A0A075BJQ3_DROME Loading...

Stonewall

AlphaFold DB , UniProt , Accession A0A075BJQ3, Species DROME (Drosophila melanogaster, Fruit fly), Gene stwl, Length 49 aa.

						>A0A075BJQ3_DROME|A0A075BJQ3|stwl
MSAASDVNLMLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGES
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.1	Low	84.2	Confident	192 Å²	192	82.2 Å²	82.2	95%	0.946	49%	0.487	S	S	*	.				0	153.4	0	-71	-176	-132.4	0	0	107.4
2	S	76.4	Confident	85.2	Confident	68 Å²	68	84.8 Å²	84.8	48%	0.476	50%	0.496	S	S	.	.			trans	-76.8	151	176.4	73.9	0	0	0	0	109.3	A4 S5 D6	S2-A4 PolarHBondContact O-N 3.1Å; S2-A4 VanDerWaalsContact O-N 3.13Å; S2-S5 WeakPolarHBondContact O-CA 3.32Å; S2-S5 VanDerWaalsContact O-CB 3.3Å; S2-S5 WeakPolarHBondContact O-CB 3.28Å; S2-S5 PolarHBondContact O-N 3.5Å; S2-S5 PolarHBondContact OG-N 3.1Å; S2-S5 PolarHBondContact OG-OG 3.5Å; S2-S5 VanDerWaalsContact OG-OG 3.1Å; S2-D6 PolarHBondContact O-N 2.98Å
3	A	72.3	Confident	86	Confident	78 Å²	78	90.9 Å²	90.9	65%	0.645	51%	0.506	S	S	*	.	H	α-helix	trans	-55.1	-32	176.2	0	0	0	0	0	112.5	S5 D6 V7	A3-S5 VanDerWaalsContact C-N 3.35Å; A3-S5 PolarHBondContact O-N 3.09Å; A3-D6 PolarHBondContact O-N 3.33Å; A3-V7 WeakPolarHBondContact O-CG2 3.3Å; A3-V7 PolarHBondContact O-N 2.96Å; A3-V7 VanDerWaalsContact O-N 3.16Å
4	A	78.6	Confident	86.7	Confident	61 Å²	61	84.7 Å²	84.7	50%	0.504	47%	0.472	S	S	.	.	H	α-helix	trans	-65.6	-35.1	174	0	0	0	0	0	112.9	S2 D6 N8	S2-A4 PolarHBondContact O-N 3.1Å; S2-A4 VanDerWaalsContact O-N 3.13Å; A4-D6 VanDerWaalsContact C-N 3.34Å; A4-N8 VanDerWaalsContact O-CB 3.32Å; A4-N8 WeakPolarHBondContact O-CB 3.46Å; A4-N8 PolarHBondContact O-N 3.28Å; A4-N8 VanDerWaalsContact O-N 3.09Å; A4-N8 PolarHBondContact O-ND2 2.87Å; A4-N8 VanDerWaalsContact O-ND2 3.1Å
5	S	87.1	Confident	87.4	Confident	50 Å²	50	81.1 Å²	81.1	35%	0.35	45%	0.452	S	S	.	.	H	α-helix	trans	-65.5	-39.1	174.7	-58.9	0	0	0	0	111.7	S2 A3 N8 L9	S2-S5 WeakPolarHBondContact O-CA 3.32Å; S2-S5 VanDerWaalsContact O-CB 3.3Å; S2-S5 WeakPolarHBondContact O-CB 3.28Å; S2-S5 PolarHBondContact O-N 3.5Å; S2-S5 PolarHBondContact OG-N 3.1Å; S2-S5 PolarHBondContact OG-OG 3.5Å; S2-S5 VanDerWaalsContact OG-OG 3.1Å; A3-S5 VanDerWaalsContact C-N 3.35Å; A3-S5 PolarHBondContact O-N 3.09Å; S5-N8 PolarHBondContact O-N 3.13Å; S5-L9 WeakPolarHBondContact O-CB 3.46Å; S5-L9 VanDerWaalsContact O-CG 3.28Å; S5-L9 WeakPolarHBondContact O-CG 3.49Å; S5-L9 PolarHBondContact O-N 3.16Å
6	D	87.6	Confident	88	Confident	82 Å²	82	84.1 Å²	84.1	44%	0.439	46%	0.462	S	S	.	.	H	α-helix	trans	-70.3	-43.5	-177.6	-61.5	-32.1	0	0	0	111.5	S2 A3 A4 N8 L9 M10	S2-D6 PolarHBondContact O-N 2.98Å; A3-D6 PolarHBondContact O-N 3.33Å; A4-D6 VanDerWaalsContact C-N 3.34Å; D6-N8 PolarHBondContact O-N 3.3Å; D6-L9 PolarHBondContact O-N 3.32Å; D6-M10 WeakPolarHBondContact O-CB 3.42Å; D6-M10 PolarHBondContact O-N 3.48Å
7	V	89.8	Confident	88.5	Confident	72 Å²	72	86.4 Å²	86.4	44%	0.436	47%	0.466	S	S	.	.	H	α-helix	trans	-63	-42.5	174.4	174.8	0	0	0	0	111.5	A3 L9 M10 L11	A3-V7 WeakPolarHBondContact O-CG2 3.3Å; A3-V7 PolarHBondContact O-N 2.96Å; A3-V7 VanDerWaalsContact O-N 3.16Å; V7-L9 PolarHBondContact O-N 3.43Å; V7-M10 WeakPolarHBondContact O-CB 3.46Å; V7-M10 PolarHBondContact O-N 3.04Å; V7-L11 PolarHBondContact O-N 3.46Å
8	N	92	Very high	89	Confident	92 Å²	92	83.9 Å²	83.9	49%	0.492	45%	0.451	S	S	.	.	H	α-helix	trans	-65.1	-39.7	177.6	-73.1	-21.5	0	0	0	112.2	A4 S5 D6 M10 L11 L12	A4-N8 VanDerWaalsContact O-CB 3.32Å; A4-N8 WeakPolarHBondContact O-CB 3.46Å; A4-N8 PolarHBondContact O-N 3.28Å; A4-N8 VanDerWaalsContact O-N 3.09Å; A4-N8 PolarHBondContact O-ND2 2.87Å; A4-N8 VanDerWaalsContact O-ND2 3.1Å; S5-N8 PolarHBondContact O-N 3.13Å; D6-N8 PolarHBondContact O-N 3.3Å; N8-M10 VanDerWaalsContact C-N 3.33Å; N8-L11 PolarHBondContact O-N 3Å; N8-L12 VanDerWaalsContact O-CG 3.31Å; N8-L12 WeakPolarHBondContact O-CG 2.88Å; N8-L12 PolarHBondContact O-N 2.93Å
9	L	93.7	Very high	89.4	Confident	76 Å²	76	82.3 Å²	82.3	40%	0.398	44%	0.444	S	S	.	.	H	α-helix	trans	-63.9	-40.4	175.1	-78.5	172.1	0	0	0	111.7	S5 D6 V7 L12 R13	S5-L9 WeakPolarHBondContact O-CB 3.46Å; S5-L9 VanDerWaalsContact O-CG 3.28Å; S5-L9 WeakPolarHBondContact O-CG 3.49Å; S5-L9 PolarHBondContact O-N 3.16Å; D6-L9 PolarHBondContact O-N 3.32Å; V7-L9 PolarHBondContact O-N 3.43Å; L9-L12 PolarHBondContact O-N 3.44Å; L9-R13 WeakPolarHBondContact O-CB 3.31Å; L9-R13 VanDerWaalsContact O-CG 3.29Å; L9-R13 WeakPolarHBondContact O-CG 3.29Å; L9-R13 PolarHBondContact O-N 3.29Å
10	M	93.5	Very high	89.8	Confident	66 Å²	66	78.8 Å²	78.8	33%	0.325	43%	0.427	S	S	.	.	H	α-helix	trans	-62.7	-47.6	176.1	-171.7	175.5	168.3	0	0	111.2	D6 V7 N8 L12 R13 S14 E45 V46	D6-M10 WeakPolarHBondContact O-CB 3.42Å; D6-M10 PolarHBondContact O-N 3.48Å; V7-M10 WeakPolarHBondContact O-CB 3.46Å; V7-M10 PolarHBondContact O-N 3.04Å; N8-M10 VanDerWaalsContact C-N 3.33Å; M10-L12 PolarHBondContact O-N 3.27Å; M10-R13 PolarHBondContact O-N 2.77Å; M10-S14 PolarHBondContact O-N 3.49Å; M10-S14 PolarHBondContact O-OG 3.44Å; M10-E45 WeakPolarHBondContact CE-O 3.31Å; M10-V46 HydrophobicContact CG-CG2 4.49Å
11	L	95	Very high	90.1	Very high	67 Å²	67	76.7 Å²	76.7	35%	0.351	42%	0.416	S	S	.	.	H	α-helix	trans	-55.8	-49.2	174.7	175.8	63.4	0	0	0	112.3	V7 N8 R13 S14 V15 V42 V46	V7-L11 PolarHBondContact O-N 3.46Å; N8-L11 PolarHBondContact O-N 3Å; L11-R13 VanDerWaalsContact C-N 3.34Å; L11-R13 PolarHBondContact O-N 2.81Å; L11-S14 PolarHBondContact O-N 3.37Å; L11-V15 HydrophobicContact CD1-CG2 4.26Å; L11-V15 WeakPolarHBondContact O-CG2 3.44Å; L11-V15 PolarHBondContact O-N 3.36Å; L11-V42 HydrophobicContact CD1-CG1 3.6Å; L11-V46 HydrophobicContact CB-CG2 4.34Å; L11-V46 HydrophobicContact CD1-CG2 4.19Å
12	L	96.2	Very high	91.8	Very high	114 Å²	114	73 Å²	73	60%	0.597	39%	0.392	S	S	*	.	H	α-helix	trans	-62.8	-40.5	-179.2	-71.6	170.8	0	0	0	112	N8 L9 M10 S14 V15 E16	N8-L12 VanDerWaalsContact O-CG 3.31Å; N8-L12 WeakPolarHBondContact O-CG 2.88Å; N8-L12 PolarHBondContact O-N 2.93Å; L9-L12 PolarHBondContact O-N 3.44Å; M10-L12 PolarHBondContact O-N 3.27Å; L12-S14 VanDerWaalsContact C-N 3.35Å; L12-V15 PolarHBondContact O-N 3.29Å; L12-E16 WeakPolarHBondContact O-CB 3.48Å; L12-E16 PolarHBondContact O-N 2.99Å
13	R	95.9	Very high	92.8	Very high	164 Å²	164	72.2 Å²	72.2	62%	0.619	38%	0.382	S	S	*	.	H	α-helix	trans	-64.6	-37.8	175.7	-74.6	173.5	176.5	176.5	1	112.5	L9 M10 L11	L9-R13 WeakPolarHBondContact O-CB 3.31Å; L9-R13 VanDerWaalsContact O-CG 3.29Å; L9-R13 WeakPolarHBondContact O-CG 3.29Å; L9-R13 PolarHBondContact O-N 3.29Å; M10-R13 PolarHBondContact O-N 2.77Å; L11-R13 VanDerWaalsContact C-N 3.34Å; L11-R13 PolarHBondContact O-N 2.81Å
14	S	96.3	Very high	94	Very high	4 Å²	4	78 Å²	78	3%	0.028	39%	0.387	C	S	.	.	H	α-helix	trans	-68.3	-41.3	175.5	-66	0	0	0	0	111.6	M10 L11 L12 K17 E45	M10-S14 PolarHBondContact O-N 3.49Å; M10-S14 PolarHBondContact O-OG 3.44Å; L11-S14 PolarHBondContact O-N 3.37Å; L12-S14 VanDerWaalsContact C-N 3.35Å; S14-K17 PolarHBondContact O-N 3.22Å; S14-E45 VanDerWaalsContact CB-OE2 3.22Å; S14-E45 WeakPolarHBondContact CB-OE2 3.44Å; S14-E45 WeakPolarHBondContact OG-CB 3.39Å; S14-E45 PolarHBondContact OG-OE2 2.92Å
15	V	97	Very high	94.9	Very high	30 Å²	30	81 Å²	81	18%	0.182	40%	0.4	C	S	.	.	H	α-helix	trans	-64.6	-39.1	175.5	170.6	0	0	0	0	111.9	L11 L12 K17 Q18 L21 Y22 W39 V42	L11-V15 HydrophobicContact CD1-CG2 4.26Å; L11-V15 WeakPolarHBondContact O-CG2 3.44Å; L11-V15 PolarHBondContact O-N 3.36Å; L12-V15 PolarHBondContact O-N 3.29Å; V15-K17 PolarHBondContact O-N 3.35Å; V15-Q18 PolarHBondContact O-N 3.07Å; V15-L21 HydrophobicContact CG1-CD1 4.25Å; V15-Y22 HydrophobicContact CG1-CD1 4.43Å; V15-W39 HydrophobicContact CG2-CH2 4.17Å; V15-W39 HydrophobicContact CG2-CZ3 3.95Å; V15-V42 HydrophobicContact CG2-CG1 4.06Å; V15-V42 HydrophobicContact CG2-CG2 4.05Å
16	E	97.3	Very high	95.3	Very high	130 Å²	130	80 Å²	80	61%	0.607	39%	0.391	S	S	*	.	H	α-helix	trans	-57.7	-32.3	178.1	-176.1	178.3	-155.2	0	0	112.7	L12 Q18 Y22	L12-E16 WeakPolarHBondContact O-CB 3.48Å; L12-E16 PolarHBondContact O-N 2.99Å; E16-Q18 PolarHBondContact O-N 3.36Å; E16-Y22 PolarHBondContact O-OH 2.87Å; E16-Y22 VanDerWaalsContact O-OH 3.07Å
17	K	96.6	Very high	95.7	Very high	123 Å²	123	83.4 Å²	83.4	54%	0.535	40%	0.404	S	S	.	.	T	Hydrogen-bonded Turn	trans	-71	-18.7	176.2	-62.3	168.4	-174.8	169	0	113.5	S14 V15 E45	S14-K17 PolarHBondContact O-N 3.22Å; V15-K17 PolarHBondContact O-N 3.35Å; K17-E45 IonicContact NZ-OE1 2.81Å; K17-E45 PolarHBondContact NZ-OE1 2.95Å; K17-E45 IonicContact NZ-OE2 2.77Å; K17-E45 PolarHBondContact NZ-OE2 2.95Å
18	Q	97	Very high	96.1	Very high	41 Å²	41	82 Å²	82	19%	0.192	39%	0.394	C	S	.	.			trans	-107.3	75.2	-173.3	-51.4	-53.8	-42.9	0	0	110.5	V15 E16 A20 L21 A38 V42	V15-Q18 PolarHBondContact O-N 3.07Å; E16-Q18 PolarHBondContact O-N 3.36Å; Q18-A20 PolarHBondContact O-N 2.62Å; Q18-A20 VanDerWaalsContact O-N 3.12Å; Q18-L21 HydrophobicContact CB-CD1 3.8Å; Q18-L21 HydrophobicContact CB-CG 4Å; Q18-L21 HydrophobicContact CG-CD1 4.49Å; Q18-L21 WeakPolarHBondContact O-CB 3.31Å; Q18-L21 PolarHBondContact O-N 3.24Å; Q18-A38 HydrophobicContact CB-CB 3.82Å; Q18-A38 HydrophobicContact CG-CB 4.13Å; Q18-V42 HydrophobicContact CG-CG2 3.88Å
19	T	96.8	Very high	96.3	Very high	53 Å²	53	80.2 Å²	80.2	33%	0.325	38%	0.381	S	S	.	.	G	3₁₀ helix	trans	-56.1	-31.3	-175.5	46.3	0	0	0	0	113.7	L21 Y22 D23 D26	T19-L21 PolarHBondContact O-N 3.02Å; T19-Y22 PolarHBondContact O-N 3.17Å; T19-D23 WeakPolarHBondContact O-CB 3.47Å; T19-D23 PolarHBondContact O-N 3.45Å; T19-D26 WeakPolarHBondContact CB-OD2 3.22Å; T19-D26 PolarHBondContact OG1-OD2 3.39Å
20	A	96.8	Very high	96.1	Very high	12 Å²	12	85.5 Å²	85.5	10%	0.099	40%	0.396	C	S	.	.	G	3₁₀ helix	trans	-53.9	-22.2	174.5	0	0	0	0	0	114.1	Q18 D26 N28 P34	Q18-A20 PolarHBondContact O-N 2.62Å; Q18-A20 VanDerWaalsContact O-N 3.12Å; A20-D26 PolarHBondContact N-OD2 2.99Å; A20-N28 HydrophobicContact CB-CB 4.11Å; A20-P34 HydrophobicContact CB-CB 4.41Å
21	L	96.2	Very high	96.3	Very high	35 Å²	35	87 Å²	87	18%	0.183	40%	0.4	C	S	.	.	G	3₁₀ helix	trans	-79.8	-29.8	179.2	-62	-178.3	0	0	0	113.8	V15 Q18 T19 A38 W39 V42	V15-L21 HydrophobicContact CG1-CD1 4.25Å; Q18-L21 HydrophobicContact CB-CD1 3.8Å; Q18-L21 HydrophobicContact CB-CG 4Å; Q18-L21 HydrophobicContact CG-CD1 4.49Å; Q18-L21 WeakPolarHBondContact O-CB 3.31Å; Q18-L21 PolarHBondContact O-N 3.24Å; T19-L21 PolarHBondContact O-N 3.02Å; L21-A38 HydrophobicContact CD1-CB 4.13Å; L21-A38 HydrophobicContact CD2-CB 3.72Å; L21-A38 HydrophobicContact CG-CB 3.78Å; L21-W39 HydrophobicContact CD1-CD2 4.12Å; L21-W39 HydrophobicContact CD1-CE3 4.28Å; L21-W39 HydrophobicContact CD1-CH2 4.21Å; L21-W39 HydrophobicContact CD1-CZ2 4.05Å; L21-W39 HydrophobicContact CD1-CZ3 4.33Å; L21-W39 HydrophobicContact CD2-CD2 4.25Å; L21-W39 HydrophobicContact CD2-CG 4.27Å; L21-W39 HydrophobicContact CD2-CZ2 4.25Å; L21-V42 HydrophobicContact CD1-CG2 4.3Å
22	Y	95.6	Very high	96.3	Very high	115 Å²	115	93.1 Å²	93.1	45%	0.451	42%	0.419	S	S	.	.	T	Hydrogen-bonded Turn	trans	-139.6	-27.4	-168.5	71.2	-93.3	0	0	0	115.5	V15 E16 T19 R24	V15-Y22 HydrophobicContact CG1-CD1 4.43Å; E16-Y22 PolarHBondContact O-OH 2.87Å; E16-Y22 VanDerWaalsContact O-OH 3.07Å; T19-Y22 PolarHBondContact O-N 3.17Å; Y22-R24 PolarHBondContact O-N 2.96Å
23	D	97.4	Very high	96.4	Very high	51 Å²	51	93 Å²	93	27%	0.273	42%	0.418	S	S	.	.			trans	-81.1	117	-178.1	-175.9	-5.6	0	0	0	110.3	T19 T25 D26 Y29	T19-D23 WeakPolarHBondContact O-CB 3.47Å; T19-D23 PolarHBondContact O-N 3.45Å; D23-T25 VanDerWaalsContact CG-OG1 3.3Å; D23-T25 PolarHBondContact O-N 2.85Å; D23-T25 WeakPolarHBondContact OD1-CB 3.45Å; D23-T25 PolarHBondContact OD1-N 2.76Å; D23-T25 PolarHBondContact OD1-OG1 2.81Å; D23-T25 PolarHBondContact OD2-OG1 3.45Å; D23-D26 HydrophobicContact CB-CB 4.13Å; D23-D26 WeakPolarHBondContact O-CB 3.41Å; D23-D26 PolarHBondContact O-N 2.97Å; D23-Y29 VanDerWaalsContact O-CB 3.26Å; D23-Y29 WeakPolarHBondContact O-CB 3.38Å; D23-Y29 WeakPolarHBondContact O-CD2 3.35Å; D23-Y29 VanDerWaalsContact O-CG 3.29Å
24	R	96.9	Very high	96.4	Very high	199 Å²	199	86.8 Å²	86.8	75%	0.751	40%	0.399	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.9	-14.9	-179.3	-60.4	-175.9	-178.6	176.8	2.8	113.7	Y22 Y29	Y22-R24 PolarHBondContact O-N 2.96Å; R24-Y29 HydrophobicContact CB-CD1 4.35Å; R24-Y29 HydrophobicContact CB-CE1 4.27Å; R24-Y29 HydrophobicContact CG-CD1 4.3Å; R24-Y29 HydrophobicContact CG-CE1 3.75Å; R24-Y29 HydrophobicContact CG-CE2 4.26Å
25	T	97.5	Very high	96.4	Very high	124 Å²	124	87.8 Å²	87.8	76%	0.761	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.7	-13	177.4	71	0	0	0	0	112.3	D23 E27	D23-T25 VanDerWaalsContact CG-OG1 3.3Å; D23-T25 PolarHBondContact O-N 2.85Å; D23-T25 WeakPolarHBondContact OD1-CB 3.45Å; D23-T25 PolarHBondContact OD1-N 2.76Å; D23-T25 PolarHBondContact OD1-OG1 2.81Å; D23-T25 PolarHBondContact OD2-OG1 3.45Å; T25-E27 PolarHBondContact O-N 3.12Å
26	D	96.5	Very high	96.4	Very high	30 Å²	30	90.3 Å²	90.3	16%	0.16	42%	0.416	C	S	.	.	S	Bend	trans	-64	127.9	172.1	-169	-54.5	0	0	0	109.7	T19 A20 D23 N28 Y29	T19-D26 WeakPolarHBondContact CB-OD2 3.22Å; T19-D26 PolarHBondContact OG1-OD2 3.39Å; A20-D26 PolarHBondContact N-OD2 2.99Å; D23-D26 HydrophobicContact CB-CB 4.13Å; D23-D26 WeakPolarHBondContact O-CB 3.41Å; D23-D26 PolarHBondContact O-N 2.97Å; D26-N28 PolarHBondContact O-N 3.04Å; D26-N28 WeakPolarHBondContact OD1-CA 3.46Å; D26-N28 VanDerWaalsContact OD1-CB 3.25Å; D26-N28 WeakPolarHBondContact OD1-CB 3.34Å; D26-N28 PolarHBondContact OD1-N 2.97Å; D26-Y29 WeakPolarHBondContact O-CB 3.38Å; D26-Y29 PolarHBondContact O-N 2.54Å
27	E	96.7	Very high	96.4	Very high	154 Å²	154	88.2 Å²	88.2	72%	0.72	41%	0.408	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.6	-21.7	179.2	56.4	164	-156.2	0	0	113.1	T25 K31	T25-E27 PolarHBondContact O-N 3.12Å; E27-K31 WeakPolarHBondContact O-CE 3.21Å; E27-K31 PolarHBondContact O-NZ 2.88Å
28	N	96.7	Very high	96.5	Very high	43 Å²	43	82.5 Å²	82.5	23%	0.23	39%	0.385	C	S	.	.	T	Hydrogen-bonded Turn	trans	-101	3.3	-179.1	-61.9	-48.9	0	0	0	113.3	A20 D26 R30 K31 P34	A20-N28 HydrophobicContact CB-CB 4.11Å; D26-N28 PolarHBondContact O-N 3.04Å; D26-N28 WeakPolarHBondContact OD1-CA 3.46Å; D26-N28 VanDerWaalsContact OD1-CB 3.25Å; D26-N28 WeakPolarHBondContact OD1-CB 3.34Å; D26-N28 PolarHBondContact OD1-N 2.97Å; N28-R30 PolarHBondContact O-N 2.98Å; N28-K31 HydrophobicContact CB-CD 4.48Å; N28-K31 WeakPolarHBondContact O-CB 3.19Å; N28-K31 PolarHBondContact O-N 3.25Å; N28-K31 PolarHBondContact OD1-NZ 3.05Å; N28-P34 HydrophobicContact CB-CB 3.74Å; N28-P34 HydrophobicContact CB-CG 3.93Å
29	Y	96.1	Very high	96.5	Very high	53 Å²	53	87 Å²	87	21%	0.208	40%	0.4	C	S	.	.	T	Hydrogen-bonded Turn	trans	-50.7	124	177.7	-176.8	-116.5	0	0	0	112.2	D23 R24 D26 K31	D23-Y29 VanDerWaalsContact O-CB 3.26Å; D23-Y29 WeakPolarHBondContact O-CB 3.38Å; D23-Y29 WeakPolarHBondContact O-CD2 3.35Å; D23-Y29 VanDerWaalsContact O-CG 3.29Å; R24-Y29 HydrophobicContact CB-CD1 4.35Å; R24-Y29 HydrophobicContact CB-CE1 4.27Å; R24-Y29 HydrophobicContact CG-CD1 4.3Å; R24-Y29 HydrophobicContact CG-CE1 3.75Å; R24-Y29 HydrophobicContact CG-CE2 4.26Å; D26-Y29 WeakPolarHBondContact O-CB 3.38Å; D26-Y29 PolarHBondContact O-N 2.54Å; Y29-K31 PolarHBondContact O-N 3.45Å
30	R	90.4	Very high	96.5	Very high	188 Å²	188	89.8 Å²	89.8	71%	0.709	41%	0.413	S	S	*	.	T	Hydrogen-bonded Turn	trans	57.8	10.9	-178.9	-65.4	179.3	174.4	173.6	-2.6	115.6	N28 R32	N28-R30 PolarHBondContact O-N 2.98Å; R30-R32 PolarHBondContact O-N 3.34Å
31	K	96.8	Very high	96.4	Very high	98 Å²	98	93.8 Å²	93.8	43%	0.426	43%	0.43	S	S	.	.			trans	-70.4	131.8	167.1	-67.1	-172.1	-169.3	152.1	0	108.1	E27 N28 Y29 P34 S35	E27-K31 WeakPolarHBondContact O-CE 3.21Å; E27-K31 PolarHBondContact O-NZ 2.88Å; N28-K31 HydrophobicContact CB-CD 4.48Å; N28-K31 WeakPolarHBondContact O-CB 3.19Å; N28-K31 PolarHBondContact O-N 3.25Å; N28-K31 PolarHBondContact OD1-NZ 3.05Å; Y29-K31 PolarHBondContact O-N 3.45Å; K31-P34 HydrophobicContact CB-CB 4.39Å; K31-P34 HydrophobicContact CB-CG 3.75Å; K31-P34 HydrophobicContact CD-CG 4.36Å; K31-P34 WeakPolarHBondContact O-CD 3.09Å; K31-S35 VanDerWaalsContact O-CB 3.31Å; K31-S35 WeakPolarHBondContact O-CB 3.26Å; K31-S35 PolarHBondContact O-N 3.32Å; K31-S35 PolarHBondContact O-OG 3.3Å
32	R	96.2	Very high	96.4	Very high	195 Å²	195	92.3 Å²	92.3	74%	0.736	42%	0.423	S	S	*	.	H	α-helix	trans	-55	-59.4	-173.6	-178.7	178.1	172.5	-173.2	-2.8	112.9	R30 S35 E36	R30-R32 PolarHBondContact O-N 3.34Å; R32-S35 PolarHBondContact O-N 3Å; R32-S35 VanDerWaalsContact O-N 3.17Å; R32-E36 HydrophobicContact CG-CG 4.43Å; R32-E36 WeakPolarHBondContact CG-OE1 3.35Å; R32-E36 IonicContact CZ-OE1 3.45Å; R32-E36 IonicContact NE-OE1 3.99Å; R32-E36 PolarHBondContact NE-OE1 3.05Å; R32-E36 IonicContact NE-OE2 3.6Å; R32-E36 IonicContact NH2-OE1 2.83Å; R32-E36 PolarHBondContact NH2-OE1 3.22Å; R32-E36 WeakPolarHBondContact O-CG 3.33Å; R32-E36 PolarHBondContact O-N 3.4Å
33	L	97.4	Very high	96.4	Very high	110 Å²	110	89.7 Å²	89.7	58%	0.576	43%	0.425	S	S	*	.	H	α-helix	trans	-62.5	-46.8	-175.4	178.1	69	0	0	0	112.9	S35 E36 N37	L33-S35 VanDerWaalsContact C-N 3.29Å; L33-S35 PolarHBondContact O-N 3.17Å; L33-E36 PolarHBondContact O-N 2.99Å; L33-N37 WeakPolarHBondContact O-CB 3.25Å; L33-N37 VanDerWaalsContact O-CG 3.26Å; L33-N37 PolarHBondContact O-N 2.72Å
34	P	97	Very high	96.2	Very high	35 Å²	35	90.1 Å²	90.1	23%	0.227	43%	0.432	C	S	.	.	H	α-helix	trans	-59.2	-37.3	172.7	-28.7	37.4	0	0	0	114.1	A20 N28 K31 A38	A20-P34 HydrophobicContact CB-CB 4.41Å; N28-P34 HydrophobicContact CB-CB 3.74Å; N28-P34 HydrophobicContact CB-CG 3.93Å; K31-P34 HydrophobicContact CB-CB 4.39Å; K31-P34 HydrophobicContact CB-CG 3.75Å; K31-P34 HydrophobicContact CD-CG 4.36Å; K31-P34 WeakPolarHBondContact O-CD 3.09Å; P34-A38 VanDerWaalsContact O-CB 3.23Å; P34-A38 WeakPolarHBondContact O-CB 3.23Å; P34-A38 PolarHBondContact O-N 3.41Å
35	S	95.9	Very high	95.9	Very high	24 Å²	24	83.5 Å²	83.5	17%	0.168	41%	0.409	C	S	.	.	H	α-helix	trans	-68.9	-42.2	177.9	-56	0	0	0	0	111.8	K31 R32 L33 A38 W39	K31-S35 VanDerWaalsContact O-CB 3.31Å; K31-S35 WeakPolarHBondContact O-CB 3.26Å; K31-S35 PolarHBondContact O-N 3.32Å; K31-S35 PolarHBondContact O-OG 3.3Å; R32-S35 PolarHBondContact O-N 3Å; R32-S35 VanDerWaalsContact O-N 3.17Å; L33-S35 VanDerWaalsContact C-N 3.29Å; L33-S35 PolarHBondContact O-N 3.17Å; S35-A38 PolarHBondContact O-N 3.34Å; S35-W39 PolarHBondContact O-N 3.5Å
36	E	97.4	Very high	95.5	Very high	84 Å²	84	79.1 Å²	79.1	39%	0.393	38%	0.382	S	S	.	.	H	α-helix	trans	-60.1	-51	174.8	-73.2	170.4	174.7	0	0	110.2	R32 L33 A38 W39 D40	R32-E36 HydrophobicContact CG-CG 4.43Å; R32-E36 WeakPolarHBondContact CG-OE1 3.35Å; R32-E36 IonicContact CZ-OE1 3.45Å; R32-E36 IonicContact NE-OE1 3.99Å; R32-E36 PolarHBondContact NE-OE1 3.05Å; R32-E36 IonicContact NE-OE2 3.6Å; R32-E36 IonicContact NH2-OE1 2.83Å; R32-E36 PolarHBondContact NH2-OE1 3.22Å; R32-E36 WeakPolarHBondContact O-CG 3.33Å; R32-E36 PolarHBondContact O-N 3.4Å; L33-E36 PolarHBondContact O-N 2.99Å; E36-A38 VanDerWaalsContact C-N 3.32Å; E36-A38 PolarHBondContact O-N 3.05Å; E36-W39 PolarHBondContact O-N 3.13Å; E36-W39 VanDerWaalsContact O-N 3.13Å; E36-D40 PolarHBondContact O-N 3.34Å
37	N	97.6	Very high	94.7	Very high	85 Å²	85	80.8 Å²	80.8	46%	0.455	41%	0.407	S	S	.	.	H	α-helix	trans	-59.2	-41	176.9	-68	-9.5	0	0	0	112.7	L33 W39 D40 M41	L33-N37 WeakPolarHBondContact O-CB 3.25Å; L33-N37 VanDerWaalsContact O-CG 3.26Å; L33-N37 PolarHBondContact O-N 2.72Å; N37-W39 VanDerWaalsContact C-N 3.34Å; N37-W39 PolarHBondContact O-N 2.9Å; N37-D40 PolarHBondContact O-N 2.96Å; N37-M41 WeakPolarHBondContact O-CG 2.91Å; N37-M41 PolarHBondContact O-N 3.03Å
38	A	97.3	Very high	93.3	Very high	4 Å²	4	82.2 Å²	82.2	3%	0.033	41%	0.414	C	S	.	.	H	α-helix	trans	-62.2	-41.1	177	0	0	0	0	0	112	Q18 L21 P34 S35 E36 M41 V42	Q18-A38 HydrophobicContact CB-CB 3.82Å; Q18-A38 HydrophobicContact CG-CB 4.13Å; L21-A38 HydrophobicContact CD1-CB 4.13Å; L21-A38 HydrophobicContact CD2-CB 3.72Å; L21-A38 HydrophobicContact CG-CB 3.78Å; P34-A38 VanDerWaalsContact O-CB 3.23Å; P34-A38 WeakPolarHBondContact O-CB 3.23Å; P34-A38 PolarHBondContact O-N 3.41Å; S35-A38 PolarHBondContact O-N 3.34Å; E36-A38 VanDerWaalsContact C-N 3.32Å; E36-A38 PolarHBondContact O-N 3.05Å; A38-M41 PolarHBondContact O-N 3.47Å; A38-V42 WeakPolarHBondContact O-CG2 3.39Å; A38-V42 PolarHBondContact O-N 2.74Å
39	W	96.6	Very high	91.3	Very high	135 Å²	135	87 Å²	87	51%	0.511	45%	0.45	S	S	.	.	H	α-helix	trans	-68.1	-36.4	175.6	-77.2	120.3	0	0	0	112.8	V15 L21 S35 E36 N37 M41 V42 A43	V15-W39 HydrophobicContact CG2-CH2 4.17Å; V15-W39 HydrophobicContact CG2-CZ3 3.95Å; L21-W39 HydrophobicContact CD1-CD2 4.12Å; L21-W39 HydrophobicContact CD1-CE3 4.28Å; L21-W39 HydrophobicContact CD1-CH2 4.21Å; L21-W39 HydrophobicContact CD1-CZ2 4.05Å; L21-W39 HydrophobicContact CD1-CZ3 4.33Å; L21-W39 HydrophobicContact CD2-CD2 4.25Å; L21-W39 HydrophobicContact CD2-CG 4.27Å; L21-W39 HydrophobicContact CD2-CZ2 4.25Å; S35-W39 PolarHBondContact O-N 3.5Å; E36-W39 PolarHBondContact O-N 3.13Å; E36-W39 VanDerWaalsContact O-N 3.13Å; N37-W39 VanDerWaalsContact C-N 3.34Å; N37-W39 PolarHBondContact O-N 2.9Å; W39-M41 VanDerWaalsContact C-N 3.3Å; W39-M41 PolarHBondContact O-N 3.33Å; W39-V42 HydrophobicContact CE3-CB 4.14Å; W39-V42 HydrophobicContact CE3-CG1 4.21Å; W39-V42 HydrophobicContact CE3-CG2 4.39Å; W39-V42 HydrophobicContact CZ3-CG1 4.18Å; W39-V42 PolarHBondContact O-N 3.4Å; W39-A43 WeakPolarHBondContact O-CB 3.5Å; W39-A43 PolarHBondContact O-N 2.92Å
40	D	96.9	Very high	91.1	Very high	111 Å²	111	88.7 Å²	88.7	59%	0.594	46%	0.462	S	S	*	.	H	α-helix	trans	-60.6	-41	172.7	-71.4	-22.3	0	0	0	111.3	E36 N37 A43 S44	E36-D40 PolarHBondContact O-N 3.34Å; N37-D40 PolarHBondContact O-N 2.96Å; D40-A43 PolarHBondContact O-N 3.37Å; D40-S44 PolarHBondContact O-N 3.17Å; D40-S44 PolarHBondContact O-OG 3.45Å
41	M	96.3	Very high	91.1	Very high	96 Å²	96	83.4 Å²	83.4	47%	0.473	45%	0.45	S	S	.	.	H	α-helix	trans	-66.2	-40.1	174.7	-66.3	-61.2	-65.8	0	0	112.7	N37 A38 W39 S44 E45	N37-M41 WeakPolarHBondContact O-CG 2.91Å; N37-M41 PolarHBondContact O-N 3.03Å; A38-M41 PolarHBondContact O-N 3.47Å; W39-M41 VanDerWaalsContact C-N 3.3Å; W39-M41 PolarHBondContact O-N 3.33Å; M41-S44 PolarHBondContact O-OG 3.22Å; M41-E45 WeakPolarHBondContact O-CG 3.43Å; M41-E45 PolarHBondContact O-N 2.99Å; M41-E45 VanDerWaalsContact O-N 3.17Å
42	V	96.3	Very high	90.8	Very high	4 Å²	4	82.6 Å²	82.6	2%	0.024	45%	0.451	C	S	.	.	H	α-helix	trans	-64	-42.9	174.9	171.6	0	0	0	0	110.8	L11 V15 Q18 L21 A38 W39 E45 V46	L11-V42 HydrophobicContact CD1-CG1 3.6Å; V15-V42 HydrophobicContact CG2-CG1 4.06Å; V15-V42 HydrophobicContact CG2-CG2 4.05Å; Q18-V42 HydrophobicContact CG-CG2 3.88Å; L21-V42 HydrophobicContact CD1-CG2 4.3Å; A38-V42 WeakPolarHBondContact O-CG2 3.39Å; A38-V42 PolarHBondContact O-N 2.74Å; W39-V42 HydrophobicContact CE3-CB 4.14Å; W39-V42 HydrophobicContact CE3-CG1 4.21Å; W39-V42 HydrophobicContact CE3-CG2 4.39Å; W39-V42 HydrophobicContact CZ3-CG1 4.18Å; W39-V42 PolarHBondContact O-N 3.4Å; V42-E45 PolarHBondContact O-N 2.73Å; V42-V46 HydrophobicContact CG1-CG2 4.31Å; V42-V46 VanDerWaalsContact O-CG2 3.31Å; V42-V46 WeakPolarHBondContact O-CG2 3.36Å; V42-V46 PolarHBondContact O-N 2.99Å
43	A	94.3	Very high	90.4	Very high	60 Å²	60	76 Å²	76	50%	0.496	43%	0.434	S	S	.	.	H	α-helix	trans	-65.9	-39.2	180	0	0	0	0	0	112.3	W39 D40 G47	W39-A43 WeakPolarHBondContact O-CB 3.5Å; W39-A43 PolarHBondContact O-N 2.92Å; D40-A43 PolarHBondContact O-N 3.37Å; A43-G47 WeakPolarHBondContact O-CA 3.45Å; A43-G47 PolarHBondContact O-N 2.83Å
44	S	93.7	Very high	90	Very high	60 Å²	60	73.9 Å²	73.9	42%	0.42	43%	0.425	S	S	.	.	H	α-helix	trans	-66.3	-37.8	176.4	68.3	0	0	0	0	112.3	D40 M41	D40-S44 PolarHBondContact O-N 3.17Å; D40-S44 PolarHBondContact O-OG 3.45Å; M41-S44 PolarHBondContact O-OG 3.22Å
45	E	91	Very high	89.5	Confident	60 Å²	60	76.5 Å²	76.5	28%	0.28	44%	0.438	S	S	.	.	H	α-helix	trans	-69.8	-43	176.6	-72.3	-170.7	172.2	0	0	112.6	M10 S14 K17 M41 V42	M10-E45 WeakPolarHBondContact CE-O 3.31Å; S14-E45 VanDerWaalsContact CB-OE2 3.22Å; S14-E45 WeakPolarHBondContact CB-OE2 3.44Å; S14-E45 WeakPolarHBondContact OG-CB 3.39Å; S14-E45 PolarHBondContact OG-OE2 2.92Å; K17-E45 IonicContact NZ-OE1 2.81Å; K17-E45 PolarHBondContact NZ-OE1 2.95Å; K17-E45 IonicContact NZ-OE2 2.77Å; K17-E45 PolarHBondContact NZ-OE2 2.95Å; M41-E45 WeakPolarHBondContact O-CG 3.43Å; M41-E45 PolarHBondContact O-N 2.99Å; M41-E45 VanDerWaalsContact O-N 3.17Å; V42-E45 PolarHBondContact O-N 2.73Å
46	V	89.3	Confident	89.1	Confident	32 Å²	32	80.2 Å²	80.2	19%	0.194	46%	0.458	C	S	.	.	H	α-helix	trans	-84.1	-28.9	-174.3	-179	0	0	0	0	112.9	M10 L11 V42	M10-V46 HydrophobicContact CG-CG2 4.49Å; L11-V46 HydrophobicContact CB-CG2 4.34Å; L11-V46 HydrophobicContact CD1-CG2 4.19Å; V42-V46 HydrophobicContact CG1-CG2 4.31Å; V42-V46 VanDerWaalsContact O-CG2 3.31Å; V42-V46 WeakPolarHBondContact O-CG2 3.36Å; V42-V46 PolarHBondContact O-N 2.99Å
47	G	79.6	Confident	88.5	Confident	66 Å²	66	79.9 Å²	79.9	68%	0.68	46%	0.463	S	S	*	.	H	α-helix	trans	-80	-13.9	-174	0	0	0	0	0	115.6	A43 S49	A43-G47 WeakPolarHBondContact O-CA 3.45Å; A43-G47 PolarHBondContact O-N 2.83Å; G47-S49 PolarHBondContact O-N 2.95Å
48	E	67.2	Low	87.7	Confident	183 Å²	183	79.5 Å²	79.5	86%	0.855	46%	0.463	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.6	17.4	176.4	-70.1	-164.4	169.8	0	0	114.1
49	S	54.1	Low	86.8	Confident	143 Å²	143	86.4 Å²	86.4	100%	1	50%	0.502	S	S	*	.			trans	-90	0	-177.1	-176	0	0	0	0	115.4	G47	G47-S49 PolarHBondContact O-N 2.95Å

Retrieved 49 of 49 residues in 53.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).