A0A075BRI2_HUMAN Loading...

Methyl CpG binding protein 2

AlphaFold DB , UniProt , Accession A0A075BRI2, Species HUMAN (Homo sapiens, Human), Gene MECP2, Length 54 aa.

						>A0A075BRI2_HUMAN|A0A075BRI2|MECP2
PAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	P	44.5	Very low	54.9	Low	177 Å²	177	110.5 Å²	110.5	100%	1.149	69%	0.687	S	S	*	*				0	106	0	29.2	-13.3	0	0	0	111.7	K3	P1-K3 PolarHBondContact O-N 3.23Å
2	A	44.8	Very low	55.4	Low	95 Å²	95	105.6 Å²	105.6	79%	0.785	67%	0.666	S	S	*	*			trans	-64.8	125	178.3	0	0	0	0	0	110.5	T4	A2-T4 PolarHBondContact O-N 2.95Å; A2-T4 VanDerWaalsContact O-N 3.1Å
3	K	56.4	Low	55.8	Low	209 Å²	209	102.8 Å²	102.8	91%	0.909	65%	0.647	S	S	*	*			trans	-77.2	88.8	171.9	-74.7	178.6	175.1	176.5	0	108.5	P1 Q5	P1-K3 PolarHBondContact O-N 3.23Å; K3-Q5 PolarHBondContact O-N 3.31Å
4	T	53.7	Low	56.3	Low	117 Å²	117	99.4 Å²	99.4	72%	0.718	63%	0.634	S	S	*	*			trans	-73.6	94.7	173.6	-57.5	0	0	0	0	110	A2	A2-T4 PolarHBondContact O-N 2.95Å; A2-T4 VanDerWaalsContact O-N 3.1Å
5	Q	53.5	Low	56.6	Low	134 Å²	134	96.3 Å²	96.3	63%	0.626	62%	0.621	S	S	*	*			trans	42.1	125.7	142.5	-67.1	-177.5	-28	0	0	121.3	K3 A7	K3-Q5 PolarHBondContact O-N 3.31Å; Q5-A7 PolarHBondContact O-N 3.07Å; Q5-A7 HydrophobicContact CB-CB 4.1Å
6	P	58.8	Low	57	Low	110 Å²	110	97.6 Å²	97.6	71%	0.714	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.7	-2.8	163.2	31.3	-33.5	0	0	0	113.8	V8 A9 T10	P6-V8 VanDerWaalsContact C-N 3.29Å; P6-V8 PolarHBondContact O-N 3.23Å; P6-A9 PolarHBondContact O-N 3.18Å; P6-T10 PolarHBondContact O-N 3.04Å; P6-T10 PolarHBondContact O-OG1 2.8Å
7	A	55.7	Low	57.4	Low	50 Å²	50	101.6 Å²	101.6	41%	0.413	62%	0.622	S	S	.	*	H	α-helix	trans	-63.2	-29.6	-173.1	0	0	0	0	0	113.9	Q5 T10 A11	Q5-A7 PolarHBondContact O-N 3.07Å; Q5-A7 HydrophobicContact CB-CB 4.1Å; A7-T10 PolarHBondContact O-N 3.13Å; A7-A11 WeakPolarHBondContact O-CB 3.49Å; A7-A11 PolarHBondContact O-N 2.78Å
8	V	58.7	Low	57.6	Low	106 Å²	106	106.1 Å²	106.1	64%	0.642	63%	0.627	S	S	*	*	H	α-helix	trans	-68.8	-37.1	179.5	-170.5	0	0	0	0	111.2	P6 A11 A12	P6-V8 VanDerWaalsContact C-N 3.29Å; P6-V8 PolarHBondContact O-N 3.23Å; V8-A11 PolarHBondContact O-N 2.87Å; V8-A12 WeakPolarHBondContact O-CB 3.13Å; V8-A12 PolarHBondContact O-N 3.26Å
9	A	58.9	Low	58	Low	66 Å²	66	108.4 Å²	108.4	55%	0.545	63%	0.629	S	S	.	*	H	α-helix	trans	-70.7	-35.2	176.6	0	0	0	0	0	112	P6 T13	P6-A9 PolarHBondContact O-N 3.18Å; A9-T13 WeakPolarHBondContact O-CG2 3.25Å; A9-T13 PolarHBondContact O-N 2.64Å; A9-T13 VanDerWaalsContact O-N 3.13Å; A9-T13 PolarHBondContact O-OG1 2.75Å
10	T	58.4	Low	58.1	Low	91 Å²	91	110 Å²	110	56%	0.558	63%	0.629	S	S	*	*	H	α-helix	trans	-70.6	-37.2	174.8	-50	0	0	0	0	112	P6 A7 T13 A14	P6-T10 PolarHBondContact O-N 3.04Å; P6-T10 PolarHBondContact O-OG1 2.8Å; A7-T10 PolarHBondContact O-N 3.13Å; T10-T13 WeakPolarHBondContact CA-OG1 3.18Å; T10-T13 PolarHBondContact O-OG1 2.82Å; T10-T13 VanDerWaalsContact O-OG1 3.08Å; T10-A14 WeakPolarHBondContact O-CB 3.34Å; T10-A14 PolarHBondContact O-N 3.28Å
11	A	60.6	Low	58.3	Low	60 Å²	60	114.8 Å²	114.8	50%	0.496	64%	0.637	S	S	.	*	H	α-helix	trans	-69	-40	176.2	0	0	0	0	0	112.4	A7 V8 A14 A15	A7-A11 WeakPolarHBondContact O-CB 3.49Å; A7-A11 PolarHBondContact O-N 2.78Å; V8-A11 PolarHBondContact O-N 2.87Å; A11-A14 PolarHBondContact O-N 3.46Å; A11-A15 WeakPolarHBondContact O-CB 3.4Å; A11-A15 PolarHBondContact O-N 2.79Å; A11-A15 VanDerWaalsContact O-CB 3.31Å
12	A	60.7	Low	59.2	Low	52 Å²	52	108.4 Å²	108.4	43%	0.43	60%	0.604	S	S	.	*	H	α-helix	trans	-64.2	-46.4	176.3	0	0	0	0	0	111.9	V8 A15 E16	V8-A12 WeakPolarHBondContact O-CB 3.13Å; V8-A12 PolarHBondContact O-N 3.26Å; A12-A15 PolarHBondContact O-N 3.31Å; A12-E16 PolarHBondContact O-N 2.72Å
13	T	60.8	Low	60.3	Low	70 Å²	70	112.9 Å²	112.9	43%	0.429	61%	0.608	S	S	.	*	H	α-helix	trans	-67.8	-35.5	176.7	48.5	0	0	0	0	112.9	A9 T10 K17	A9-T13 WeakPolarHBondContact O-CG2 3.25Å; A9-T13 PolarHBondContact O-N 2.64Å; A9-T13 VanDerWaalsContact O-N 3.13Å; A9-T13 PolarHBondContact O-OG1 2.75Å; T10-T13 WeakPolarHBondContact CA-OG1 3.18Å; T10-T13 PolarHBondContact O-OG1 2.82Å; T10-T13 VanDerWaalsContact O-OG1 3.08Å; T13-K17 VanDerWaalsContact O-CG 3.29Å; T13-K17 WeakPolarHBondContact O-CG 3.19Å; T13-K17 PolarHBondContact O-N 2.81Å
14	A	62.1	Low	60.7	Low	55 Å²	55	106.2 Å²	106.2	46%	0.455	60%	0.599	S	S	.	*	H	α-helix	trans	-67.3	-38.2	173.7	0	0	0	0	0	112.2	T10 A11 K17 Y18	T10-A14 WeakPolarHBondContact O-CB 3.34Å; T10-A14 PolarHBondContact O-N 3.28Å; A11-A14 PolarHBondContact O-N 3.46Å; A14-K17 PolarHBondContact O-N 2.9Å; A14-Y18 PolarHBondContact O-N 2.89Å; A14-Y18 VanDerWaalsContact O-N 3.16Å
15	A	62.1	Low	61.3	Low	53 Å²	53	108.9 Å²	108.9	44%	0.438	60%	0.604	S	S	.	*	H	α-helix	trans	-65.3	-43.5	175.1	0	0	0	0	0	111.6	A11 A12 Y18 K19	A11-A15 WeakPolarHBondContact O-CB 3.4Å; A11-A15 PolarHBondContact O-N 2.79Å; A11-A15 VanDerWaalsContact O-CB 3.31Å; A12-A15 PolarHBondContact O-N 3.31Å; A15-Y18 PolarHBondContact O-N 2.81Å; A15-K19 WeakPolarHBondContact O-CG 3.42Å; A15-K19 PolarHBondContact O-N 2.76Å
16	E	63	Low	61.9	Low	116 Å²	116	109.9 Å²	109.9	54%	0.542	60%	0.602	S	S	.	*	H	α-helix	trans	-59.1	-47	173	-90.8	176.5	108.4	0	0	112.1	A12 Y18 K19 H20	A12-E16 PolarHBondContact O-N 2.72Å; E16-Y18 PolarHBondContact O-N 3.41Å; E16-K19 PolarHBondContact O-N 3.08Å; E16-K19 VanDerWaalsContact O-N 3.11Å; E16-H20 PolarHBondContact O-CD2 2.86Å; E16-H20 PolarHBondContact O-N 3.36Å
17	K	63.1	Low	62.3	Low	167 Å²	167	114 Å²	114	73%	0.726	61%	0.608	S	S	*	*	H	α-helix	trans	-60	-30.3	178.1	-72.8	-176.5	-172.2	-160.1	0	113.4	T13 A14	T13-K17 VanDerWaalsContact O-CG 3.29Å; T13-K17 WeakPolarHBondContact O-CG 3.19Å; T13-K17 PolarHBondContact O-N 2.81Å; A14-K17 PolarHBondContact O-N 2.9Å
18	Y	61.3	Low	63	Low	182 Å²	182	117.4 Å²	117.4	71%	0.714	62%	0.62	S	S	*	*	H	α-helix	trans	-77.2	-33.8	177.4	-170.8	-101.7	0	0	0	112.6	A14 A15 E16	A14-Y18 PolarHBondContact O-N 2.89Å; A14-Y18 VanDerWaalsContact O-N 3.16Å; A15-Y18 PolarHBondContact O-N 2.81Å; E16-Y18 PolarHBondContact O-N 3.41Å
19	K	65.8	Low	63.4	Low	150 Å²	150	117.8 Å²	117.8	65%	0.652	62%	0.617	S	S	*	*	H	α-helix	trans	-68.7	-37.2	179.3	-65.4	-70.6	176.9	178.3	0	112.6	A15 E16 R21	A15-K19 WeakPolarHBondContact O-CG 3.42Å; A15-K19 PolarHBondContact O-N 2.76Å; E16-K19 PolarHBondContact O-N 3.08Å; E16-K19 VanDerWaalsContact O-N 3.11Å; K19-R21 VanDerWaalsContact C-N 3.3Å; K19-R21 PolarHBondContact O-N 2.81Å
20	H	59.8	Low	63.7	Low	139 Å²	139	120.4 Å²	120.4	64%	0.644	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.1	-4.4	-176.5	-61.9	-58.7	0	0	0	114.6	E16 G22	E16-H20 PolarHBondContact O-CD2 2.86Å; E16-H20 PolarHBondContact O-N 3.36Å; H20-G22 PolarHBondContact O-N 3.46Å
21	R	62.8	Low	64.1	Low	212 Å²	212	121.3 Å²	121.3	80%	0.8	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.3	-13.7	-179.7	-154.3	-179.1	-150.9	176.1	7.8	113.8	K19	K19-R21 VanDerWaalsContact C-N 3.3Å; K19-R21 PolarHBondContact O-N 2.81Å
22	G	62.3	Low	64.5	Low	43 Å²	43	122.8 Å²	122.8	44%	0.443	64%	0.642	S	S	.	*	T	Hydrogen-bonded Turn	trans	-122.5	-19.9	-170.5	0	0	0	0	0	116.2	H20	H20-G22 PolarHBondContact O-N 3.46Å
23	E	68.3	Low	65	Low	188 Å²	188	125.9 Å²	125.9	88%	0.879	66%	0.661	S	S	*	*	S	Bend	trans	-98.6	-14.6	-163.1	-62.9	-125.2	124.7	0	0	114.9
24	G	65.3	Low	65.8	Low	70 Å²	70	129.9 Å²	129.9	72%	0.722	68%	0.676	S	S	*	*	S	Bend	trans	-122	-16.7	-166.7	0	0	0	0	0	118.6
25	E	64.8	Low	66.5	Low	173 Å²	173	132.8 Å²	132.8	81%	0.808	69%	0.691	S	S	*	*			trans	-132.1	-2.1	-163.4	-151.6	-172.8	173.2	0	0	115.2	K27	E25-K27 PolarHBondContact O-N 2.94Å
26	R	66.9	Low	67	Low	155 Å²	155	139.1 Å²	139.1	59%	0.585	70%	0.703	S	S	*	*			trans	-80.4	76.5	174.7	-60.9	-173.4	-174.8	-163.8	0.7	109.4	D28 I29	R26-D28 WeakPolarHBondContact CA-OD1 3.33Å; R26-I29 HydrophobicContact CB-CG1 3.78Å; R26-I29 WeakPolarHBondContact O-CG1 3.29Å; R26-I29 HydrophobicContact CB-CD1 3.9Å
27	K	67.1	Low	67.6	Low	196 Å²	196	139.6 Å²	139.6	85%	0.852	72%	0.717	S	S	*	*			trans	-81.1	-5.8	167.8	-62.6	-165.7	179.9	-175.3	0	112	E25	E25-K27 PolarHBondContact O-N 2.94Å
28	D	69.7	Low	67.8	Low	122 Å²	122	138.1 Å²	138.1	65%	0.652	72%	0.716	S	S	*	*			trans	-95.7	-8.8	-175.7	37.8	-66.6	0	0	0	113.1	R26 V30	R26-D28 WeakPolarHBondContact CA-OD1 3.33Å; D28-V30 PolarHBondContact O-N 3.29Å
29	I	66.9	Low	68.3	Low	114 Å²	114	137.4 Å²	137.4	59%	0.585	71%	0.713	S	S	*	*			trans	-77.8	73.6	164.5	45.8	175	0	0	0	109.2	R26 S31	R26-I29 HydrophobicContact CB-CG1 3.78Å; R26-I29 WeakPolarHBondContact O-CG1 3.29Å; R26-I29 HydrophobicContact CB-CD1 3.9Å; I29-S31 PolarHBondContact O-N 3.16Å
30	V	65.5	Low	68.7	Low	121 Å²	121	138 Å²	138	73%	0.733	72%	0.718	S	S	*	*			trans	-62.7	88.7	159.2	-175.9	0	0	0	0	106.2	D28 S32	D28-V30 PolarHBondContact O-N 3.29Å; V30-S32 PolarHBondContact O-N 2.92Å
31	S	67.4	Low	69.4	Low	110 Å²	110	137 Å²	137	77%	0.769	71%	0.713	S	S	*	*			trans	-59.9	92.8	159.4	-85	0	0	0	0	105.3	I29 S33	I29-S31 PolarHBondContact O-N 3.16Å; S31-S33 VanDerWaalsContact C-N 3.26Å; S31-S33 PolarHBondContact O-N 3.46Å
32	S	68.4	Low	70.3	Confident	90 Å²	90	132.5 Å²	132.5	63%	0.629	71%	0.712	S	S	*	*			trans	-63.4	93.6	179.2	63.8	0	0	0	0	107.2	V30 M34	V30-S32 PolarHBondContact O-N 2.92Å; S32-M34 PolarHBondContact O-N 3.44Å
33	S	72.1	Confident	71	Confident	117 Å²	117	136.7 Å²	136.7	82%	0.818	73%	0.728	S	S	*	*			trans	-73.7	-7.1	174.5	57.5	0	0	0	0	111.8	S31	S31-S33 VanDerWaalsContact C-N 3.26Å; S31-S33 PolarHBondContact O-N 3.46Å
34	M	77.7	Confident	71.4	Confident	154 Å²	154	132.2 Å²	132.2	76%	0.759	71%	0.71	S	S	*	*	S	Bend	trans	-74.4	124.2	173.2	-64.9	-146	-79.7	0	0	109.3	S32 R36	S32-M34 PolarHBondContact O-N 3.44Å; M34-R36 PolarHBondContact O-N 3.18Å
35	P	75.7	Confident	72.2	Confident	116 Å²	116	134.3 Å²	134.3	75%	0.753	71%	0.714	S	S	*	*	P	Polyproline II helix	trans	-55	134.6	171.6	22.7	-30.5	0	0	0	108	P37	P35-P37 WeakPolarHBondContact O-CD 3.42Å
36	R	74.1	Confident	73.1	Confident	186 Å²	186	135.2 Å²	135.2	70%	0.702	71%	0.71	S	S	*	*	P	Polyproline II helix	trans	-54	117.9	177	-67.3	-172.7	-178.4	-164.5	1.3	106.8	M34 N38	M34-R36 PolarHBondContact O-N 3.18Å; R36-N38 PolarHBondContact O-N 3.26Å
37	P	74.2	Confident	73.7	Confident	127 Å²	127	133.6 Å²	133.6	83%	0.825	72%	0.717	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.8	113.5	-178.9	22.5	-30.3	0	0	0	106.6	P35 R39	P35-P37 WeakPolarHBondContact O-CD 3.42Å; P37-R39 PolarHBondContact O-N 3.04Å
38	N	67.6	Low	74.3	Confident	135 Å²	135	129.8 Å²	129.8	72%	0.722	71%	0.713	S	S	*	*	T	Hydrogen-bonded Turn	trans	30.4	84.2	179.5	-142.6	-15.4	0	0	0	113.3	R36 E40	R36-N38 PolarHBondContact O-N 3.26Å; N38-E40 PolarHBondContact O-N 3.19Å
39	R	71.1	Confident	74.8	Confident	168 Å²	168	130.5 Å²	130.5	63%	0.634	72%	0.721	S	S	*	*			trans	-65	86.8	159.3	179.5	179.3	172	138.1	4.9	105.7	P37 E41	P37-R39 PolarHBondContact O-N 3.04Å; R39-E41 PolarHBondContact NE-OE1 3.11Å; R39-E41 PolarHBondContact O-N 3.04Å; R39-E41 IonicContact NH2-OE1 3.74Å; R39-E41 IonicContact NE-OE1 2.82Å; R39-E41 IonicContact CZ-OE1 3.69Å
40	E	74.3	Confident	75.2	Confident	163 Å²	163	130.3 Å²	130.3	76%	0.762	73%	0.726	S	S	*	*			trans	-58.7	93.8	166.7	32.8	-170	73.1	0	0	105.6	N38	N38-E40 PolarHBondContact O-N 3.19Å
41	E	75.8	Confident	75.9	Confident	117 Å²	117	132.7 Å²	132.7	55%	0.547	73%	0.729	S	S	.	*			trans	-50.2	136.8	162.6	-71.4	-68.7	107	0	0	105.8	R39 V43	R39-E41 PolarHBondContact NE-OE1 3.11Å; R39-E41 PolarHBondContact O-N 3.04Å; R39-E41 IonicContact NH2-OE1 3.74Å; R39-E41 IonicContact NE-OE1 2.82Å; R39-E41 IonicContact CZ-OE1 3.69Å; E41-V43 PolarHBondContact O-N 3.29Å
42	P	80.4	Confident	76.3	Confident	118 Å²	118	138 Å²	138	77%	0.766	73%	0.732	S	S	*	*			trans	-52.2	106.5	-179.7	-21.7	30.6	0	0	0	107.6	D44	P42-D44 VanDerWaalsContact C-N 3.31Å; P42-D44 PolarHBondContact O-N 3.35Å
43	V	76.8	Confident	76.5	Confident	130 Å²	130	139.7 Å²	139.7	79%	0.788	74%	0.738	S	S	*	*			trans	-65.2	106.5	175.9	171.3	0	0	0	0	103.5	E41 S45	E41-V43 PolarHBondContact O-N 3.29Å; V43-S45 VanDerWaalsContact C-N 3.28Å; V43-S45 PolarHBondContact O-N 3.02Å
44	D	77.6	Confident	76.5	Confident	94 Å²	94	142.9 Å²	142.9	50%	0.503	76%	0.761	S	S	.	*			trans	-63.7	96.3	-180	-170.2	-5.8	0	0	0	107.6	P42 R46	P42-D44 VanDerWaalsContact C-N 3.31Å; P42-D44 PolarHBondContact O-N 3.35Å; D44-R46 VanDerWaalsContact CG-NE 3.35Å; D44-R46 PolarHBondContact OD2-NH2 2.95Å; D44-R46 IonicContact OD2-NH2 2.64Å; D44-R46 VanDerWaalsContact OD2-NE 3.13Å; D44-R46 PolarHBondContact OD2-NE 3.39Å; D44-R46 IonicContact OD2-NE 3.13Å; D44-R46 VanDerWaalsContact OD2-CZ 3.25Å; D44-R46 IonicContact OD2-CZ 3.25Å; D44-R46 IonicContact OD1-NH2 3.81Å; D44-R46 PolarHBondContact OD1-NE 3.27Å; D44-R46 IonicContact OD1-NE 2.78Å; D44-R46 PolarHBondContact OD1-N 3.39Å; D44-R46 IonicContact OD1-CZ 3.7Å; D44-R46 WeakPolarHBondContact OD1-CG 3.45Å; D44-R46 WeakPolarHBondContact OD1-CD 3.31Å; D44-R46 WeakPolarHBondContact OD1-CB 3.44Å; D44-R46 VanDerWaalsContact OD1-CB 3.25Å; D44-R46 PolarHBondContact O-N 3.23Å
45	S	82.3	Confident	76.4	Confident	115 Å²	115	142.3 Å²	142.3	80%	0.804	76%	0.761	S	S	*	*			trans	-79.2	5.3	-176.4	59.4	0	0	0	0	112.3	V43 T47	V43-S45 VanDerWaalsContact C-N 3.28Å; V43-S45 PolarHBondContact O-N 3.02Å; S45-T47 PolarHBondContact O-N 3.37Å
46	R	84.5	Confident	76.4	Confident	191 Å²	191	143.7 Å²	143.7	72%	0.721	76%	0.761	S	S	*	*	P	Polyproline II helix	trans	-64	123.4	176	-67.4	-177.9	-68.4	159.9	-4.4	108.6	D44	D44-R46 VanDerWaalsContact CG-NE 3.35Å; D44-R46 PolarHBondContact OD2-NH2 2.95Å; D44-R46 IonicContact OD2-NH2 2.64Å; D44-R46 VanDerWaalsContact OD2-NE 3.13Å; D44-R46 PolarHBondContact OD2-NE 3.39Å; D44-R46 IonicContact OD2-NE 3.13Å; D44-R46 VanDerWaalsContact OD2-CZ 3.25Å; D44-R46 IonicContact OD2-CZ 3.25Å; D44-R46 IonicContact OD1-NH2 3.81Å; D44-R46 PolarHBondContact OD1-NE 3.27Å; D44-R46 IonicContact OD1-NE 2.78Å; D44-R46 PolarHBondContact OD1-N 3.39Å; D44-R46 IonicContact OD1-CZ 3.7Å; D44-R46 WeakPolarHBondContact OD1-CG 3.45Å; D44-R46 WeakPolarHBondContact OD1-CD 3.31Å; D44-R46 WeakPolarHBondContact OD1-CB 3.44Å; D44-R46 VanDerWaalsContact OD1-CB 3.25Å; D44-R46 PolarHBondContact O-N 3.23Å
47	T	78	Confident	76.6	Confident	121 Å²	121	141.3 Å²	141.3	74%	0.742	76%	0.764	S	S	*	*	P	Polyproline II helix	trans	-55.4	128.2	164.5	40.9	0	0	0	0	108.1	S45 V49	S45-T47 PolarHBondContact O-N 3.37Å; T47-V49 PolarHBondContact O-N 3.24Å
48	P	79.8	Confident	76.7	Confident	116 Å²	116	142.2 Å²	142.2	75%	0.753	76%	0.761	S	S	*	*	P	Polyproline II helix	trans	-59.9	119.1	-179.7	23.3	-32	0	0	0	108.2	T50	P48-T50 PolarHBondContact O-N 3.13Å
49	V	81.3	Confident	77.3	Confident	137 Å²	137	142.6 Å²	142.6	83%	0.83	76%	0.763	S	S	*	*			trans	-70.9	106.5	174.3	-179.6	0	0	0	0	106.1	T47 E51	T47-V49 PolarHBondContact O-N 3.24Å; V49-E51 PolarHBondContact O-N 3.03Å
50	T	75.4	Confident	77.7	Confident	111 Å²	111	140.9 Å²	140.9	68%	0.681	77%	0.772	S	S	*	*			trans	-72.6	108.3	167.2	49.8	0	0	0	0	107.2	P48 R52	P48-T50 PolarHBondContact O-N 3.13Å; T50-R52 PolarHBondContact O-N 2.98Å
51	E	80.6	Confident	77.9	Confident	171 Å²	171	139.4 Å²	139.4	80%	0.799	77%	0.772	S	S	*	*			trans	-61.6	104.3	171	-153.3	-173.5	122.9	0	0	107.4	V49 V53	V49-E51 PolarHBondContact O-N 3.03Å; E51-V53 PolarHBondContact O-N 3.43Å
52	R	74.9	Confident	78.1	Confident	220 Å²	220	141.1 Å²	141.1	83%	0.83	79%	0.79	S	S	*	*			trans	-87.2	93.3	172.6	-73	-172.3	-76	177	-3.1	107.2	T50 S54	T50-R52 PolarHBondContact O-N 2.98Å; R52-S54 PolarHBondContact O-N 3.1Å
53	V	72.9	Confident	77.9	Confident	126 Å²	126	143 Å²	143	76%	0.764	79%	0.792	S	S	*	*			trans	-59.7	117.6	167.2	-172.4	0	0	0	0	107.1	E51	E51-V53 PolarHBondContact O-N 3.43Å
54	S	71.1	Confident	78	Confident	184 Å²	184	144.2 Å²	144.2	100%	1.287	79%	0.792	S	S	*	*			trans	-90.9	0	174.1	-65	0	0	0	0	111.2	R52	R52-S54 PolarHBondContact O-N 3.1Å

Retrieved 54 of 54 residues in 26.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).