CD1-CG2 4.22Å; L11-V15 WeakPolarHBondContact O-CG2 3.16Å; L11-V15 PolarHBondContact O-N 3.18Å; L12-V15 PolarHBondContact O-N 3.13Å; V15-K17 PolarHBondContact O-N 3.45Å; V15-Q18 PolarHBondContact O-N 2.98Å; V15-L21 HydrophobicContact CG1-CD1 4.32Å; V15-Y22 HydrophobicContact CG1-CD1 4.45Å; V15-Y22 WeakPolarHBondContact O-CE1 3.27Å; V15-W39 HydrophobicContact CG2-CH2 4.25Å; V15-W39 HydrophobicContact CG2-CZ3 4.02Å; V15-V42 HydrophobicContact CG2-CG1 4.12Å; V15-V42 HydrophobicContact CG2-CG2 4.06Å
16	E	97.6	Very high	96.1	Very high	131 Å²	131	81.3 Å²	81.3	61%	0.612	40%	0.395	S	S	*	.	H	α-helix	trans	-55.7	-35.8	179	-177	179.5	-163.3	0	0	112.6	L12 Q18 Y22	L12-E16 WeakPolarHBondContact O-CB 3.35Å; L12-E16 PolarHBondContact O-N 3.49Å; E16-Q18 PolarHBondContact O-N 3.4Å; E16-Y22 WeakPolarHBondContact O-CE1 3.43Å; E16-Y22 PolarHBondContact O-OH 3.37Å
17	K	96.9	Very high	96.4	Very high	123 Å²	123	83.7 Å²	83.7	54%	0.535	41%	0.406	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.3	-18.2	177.2	-61.5	168.8	-175	168.8	0	113.8	S14 V15 E45	S14-K17 PolarHBondContact O-N 2.89Å; V15-K17 PolarHBondContact O-N 3.45Å; K17-E45 IonicContact NZ-OE1 3.61Å; K17-E45 PolarHBondContact NZ-OE1 2.84Å; K17-E45 IonicContact NZ-OE2 2.79Å; K17-E45 PolarHBondContact NZ-OE2 3Å
18	Q	97.6	Very high	96.7	Very high	39 Å²	39	82 Å²	82	18%	0.182	39%	0.394	C	S	.	.			trans	-105.8	74.2	-174.6	-52	-52.9	-44.6	0	0	110.6	V15 E16 A20 L21 A38 V42	V15-Q18 PolarHBondContact O-N 2.98Å; E16-Q18 PolarHBondContact O-N 3.4Å; Q18-A20 PolarHBondContact O-N 3.44Å; Q18-A20 VanDerWaalsContact O-N 3.13Å; Q18-L21 HydrophobicContact CB-CD1 3.77Å; Q18-L21 HydrophobicContact CB-CG 3.97Å; Q18-L21 HydrophobicContact CG-CD1 4.43Å; Q18-L21 WeakPolarHBondContact O-CB 3.31Å; Q18-L21 PolarHBondContact O-N 3.25Å; Q18-A38 HydrophobicContact CB-CB 3.83Å; Q18-A38 HydrophobicContact CG-CB 4.07Å; Q18-V42 HydrophobicContact CG-CG2 3.82Å
19	T	97.6	Very high	96.9	Very high	55 Å²	55	80.4 Å²	80.4	34%	0.337	38%	0.382	S	S	.	.	G	3₁₀ helix	trans	-55.1	-32.3	-176.3	45.8	0	0	0	0	113.6	L21 Y22 D23 D26	T19-L21 PolarHBondContact O-N 3.06Å; T19-Y22 PolarHBondContact O-N 3.5Å; T19-D23 WeakPolarHBondContact O-CB 3.34Å; T19-D23 PolarHBondContact O-N 3.37Å; T19-D26 WeakPolarHBondContact CB-OD2 3.26Å; T19-D26 PolarHBondContact OG1-OD2 2.91Å
20	A	97.5	Very high	96.8	Very high	11 Å²	11	85.4 Å²	85.4	9%	0.091	40%	0.396	C	S	.	.	G	3₁₀ helix	trans	-54	-21.2	174.6	0	0	0	0	0	114.3	Q18 D26 N28 Y29 R30 P34	Q18-A20 PolarHBondContact O-N 3.44Å; Q18-A20 VanDerWaalsContact O-N 3.13Å; A20-D26 PolarHBondContact N-OD2 3.37Å; A20-N28 HydrophobicContact CB-CB 4.21Å; A20-Y29 WeakPolarHBondContact O-CA 3.36Å; A20-R30 PolarHBondContact O-N 3.46Å; A20-P34 HydrophobicContact CB-CB 4.37Å
21	L	97	Very high	96.9	Very high	26 Å²	26	86.5 Å²	86.5	14%	0.136	40%	0.398	C	S	.	.	G	3₁₀ helix	trans	-81.8	-29.7	178.8	-61	-178.2	0	0	0	113.8	V15 Q18 T19 A38 W39 V42	V15-L21 HydrophobicContact CG1-CD1 4.32Å; Q18-L21 HydrophobicContact CB-CD1 3.77Å; Q18-L21 HydrophobicContact CB-CG 3.97Å; Q18-L21 HydrophobicContact CG-CD1 4.43Å; Q18-L21 WeakPolarHBondContact O-CB 3.31Å; Q18-L21 PolarHBondContact O-N 3.25Å; T19-L21 PolarHBondContact O-N 3.06Å; L21-A38 HydrophobicContact CD1-CB 4.14Å; L21-A38 HydrophobicContact CD2-CB 3.78Å; L21-A38 HydrophobicContact CG-CB 3.83Å; L21-W39 HydrophobicContact CD1-CD2 4.12Å; L21-W39 HydrophobicContact CD1-CE3 4.29Å; L21-W39 HydrophobicContact CD1-CH2 4.2Å; L21-W39 HydrophobicContact CD1-CZ2 4.03Å; L21-W39 HydrophobicContact CD1-CZ3 4.33Å; L21-W39 HydrophobicContact CD2-CD2 4.32Å; L21-W39 HydrophobicContact CD2-CG 4.35Å; L21-W39 HydrophobicContact CD2-CZ2 4.28Å; L21-V42 HydrophobicContact CD1-CG2 4.39Å
22	Y	96.3	Very high	97	Very high	117 Å²	117	92.4 Å²	92.4	46%	0.459	42%	0.416	S	S	.	.	T	Hydrogen-bonded Turn	trans	-138.2	-27.8	-168.1	70.7	-92.8	0	0	0	115.7	V15 E16 T19 R24	V15-Y22 HydrophobicContact CG1-CD1 4.45Å; V15-Y22 WeakPolarHBondContact O-CE1 3.27Å; E16-Y22 WeakPolarHBondContact O-CE1 3.43Å; E16-Y22 PolarHBondContact O-OH 3.37Å; T19-Y22 PolarHBondContact O-N 3.5Å; Y22-R24 PolarHBondContact O-N 2.93Å
23	D	97.8	Very high	97	Very high	51 Å²	51	92.2 Å²	92.2	27%	0.273	42%	0.415	S	S	.	.			trans	-82.4	114.9	-177.9	-177.3	-2.6	0	0	0	110.4	T19 T25 D26 Y29	T19-D23 WeakPolarHBondContact O-CB 3.34Å; T19-D23 PolarHBondContact O-N 3.37Å; D23-T25 VanDerWaalsContact CG-OG1 3.3Å; D23-T25 PolarHBondContact O-N 3.21Å; D23-T25 WeakPolarHBondContact OD1-CB 3.4Å; D23-T25 PolarHBondContact OD1-N 3.41Å; D23-T25 PolarHBondContact OD1-OG1 3.04Å; D23-T25 PolarHBondContact OD2-OG1 3.49Å; D23-D26 HydrophobicContact CB-CB 4.14Å; D23-D26 VanDerWaalsContact O-CB 3.28Å; D23-D26 WeakPolarHBondContact O-CB 3.31Å; D23-D26 PolarHBondContact O-N 3.14Å; D23-Y29 VanDerWaalsContact O-CB 3.27Å; D23-Y29 WeakPolarHBondContact O-CB 3.23Å; D23-Y29 WeakPolarHBondContact O-CD2 3.41Å
24	R	97.6	Very high	97.1	Very high	202 Å²	202	86.4 Å²	86.4	76%	0.762	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.6	-15.6	-179.7	-62.7	-177.1	-178	-178.1	2.1	113.8	Y22 Y29	Y22-R24 PolarHBondContact O-N 2.93Å; R24-Y29 HydrophobicContact CB-CD1 4.49Å; R24-Y29 HydrophobicContact CB-CE1 4.41Å; R24-Y29 HydrophobicContact CG-CD1 4.4Å; R24-Y29 HydrophobicContact CG-CE1 3.85Å; R24-Y29 HydrophobicContact CG-CE2 4.11Å
25	T	97.9	Very high	97.1	Very high	124 Å²	124	87 Å²	87	76%	0.761	40%	0.402	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.7	-12.5	177.7	71.2	0	0	0	0	112.3	D23 E27	D23-T25 VanDerWaalsContact CG-OG1 3.3Å; D23-T25 PolarHBondContact O-N 3.21Å; D23-T25 WeakPolarHBondContact OD1-CB 3.4Å; D23-T25 PolarHBondContact OD1-N 3.41Å; D23-T25 PolarHBondContact OD1-OG1 3.04Å; D23-T25 PolarHBondContact OD2-OG1 3.49Å; T25-E27 PolarHBondContact O-N 2.94Å
26	D	97.1	Very high	97.1	Very high	31 Å²	31	89.5 Å²	89.5	17%	0.166	41%	0.412	C	S	.	.	S	Bend	trans	-63.6	127.2	172	-169.7	-55.6	0	0	0	109.5	T19 A20 D23 N28 Y29	T19-D26 WeakPolarHBondContact CB-OD2 3.26Å; T19-D26 PolarHBondContact OG1-OD2 2.91Å; A20-D26 PolarHBondContact N-OD2 3.37Å; D23-D26 HydrophobicContact CB-CB 4.14Å; D23-D26 VanDerWaalsContact O-CB 3.28Å; D23-D26 WeakPolarHBondContact O-CB 3.31Å; D23-D26 PolarHBondContact O-N 3.14Å; D26-N28 PolarHBondContact O-N 3Å; D26-N28 VanDerWaalsContact OD1-CA 3.31Å; D26-N28 WeakPolarHBondContact OD1-CA 3.3Å; D26-N28 VanDerWaalsContact OD1-CB 3.26Å; D26-N28 WeakPolarHBondContact OD1-CB 3.41Å; D26-N28 PolarHBondContact OD1-N 3.34Å; D26-Y29 VanDerWaalsContact O-CB 3.23Å; D26-Y29 WeakPolarHBondContact O-CB 3.24Å; D26-Y29 PolarHBondContact O-N 2.92Å
27	E	97.1	Very high	97.1	Very high	154 Å²	154	87.3 Å²	87.3	72%	0.72	40%	0.404	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.7	-22.1	179.1	54	161.6	-150.3	0	0	113	T25 K31	T25-E27 PolarHBondContact O-N 2.94Å; E27-K31 WeakPolarHBondContact O-CE 3.36Å; E27-K31 PolarHBondContact O-NZ 3.4Å
28	N	97.4	Very high	97.2	Very high	43 Å²	43	81.6 Å²	81.6	23%	0.23	38%	0.38	C	S	.	.	T	Hydrogen-bonded Turn	trans	-103.7	5.9	-178.9	-61.3	-49.2	0	0	0	113.4	A20 D26 R30 K31 P34	A20-N28 HydrophobicContact CB-CB 4.21Å; D26-N28 PolarHBondContact O-N 3Å; D26-N28 VanDerWaalsContact OD1-CA 3.31Å; D26-N28 WeakPolarHBondContact OD1-CA 3.3Å; D26-N28 VanDerWaalsContact OD1-CB 3.26Å; D26-N28 WeakPolarHBondContact OD1-CB 3.41Å; D26-N28 PolarHBondContact OD1-N 3.34Å; N28-R30 PolarHBondContact O-N 3.34Å; N28-R30 VanDerWaalsContact O-N 3.07Å; N28-K31 HydrophobicContact CB-CD 4.47Å; N28-K31 WeakPolarHBondContact O-CB 3.37Å; N28-K31 PolarHBondContact O-N 3.03Å; N28-K31 PolarHBondContact OD1-NZ 3.46Å; N28-P34 HydrophobicContact CB-CB 3.79Å; N28-P34 HydrophobicContact CB-CG 3.92Å
29	Y	97.4	Very high	97.2	Very high	55 Å²	55	86.2 Å²	86.2	22%	0.216	40%	0.396	C	S	.	.	T	Hydrogen-bonded Turn	trans	-47.2	116	179.7	178.7	-115.1	0	0	0	112.3	A20 D23 R24 D26 K31	A20-Y29 WeakPolarHBondContact O-CA 3.36Å; D23-Y29 VanDerWaalsContact O-CB 3.27Å; D23-Y29 WeakPolarHBondContact O-CB 3.23Å; D23-Y29 WeakPolarHBondContact O-CD2 3.41Å; R24-Y29 HydrophobicContact CB-CD1 4.49Å; R24-Y29 HydrophobicContact CB-CE1 4.41Å; R24-Y29 HydrophobicContact CG-CD1 4.4Å; R24-Y29 HydrophobicContact CG-CE1 3.85Å; R24-Y29 HydrophobicContact CG-CE2 4.11Å; D26-Y29 VanDerWaalsContact O-CB 3.23Å; D26-Y29 WeakPolarHBondContact O-CB 3.24Å; D26-Y29 PolarHBondContact O-N 2.92Å; Y29-K31 PolarHBondContact O-N 3.13Å
30	R	92.3	Very high	97.1	Very high	178 Å²	178	88.9 Å²	88.9	67%	0.672	41%	0.408	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.7	16.6	179.9	-63.7	-175.1	175.9	178.6	-0.6	115.6	A20 N28 R32 S35	A20-R30 PolarHBondContact O-N 3.46Å; N28-R30 PolarHBondContact O-N 3.34Å; N28-R30 VanDerWaalsContact O-N 3.07Å; R30-R32 PolarHBondContact O-N 2.98Å; R30-S35 WeakPolarHBondContact CA-OG 3.26Å
31	K	97.8	Very high	97.1	Very high	100 Å²	100	93 Å²	93	44%	0.435	43%	0.426	S	S	.	.			trans	-65.3	136.7	165.2	-69.8	-173.3	-169.1	153.6	0	108	E27 N28 Y29 L33 P34 S35	E27-K31 WeakPolarHBondContact O-CE 3.36Å; E27-K31 PolarHBondContact O-NZ 3.4Å; N28-K31 HydrophobicContact CB-CD 4.47Å; N28-K31 WeakPolarHBondContact O-CB 3.37Å; N28-K31 PolarHBondContact O-N 3.03Å; N28-K31 PolarHBondContact OD1-NZ 3.46Å; Y29-K31 PolarHBondContact O-N 3.13Å; K31-L33 PolarHBondContact O-N 2.95Å; K31-P34 HydrophobicContact CB-CB 4.43Å; K31-P34 HydrophobicContact CB-CG 3.81Å; K31-P34 HydrophobicContact CD-CG 4.49Å; K31-P34 WeakPolarHBondContact O-CD 3.46Å; K31-S35 VanDerWaalsContact O-CB 3.27Å; K31-S35 WeakPolarHBondContact O-CB 3.47Å; K31-S35 PolarHBondContact O-N 3.12Å; K31-S35 PolarHBondContact O-OG 3.44Å
32	R	97.1	Very high	97.1	Very high	191 Å²	191	92 Å²	92	72%	0.721	42%	0.421	S	S	*	.	H	α-helix	trans	-53.7	-61.1	-172	-177.8	177.6	171.6	-167.4	-5.4	113.1	R30 S35 E36	R30-R32 PolarHBondContact O-N 2.98Å; R32-S35 PolarHBondContact O-N 3.23Å; R32-E36 HydrophobicContact CG-CG 4.45Å; R32-E36 WeakPolarHBondContact CG-OE1 3.47Å; R32-E36 IonicContact CZ-OE1 3.45Å; R32-E36 IonicContact NE-OE1 4Å; R32-E36 PolarHBondContact NE-OE1 3Å; R32-E36 IonicContact NE-OE2 2.78Å; R32-E36 IonicContact NH2-OE1 2.84Å; R32-E36 PolarHBondContact NH2-OE1 3.04Å; R32-E36 WeakPolarHBondContact O-CG 3.49Å; R32-E36 PolarHBondContact O-N 3.22Å
33	L	97.8	Very high	97	Very high	111 Å²	111	89.2 Å²	89.2	58%	0.581	42%	0.423	S	S	*	.	H	α-helix	trans	-62.9	-46.7	-175.6	179.1	70.4	0	0	0	112.9	K31 S35 E36 N37	K31-L33 PolarHBondContact O-N 2.95Å; L33-S35 VanDerWaalsContact C-N 3.29Å; L33-S35 PolarHBondContact O-N 2.98Å; L33-E36 PolarHBondContact O-N 3.45Å; L33-N37 VanDerWaalsContact O-CG 3.27Å; L33-N37 PolarHBondContact O-N 2.97Å
34	P	97.4	Very high	96.8	Very high	35 Å²	35	89.6 Å²	89.6	23%	0.227	43%	0.429	C	S	.	.	H	α-helix	trans	-58.9	-37.4	172.8	-28.7	37.4	0	0	0	114.1	A20 N28 K31 A38	A20-P34 HydrophobicContact CB-CB 4.37Å; N28-P34 HydrophobicContact CB-CB 3.79Å; N28-P34 HydrophobicContact CB-CG 3.92Å; K31-P34 HydrophobicContact CB-CB 4.43Å; K31-P34 HydrophobicContact CB-CG 3.81Å; K31-P34 HydrophobicContact CD-CG 4.49Å; K31-P34 WeakPolarHBondContact O-CD 3.46Å; P34-A38 VanDerWaalsContact O-CB 3.23Å; P34-A38 WeakPolarHBondContact O-CB 3.48Å; P34-A38 PolarHBondContact O-N 3.25Å
35	S	96.9	Very high	96.5	Very high	20 Å²	20	82.9 Å²	82.9	14%	0.14	41%	0.406	C	S	.	.	H	α-helix	trans	-70.2	-41.2	178.4	-55.7	0	0	0	0	112	R30 K31 R32 L33 A38 W39	R30-S35 WeakPolarHBondContact CA-OG 3.26Å; K31-S35 VanDerWaalsContact O-CB 3.27Å; K31-S35 WeakPolarHBondContact O-CB 3.47Å; K31-S35 PolarHBondContact O-N 3.12Å; K31-S35 PolarHBondContact O-OG 3.44Å; R32-S35 PolarHBondContact O-N 3.23Å; L33-S35 VanDerWaalsContact C-N 3.29Å; L33-S35 PolarHBondContact O-N 2.98Å; S35-A38 PolarHBondContact O-N 3.2Å; S35-W39 PolarHBondContact O-N 3.27Å
36	E	97.8	Very high	96.1	Very high	83 Å²	83	78.6 Å²	78.6	39%	0.388	38%	0.38	S	S	.	.	H	α-helix	trans	-59.7	-51.3	174.2	-73.4	170	175.8	0	0	109.9	R32 L33 A38 W39 D40	R32-E36 HydrophobicContact CG-CG 4.45Å; R32-E36 WeakPolarHBondContact CG-OE1 3.47Å; R32-E36 IonicContact CZ-OE1 3.45Å; R32-E36 IonicContact NE-OE1 4Å; R32-E36 PolarHBondContact NE-OE1 3Å; R32-E36 IonicContact NE-OE2 2.78Å; R32-E36 IonicContact NH2-OE1 2.84Å; R32-E36 PolarHBondContact NH2-OE1 3.04Å; R32-E36 WeakPolarHBondContact O-CG 3.49Å; R32-E36 PolarHBondContact O-N 3.22Å; L33-E36 PolarHBondContact O-N 3.45Å; E36-A38 VanDerWaalsContact C-N 3.33Å; E36-A38 PolarHBondContact O-N 2.93Å; E36-W39 PolarHBondContact O-N 3.26Å; E36-W39 VanDerWaalsContact O-N 3.14Å; E36-D40 PolarHBondContact O-N 3.06Å
37	N	97.8	Very high	95.2	Very high	84 Å²	84	80.1 Å²	80.1	45%	0.449	40%	0.403	S	S	.	.	H	α-helix	trans	-59.4	-41.2	176.9	-67.7	-9.9	0	0	0	112.7	L33 W39 D40 M41	L33-N37 VanDerWaalsContact O-CG 3.27Å; L33-N37 PolarHBondContact O-N 2.97Å; N37-W39 VanDerWaalsContact C-N 3.34Å; N37-W39 PolarHBondContact O-N 2.78Å; N37-D40 PolarHBondContact O-N 3.33Å; N37-M41 WeakPolarHBondContact O-CG 3.23Å; N37-M41 PolarHBondContact O-N 2.72Å
38	A	97.8	Very high	93.7	Very high	4 Å²	4	80.8 Å²	80.8	3%	0.033	41%	0.406	C	S	.	.	H	α-helix	trans	-62	-40.9	177.2	0	0	0	0	0	112.1	Q18 L21 P34 S35 E36 M41 V42	Q18-A38 HydrophobicContact CB-CB 3.83Å; Q18-A38 HydrophobicContact CG-CB 4.07Å; L21-A38 HydrophobicContact CD1-CB 4.14Å; L21-A38 HydrophobicContact CD2-CB 3.78Å; L21-A38 HydrophobicContact CG-CB 3.83Å; P34-A38 VanDerWaalsContact O-CB 3.23Å; P34-A38 WeakPolarHBondContact O-CB 3.48Å; P34-A38 PolarHBondContact O-N 3.25Å; S35-A38 PolarHBondContact O-N 3.2Å; E36-A38 VanDerWaalsContact C-N 3.33Å; E36-A38 PolarHBondContact O-N 2.93Å; A38-M41 PolarHBondContact O-N 3.3Å; A38-V42 WeakPolarHBondContact O-CG2 3.29Å; A38-V42 PolarHBondContact O-N 2.98Å
39	W	97.1	Very high	91.6	Very high	136 Å²	136	86.4 Å²	86.4	52%	0.515	45%	0.449	S	S	.	.	H	α-helix	trans	-68.4	-36.7	175.7	-77.6	121.1	0	0	0	112.7	V15 L21 S35 E36 N37 M41 V42 A43	V15-W39 HydrophobicContact CG2-CH2 4.25Å; V15-W39 HydrophobicContact CG2-CZ3 4.02Å; L21-W39 HydrophobicContact CD1-CD2 4.12Å; L21-W39 HydrophobicContact CD1-CE3 4.29Å; L21-W39 HydrophobicContact CD1-CH2 4.2Å; L21-W39 HydrophobicContact CD1-CZ2 4.03Å; L21-W39 HydrophobicContact CD1-CZ3 4.33Å; L21-W39 HydrophobicContact CD2-CD2 4.32Å; L21-W39 HydrophobicContact CD2-CG 4.35Å; L21-W39 HydrophobicContact CD2-CZ2 4.28Å; S35-W39 PolarHBondContact O-N 3.27Å; E36-W39 PolarHBondContact O-N 3.26Å; E36-W39 VanDerWaalsContact O-N 3.14Å; N37-W39 VanDerWaalsContact C-N 3.34Å; N37-W39 PolarHBondContact O-N 2.78Å; W39-M41 VanDerWaalsContact C-N 3.32Å; W39-M41 PolarHBondContact O-N 2.64Å; W39-V42 HydrophobicContact CE3-CB 4.16Å; W39-V42 HydrophobicContact CE3-CG1 4.22Å; W39-V42 HydrophobicContact CE3-CG2 4.42Å; W39-V42 HydrophobicContact CZ3-CG1 4.19Å; W39-V42 PolarHBondContact O-N 2.79Å; W39-A43 WeakPolarHBondContact O-CB 3.37Å; W39-A43 PolarHBondContact O-N 3.02Å
40	D	97.1	Very high	91.3	Very high	110 Å²	110	88 Å²	88	59%	0.588	46%	0.461	S	S	*	.	H	α-helix	trans	-60.6	-42.7	172.7	-71	-23.4	0	0	0	111.1	E36 N37 A43 S44	E36-D40 PolarHBondContact O-N 3.06Å; N37-D40 PolarHBondContact O-N 3.33Å; D40-A43 PolarHBondContact O-N 2.94Å; D40-S44 PolarHBondContact O-N 3.49Å
41	M	96.6	Very high	91.3	Very high	97 Å²	97	83.3 Å²	83.3	48%	0.478	45%	0.45	S	S	.	.	H	α-helix	trans	-62.5	-46.5	174.9	-67.1	-61.5	-66.7	0	0	111.7	N37 A38 W39 A43 S44 E45	N37-M41 WeakPolarHBondContact O-CG 3.23Å; N37-M41 PolarHBondContact O-N 2.72Å; A38-M41 PolarHBondContact O-N 3.3Å; W39-M41 VanDerWaalsContact C-N 3.32Å; W39-M41 PolarHBondContact O-N 2.64Å; M41-A43 VanDerWaalsContact C-N 3.32Å; M41-A43 PolarHBondContact O-N 3.09Å; M41-S44 PolarHBondContact O-N 3.25Å; M41-S44 PolarHBondContact O-OG 3.42Å; M41-E45 PolarHBondContact O-N 2.87Å; M41-E45 VanDerWaalsContact O-N 3.09Å
42	V	96.6	Very high	90.9	Very high	5 Å²	5	82.3 Å²	82.3	3%	0.03	45%	0.451	C	S	.	.	H	α-helix	trans	-59.3	-43.8	176.1	171.8	0	0	0	0	111.2	L11 V15 Q18 L21 A38 W39 S44 E45 V46	L11-V42 HydrophobicContact CD1-CG1 3.64Å; V15-V42 HydrophobicContact CG2-CG1 4.12Å; V15-V42 HydrophobicContact CG2-CG2 4.06Å; Q18-V42 HydrophobicContact CG-CG2 3.82Å; L21-V42 HydrophobicContact CD1-CG2 4.39Å; A38-V42 WeakPolarHBondContact O-CG2 3.29Å; A38-V42 PolarHBondContact O-N 2.98Å; W39-V42 HydrophobicContact CE3-CB 4.16Å; W39-V42 HydrophobicContact CE3-CG1 4.22Å; W39-V42 HydrophobicContact CE3-CG2 4.42Å; W39-V42 HydrophobicContact CZ3-CG1 4.19Å; W39-V42 PolarHBondContact O-N 2.79Å; V42-S44 VanDerWaalsContact C-N 3.35Å; V42-S44 PolarHBondContact O-N 3.35Å; V42-E45 PolarHBondContact O-N 3.31Å; V42-V46 HydrophobicContact CG1-CG2 4.28Å; V42-V46 WeakPolarHBondContact O-CB 3.35Å; V42-V46 VanDerWaalsContact O-CG2 3.29Å; V42-V46 WeakPolarHBondContact O-CG2 3.42Å; V42-V46 PolarHBondContact O-N 3.48Å
43	A	94.4	Very high	90.6	Very high	60 Å²	60	75.9 Å²	75.9	50%	0.496	44%	0.435	S	S	.	.	H	α-helix	trans	-64	-39.8	178.6	0	0	0	0	0	112	W39 D40 M41 G47	W39-A43 WeakPolarHBondContact O-CB 3.37Å; W39-A43 PolarHBondContact O-N 3.02Å; D40-A43 PolarHBondContact O-N 2.94Å; M41-A43 VanDerWaalsContact C-N 3.32Å; M41-A43 PolarHBondContact O-N 3.09Å; A43-G47 WeakPolarHBondContact O-CA 3.4Å; A43-G47 PolarHBondContact O-N 2.85Å
44	S	93.8	Very high	90.1	Very high	58 Å²	58	73.8 Å²	73.8	41%	0.406	43%	0.425	S	S	.	.	H	α-helix	trans	-63.4	-39.8	175.9	72.1	0	0	0	0	112.7	D40 M41 V42	D40-S44 PolarHBondContact O-N 3.49Å; M41-S44 PolarHBondContact O-N 3.25Å; M41-S44 PolarHBondContact O-OG 3.42Å; V42-S44 VanDerWaalsContact C-N 3.35Å; V42-S44 PolarHBondContact O-N 3.35Å
45	E	91	Very high	89.6	Confident	61 Å²	61	76.3 Å²	76.3	29%	0.285	44%	0.439	S	S	.	.	H	α-helix	trans	-75.4	-30.4	-179.3	-70.2	-169.9	168.2	0	0	113.7	S14 K17 M41 V42	S14-E45 WeakPolarHBondContact CA-OE2 3.45Å; S14-E45 VanDerWaalsContact CB-OE2 3.23Å; S14-E45 WeakPolarHBondContact CB-OE2 3.38Å; S14-E45 WeakPolarHBondContact OG-CB 3.48Å; S14-E45 PolarHBondContact OG-OE2 3.32Å; K17-E45 IonicContact NZ-OE1 3.61Å; K17-E45 PolarHBondContact NZ-OE1 2.84Å; K17-E45 IonicContact NZ-OE2 2.79Å; K17-E45 PolarHBondContact NZ-OE2 3Å; M41-E45 PolarHBondContact O-N 2.87Å; M41-E45 VanDerWaalsContact O-N 3.09Å; V42-E45 PolarHBondContact O-N 3.31Å
46	V	89.5	Confident	89.1	Confident	35 Å²	35	80.4 Å²	80.4	21%	0.212	46%	0.46	C	S	.	.	H	α-helix	trans	-95.1	-28.2	-176.6	-179.7	0	0	0	0	112	L11 V42	L11-V46 HydrophobicContact CB-CG2 4.44Å; L11-V46 HydrophobicContact CD1-CG2 4.3Å; V42-V46 HydrophobicContact CG1-CG2 4.28Å; V42-V46 WeakPolarHBondContact O-CB 3.35Å; V42-V46 VanDerWaalsContact O-CG2 3.29Å; V42-V46 WeakPolarHBondContact O-CG2 3.42Å; V42-V46 PolarHBondContact O-N 3.48Å
47	G	79.3	Confident	88.4	Confident	63 Å²	63	80.2 Å²	80.2	65%	0.649	47%	0.466	S	S	*	.	H	α-helix	trans	-83.3	-17.3	-177.8	0	0	0	0	0	114.8	A43 S49	A43-G47 WeakPolarHBondContact O-CA 3.4Å; A43-G47 PolarHBondContact O-N 2.85Å; G47-S49 VanDerWaalsContact C-N 3.33Å; G47-S49 PolarHBondContact O-N 3.1Å; G47-S49 VanDerWaalsContact O-N 3.1Å
48	E	65.7	Low	87.7	Confident	168 Å²	168	79.8 Å²	79.8	79%	0.785	47%	0.467	S	S	*	.			trans	-76.6	85.1	164.5	-72.4	-170.8	-176	0	0	109.1
49	S	53.4	Low	86.7	Confident	161 Å²	161	86.7 Å²	86.7	100%	1.126	51%	0.506	S	S	*	.			trans	-142.8	0	172.9	-167.7	0	0	0	0	113.3	G47	G47-S49 VanDerWaalsContact C-N 3.33Å; G47-S49 PolarHBondContact O-N 3.1Å; G47-S49 VanDerWaalsContact O-N 3.1Å

Retrieved 49 of 49 residues in 55.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).