A0A075DCI0_MOUSE Loading...

ATP synthase complex subunit 8

AlphaFold DB , UniProt , Accession A0A075DCI0, Species MOUSE (Mus musculus, Mouse), Gene ATP8, Length 67 aa.

						>A0A075DCI0_MOUSE|A0A075DCI0|ATP8
MPQLDTSTWFITIVSSMITLFILFQLKISSQTFPLAPSPKSLTTMKVKTPWESKWTKIYLPHSLPQQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	55.7	Low	74.8	Confident	178 Å²	178	122.1 Å²	122.1	88%	0.877	64%	0.639	S	S	*	*				0	127.1	0	-98	168.2	136.6	0	107.4	Q3 L4	M1-Q3 PolarHBondContact O-N 2.99Å; M1-L4 WeakPolarHBondContact O-CB 3.12Å; M1-L4 PolarHBondContact O-N 2.9Å
2	P	64.8	Low	76.2	Confident	119 Å²	119	118.7 Å²	118.7	77%	0.773	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66	-8.2	-174.5	26.6	-34.6	0	0	114.3
3	Q	60.2	Low	77.4	Confident	144 Å²	144	116.6 Å²	116.6	67%	0.673	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.4	-15.6	172.8	-70	173.1	-25.8	0	113.4	M1 D5	M1-Q3 PolarHBondContact O-N 2.99Å; Q3-D5 VanDerWaalsContact C-N 3.29Å
4	L	68.9	Low	78.7	Confident	134 Å²	134	112.3 Å²	112.3	70%	0.702	60%	0.595	S	S	*	*	S	Bend	trans	-81	-11.1	178.6	-118	78.3	0	0	112.7	M1 T6	M1-L4 WeakPolarHBondContact O-CB 3.12Å; M1-L4 PolarHBondContact O-N 2.9Å; L4-T6 VanDerWaalsContact C-N 3.3Å; L4-T6 PolarHBondContact O-N 2.79Å
5	D	72.8	Confident	79.7	Confident	95 Å²	95	109.2 Å²	109.2	51%	0.508	59%	0.586	S	S	.	*			trans	-78.3	80.5	176.8	-61	-48.6	0	0	109.5	Q3 S7	Q3-D5 VanDerWaalsContact C-N 3.29Å; D5-S7 PolarHBondContact O-N 2.88Å
6	T	74	Confident	80.6	Confident	95 Å²	95	106.5 Å²	106.5	58%	0.583	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.2	-12.7	-176.1	54.8	0	0	0	114	L4 T8 W9	L4-T6 VanDerWaalsContact C-N 3.3Å; L4-T6 PolarHBondContact O-N 2.79Å; T6-T8 PolarHBondContact O-N 2.94Å; T6-W9 WeakPolarHBondContact O-CB 3.22Å; T6-W9 PolarHBondContact O-N 3.03Å
7	S	78.3	Confident	81.6	Confident	93 Å²	93	107.7 Å²	107.7	65%	0.65	58%	0.581	S	S	*	*	H	α-helix	trans	-61	-34	177.4	54.8	0	0	0	112.3	D5 W9	D5-S7 PolarHBondContact O-N 2.88Å; S7-W9 VanDerWaalsContact C-N 3.32Å
8	T	83.9	Confident	82.4	Confident	75 Å²	75	106.9 Å²	106.9	46%	0.46	58%	0.575	S	S	.	*	H	α-helix	trans	-75.8	-23.4	179.7	-40	0	0	0	112.2	T6 F10 I11 T12	T6-T8 PolarHBondContact O-N 2.94Å; T8-F10 VanDerWaalsContact C-N 3.32Å; T8-F10 PolarHBondContact O-N 3.37Å; T8-I11 PolarHBondContact O-N 3.32Å; T8-T12 PolarHBondContact O-N 3.09Å; T8-T12 PolarHBondContact O-OG1 3.1Å
9	W	86.1	Confident	83.1	Confident	141 Å²	141	105.3 Å²	105.3	53%	0.534	57%	0.57	S	S	.	*	H	α-helix	trans	-62.9	-38.2	-171.9	-70.9	27.3	0	0	112.3	T6 S7 I11 T12 I13	T6-W9 WeakPolarHBondContact O-CB 3.22Å; T6-W9 PolarHBondContact O-N 3.03Å; S7-W9 VanDerWaalsContact C-N 3.32Å; W9-I11 PolarHBondContact O-N 2.96Å; W9-T12 PolarHBondContact O-N 2.97Å; W9-I13 WeakPolarHBondContact O-CB 3.34Å; W9-I13 WeakPolarHBondContact O-CD1 3.16Å; W9-I13 WeakPolarHBondContact O-CG1 3.49Å; W9-I13 PolarHBondContact O-N 3.07Å
10	F	87.3	Confident	83.7	Confident	154 Å²	154	104.9 Å²	104.9	68%	0.675	57%	0.567	S	S	*	*	H	α-helix	trans	-58.9	-48	177.4	179.7	-103.3	0	0	111.6	T8 T12 I13 V14	T8-F10 VanDerWaalsContact C-N 3.32Å; T8-F10 PolarHBondContact O-N 3.37Å; F10-T12 PolarHBondContact O-N 2.92Å; F10-I13 PolarHBondContact O-N 3.26Å; F10-V14 HydrophobicContact CE1-CG2 4.23Å; F10-V14 HydrophobicContact CE2-CG2 4.16Å; F10-V14 HydrophobicContact CZ-CG2 4Å; F10-V14 WeakPolarHBondContact O-CG2 3.27Å; F10-V14 PolarHBondContact O-N 2.94Å
11	I	90.4	Very high	84.3	Confident	115 Å²	115	106 Å²	106	59%	0.59	57%	0.566	S	S	*	*	H	α-helix	trans	-65.6	-41.6	179.1	-63.5	167.2	0	0	110.2	T8 W9 V14 S15	T8-I11 PolarHBondContact O-N 3.32Å; W9-I11 PolarHBondContact O-N 2.96Å; I11-V14 PolarHBondContact O-N 3.18Å; I11-S15 WeakPolarHBondContact O-CB 3.36Å; I11-S15 PolarHBondContact O-N 3.22Å
12	T	91.8	Very high	86.2	Confident	81 Å²	81	102.4 Å²	102.4	50%	0.497	55%	0.55	S	S	.	*	H	α-helix	trans	-63.3	-42.7	177.3	-53.1	0	0	0	112.2	T8 W9 F10 S16	T8-T12 PolarHBondContact O-N 3.09Å; T8-T12 PolarHBondContact O-OG1 3.1Å; W9-T12 PolarHBondContact O-N 2.97Å; F10-T12 PolarHBondContact O-N 2.92Å; T12-S16 VanDerWaalsContact O-CB 3.29Å; T12-S16 WeakPolarHBondContact O-CB 3.34Å; T12-S16 PolarHBondContact O-N 2.79Å; T12-S16 PolarHBondContact O-OG 2.6Å
13	I	92.3	Very high	87.6	Confident	92 Å²	92	101.8 Å²	101.8	47%	0.472	54%	0.539	S	S	.	.	H	α-helix	trans	-65	-48.1	177.8	-68.6	163.5	0	0	110.3	W9 F10 S15 S16 M17	W9-I13 WeakPolarHBondContact O-CB 3.34Å; W9-I13 WeakPolarHBondContact O-CD1 3.16Å; W9-I13 WeakPolarHBondContact O-CG1 3.49Å; W9-I13 PolarHBondContact O-N 3.07Å; F10-I13 PolarHBondContact O-N 3.26Å; I13-S15 PolarHBondContact O-N 2.88Å; I13-S16 WeakPolarHBondContact CA-OG 3.21Å; I13-S16 PolarHBondContact O-N 3.4Å; I13-S16 PolarHBondContact O-OG 2.76Å; I13-M17 HydrophobicContact CG2-SD 4.33Å; I13-M17 WeakPolarHBondContact O-CB 3.47Å; I13-M17 WeakPolarHBondContact O-CG 3.19Å; I13-M17 PolarHBondContact O-N 2.89Å
14	V	95.2	Very high	89.2	Confident	56 Å²	56	100.7 Å²	100.7	34%	0.339	53%	0.533	S	S	.	.	H	α-helix	trans	-63.1	-44.8	178.1	173.2	0	0	0	111.3	F10 I11 S16 M17 I18	F10-V14 HydrophobicContact CE1-CG2 4.23Å; F10-V14 HydrophobicContact CE2-CG2 4.16Å; F10-V14 HydrophobicContact CZ-CG2 4Å; F10-V14 WeakPolarHBondContact O-CG2 3.27Å; F10-V14 PolarHBondContact O-N 2.94Å; I11-V14 PolarHBondContact O-N 3.18Å; V14-S16 PolarHBondContact O-N 2.9Å; V14-M17 PolarHBondContact O-N 2.73Å; V14-I18 HydrophobicContact CG1-CD1 3.81Å; V14-I18 HydrophobicContact CG1-CG1 4.49Å; V14-I18 WeakPolarHBondContact O-CG1 3.44Å; V14-I18 PolarHBondContact O-N 2.78Å
15	S	93.9	Very high	90.2	Very high	66 Å²	66	98.6 Å²	98.6	46%	0.462	52%	0.519	S	S	.	.	H	α-helix	trans	-61.4	-43.7	178.2	-179.1	0	0	0	112.3	I11 I13 I18 T19	I11-S15 WeakPolarHBondContact O-CB 3.36Å; I11-S15 PolarHBondContact O-N 3.22Å; I13-S15 PolarHBondContact O-N 2.88Å; S15-I18 PolarHBondContact O-N 2.62Å; S15-T19 WeakPolarHBondContact O-CB 3.41Å; S15-T19 PolarHBondContact O-N 2.67Å; S15-T19 PolarHBondContact O-OG1 2.68Å
16	S	94.6	Very high	91	Very high	66 Å²	66	99.4 Å²	99.4	46%	0.462	52%	0.523	S	S	.	.	H	α-helix	trans	-67.9	-39.4	176.8	59.3	0	0	0	112.6	T12 I13 V14 T19 L20	T12-S16 VanDerWaalsContact O-CB 3.29Å; T12-S16 WeakPolarHBondContact O-CB 3.34Å; T12-S16 PolarHBondContact O-N 2.79Å; T12-S16 PolarHBondContact O-OG 2.6Å; I13-S16 WeakPolarHBondContact CA-OG 3.21Å; I13-S16 PolarHBondContact O-N 3.4Å; I13-S16 PolarHBondContact O-OG 2.76Å; V14-S16 PolarHBondContact O-N 2.9Å; S16-T19 PolarHBondContact O-N 2.82Å; S16-L20 VanDerWaalsContact O-CB 3.31Å; S16-L20 WeakPolarHBondContact O-CB 3.43Å; S16-L20 PolarHBondContact O-N 2.6Å
17	M	96.7	Very high	91.6	Very high	127 Å²	127	102.4 Å²	102.4	63%	0.626	53%	0.528	S	S	*	.	H	α-helix	trans	-61.5	-45.9	174.1	-79.9	-175.4	67.5	0	112.5	I13 V14 L20 F21	I13-M17 HydrophobicContact CG2-SD 4.33Å; I13-M17 WeakPolarHBondContact O-CB 3.47Å; I13-M17 WeakPolarHBondContact O-CG 3.19Å; I13-M17 PolarHBondContact O-N 2.89Å; V14-M17 PolarHBondContact O-N 2.73Å; M17-L20 PolarHBondContact O-N 2.77Å; M17-F21 VanDerWaalsContact O-CB 3.29Å; M17-F21 WeakPolarHBondContact O-CB 3.41Å; M17-F21 PolarHBondContact O-N 3.17Å
18	I	96.6	Very high	92.1	Very high	93 Å²	93	102.2 Å²	102.2	48%	0.477	52%	0.519	S	S	.	.	H	α-helix	trans	-63	-45.8	179	-68.3	167.2	0	0	110.4	V14 S15 L20 F21 I22	V14-I18 HydrophobicContact CG1-CD1 3.81Å; V14-I18 HydrophobicContact CG1-CG1 4.49Å; V14-I18 WeakPolarHBondContact O-CG1 3.44Å; V14-I18 PolarHBondContact O-N 2.78Å; S15-I18 PolarHBondContact O-N 2.62Å; I18-L20 VanDerWaalsContact C-N 3.34Å; I18-L20 PolarHBondContact O-N 2.55Å; I18-F21 PolarHBondContact O-N 3Å; I18-I22 HydrophobicContact CG2-CD1 3.79Å; I18-I22 HydrophobicContact CG2-CG1 4.48Å; I18-I22 WeakPolarHBondContact O-CG1 3.28Å; I18-I22 PolarHBondContact O-N 3.44Å
19	T	95.9	Very high	92.2	Very high	77 Å²	77	103.7 Å²	103.7	47%	0.472	53%	0.532	S	S	.	.	H	α-helix	trans	-58.4	-48	178.3	-57.6	0	0	0	110.9	S15 S16 I22 L23	S15-T19 WeakPolarHBondContact O-CB 3.41Å; S15-T19 PolarHBondContact O-N 2.67Å; S15-T19 PolarHBondContact O-OG1 2.68Å; S16-T19 PolarHBondContact O-N 2.82Å; T19-I22 PolarHBondContact O-N 2.87Å; T19-L23 HydrophobicContact CG2-CD1 4.35Å; T19-L23 WeakPolarHBondContact O-CG 3.32Å; T19-L23 PolarHBondContact O-N 3.25Å
20	L	95.3	Very high	91.9	Very high	96 Å²	96	101 Å²	101	50%	0.503	54%	0.535	S	S	.	.	H	α-helix	trans	-64.3	-42	179.4	-169.4	62.6	0	0	111.7	S16 M17 I18 I22 L23 F24	S16-L20 VanDerWaalsContact O-CB 3.31Å; S16-L20 WeakPolarHBondContact O-CB 3.43Å; S16-L20 PolarHBondContact O-N 2.6Å; M17-L20 PolarHBondContact O-N 2.77Å; I18-L20 VanDerWaalsContact C-N 3.34Å; I18-L20 PolarHBondContact O-N 2.55Å; L20-I22 PolarHBondContact O-N 3.14Å; L20-L23 PolarHBondContact O-N 3.11Å; L20-F24 HydrophobicContact CD1-CD2 3.89Å; L20-F24 HydrophobicContact CD1-CE2 3.42Å; L20-F24 VanDerWaalsContact CD1-CE2 3.42Å; L20-F24 HydrophobicContact CD1-CZ 4.34Å; L20-F24 HydrophobicContact CD2-CE2 4.05Å; L20-F24 HydrophobicContact CG-CD2 3.73Å; L20-F24 HydrophobicContact CG-CE2 3.52Å; L20-F24 WeakPolarHBondContact O-CD2 3.41Å; L20-F24 PolarHBondContact O-N 3.44Å
21	F	95.8	Very high	91.6	Very high	128 Å²	128	99.4 Å²	99.4	56%	0.561	53%	0.53	S	S	*	.	H	α-helix	trans	-59.5	-47.2	177.4	-178.6	-101.7	0	0	112	M17 I18 L23 F24 Q25	M17-F21 VanDerWaalsContact O-CB 3.29Å; M17-F21 WeakPolarHBondContact O-CB 3.41Å; M17-F21 PolarHBondContact O-N 3.17Å; I18-F21 PolarHBondContact O-N 3Å; F21-L23 PolarHBondContact O-N 3.33Å; F21-F24 PolarHBondContact O-N 3.39Å; F21-Q25 HydrophobicContact CD1-CG 4.01Å; F21-Q25 HydrophobicContact CD2-CG 4.36Å; F21-Q25 HydrophobicContact CE1-CG 3.72Å; F21-Q25 HydrophobicContact CE2-CG 4.1Å; F21-Q25 VanDerWaalsContact CE2-NE2 3.25Å; F21-Q25 HydrophobicContact CG-CG 4.33Å; F21-Q25 HydrophobicContact CZ-CG 3.77Å; F21-Q25 WeakPolarHBondContact O-CB 3.31Å; F21-Q25 VanDerWaalsContact O-CG 3.23Å; F21-Q25 WeakPolarHBondContact O-CG 3.23Å; F21-Q25 PolarHBondContact O-N 3.11Å
22	I	95.4	Very high	91	Very high	104 Å²	104	100.4 Å²	100.4	53%	0.533	54%	0.541	S	S	.	.	H	α-helix	trans	-61.9	-43.3	179.4	-66.2	166.4	0	0	111.1	I18 T19 L20 F24 Q25 L26	I18-I22 HydrophobicContact CG2-CD1 3.79Å; I18-I22 HydrophobicContact CG2-CG1 4.48Å; I18-I22 WeakPolarHBondContact O-CG1 3.28Å; I18-I22 PolarHBondContact O-N 3.44Å; T19-I22 PolarHBondContact O-N 2.87Å; L20-I22 PolarHBondContact O-N 3.14Å; I22-F24 PolarHBondContact O-N 2.92Å; I22-Q25 PolarHBondContact O-N 3.33Å; I22-L26 PolarHBondContact O-N 2.88Å; I22-L26 VanDerWaalsContact O-N 3.07Å
23	L	94.6	Very high	90.1	Very high	105 Å²	105	103.1 Å²	103.1	55%	0.55	55%	0.547	S	S	.	.	H	α-helix	trans	-62	-44	178.2	-71	172.5	0	0	112.1	T19 L20 F21 K27	T19-L23 HydrophobicContact CG2-CD1 4.35Å; T19-L23 WeakPolarHBondContact O-CG 3.32Å; T19-L23 PolarHBondContact O-N 3.25Å; L20-L23 PolarHBondContact O-N 3.11Å; F21-L23 PolarHBondContact O-N 3.33Å; L23-K27 WeakPolarHBondContact O-CG 3.43Å; L23-K27 PolarHBondContact O-N 3.37Å
24	F	92.9	Very high	89.2	Confident	122 Å²	122	104.4 Å²	104.4	54%	0.535	56%	0.561	S	S	.	*	H	α-helix	trans	-67.5	-43.4	177	-82.5	-64.1	0	0	112.5	L20 F21 I22 L26 K27 I28	L20-F24 HydrophobicContact CD1-CD2 3.89Å; L20-F24 HydrophobicContact CD1-CE2 3.42Å; L20-F24 VanDerWaalsContact CD1-CE2 3.42Å; L20-F24 HydrophobicContact CD1-CZ 4.34Å; L20-F24 HydrophobicContact CD2-CE2 4.05Å; L20-F24 HydrophobicContact CG-CD2 3.73Å; L20-F24 HydrophobicContact CG-CE2 3.52Å; L20-F24 WeakPolarHBondContact O-CD2 3.41Å; L20-F24 PolarHBondContact O-N 3.44Å; F21-F24 PolarHBondContact O-N 3.39Å; I22-F24 PolarHBondContact O-N 2.92Å; F24-L26 VanDerWaalsContact C-N 3.31Å; F24-L26 PolarHBondContact O-N 3.07Å; F24-K27 PolarHBondContact O-N 3.4Å; F24-K27 VanDerWaalsContact O-N 3.15Å; F24-I28 VanDerWaalsContact O-CG1 3.32Å; F24-I28 WeakPolarHBondContact O-CG1 3.29Å; F24-I28 PolarHBondContact O-N 3.39Å
25	Q	90	Very high	88.1	Confident	89 Å²	89	109 Å²	109	42%	0.416	58%	0.582	S	S	.	*	H	α-helix	trans	-57.9	-43.6	177.9	-74.2	-65.9	-11.6	0	111.8	F21 I22 K27 I28 S29	F21-Q25 HydrophobicContact CD1-CG 4.01Å; F21-Q25 HydrophobicContact CD2-CG 4.36Å; F21-Q25 HydrophobicContact CE1-CG 3.72Å; F21-Q25 HydrophobicContact CE2-CG 4.1Å; F21-Q25 VanDerWaalsContact CE2-NE2 3.25Å; F21-Q25 HydrophobicContact CG-CG 4.33Å; F21-Q25 HydrophobicContact CZ-CG 3.77Å; F21-Q25 WeakPolarHBondContact O-CB 3.31Å; F21-Q25 VanDerWaalsContact O-CG 3.23Å; F21-Q25 WeakPolarHBondContact O-CG 3.23Å; F21-Q25 PolarHBondContact O-N 3.11Å; I22-Q25 PolarHBondContact O-N 3.33Å; Q25-K27 VanDerWaalsContact C-N 3.32Å; Q25-K27 PolarHBondContact O-N 2.9Å; Q25-I28 PolarHBondContact O-N 3.28Å; Q25-S29 VanDerWaalsContact O-CB 3.28Å; Q25-S29 WeakPolarHBondContact O-CB 3.31Å; Q25-S29 PolarHBondContact O-N 3.5Å
26	L	89.2	Confident	86.7	Confident	112 Å²	112	109.5 Å²	109.5	59%	0.586	59%	0.591	S	S	*	*	H	α-helix	trans	-60.8	-42.1	177.3	-177.7	64	0	0	112.1	I22 F24 S30	I22-L26 PolarHBondContact O-N 2.88Å; I22-L26 VanDerWaalsContact O-N 3.07Å; F24-L26 VanDerWaalsContact C-N 3.31Å; F24-L26 PolarHBondContact O-N 3.07Å; L26-S30 WeakPolarHBondContact O-CB 3.22Å; L26-S30 PolarHBondContact O-N 3.04Å; L26-S30 VanDerWaalsContact O-N 3.11Å; L26-S30 PolarHBondContact O-OG 3.32Å
27	K	87.3	Confident	85.2	Confident	158 Å²	158	112.4 Å²	112.4	69%	0.687	61%	0.608	S	S	*	*	H	α-helix	trans	-68.1	-43.2	179.3	-71.4	-73.7	178.1	177.8	112.2	L23 F24 Q25 S30 Q31	L23-K27 WeakPolarHBondContact O-CG 3.43Å; L23-K27 PolarHBondContact O-N 3.37Å; F24-K27 PolarHBondContact O-N 3.4Å; F24-K27 VanDerWaalsContact O-N 3.15Å; Q25-K27 VanDerWaalsContact C-N 3.32Å; Q25-K27 PolarHBondContact O-N 2.9Å; K27-S30 PolarHBondContact O-N 3.36Å; K27-Q31 PolarHBondContact O-N 2.83Å
28	I	87.9	Confident	83.4	Confident	90 Å²	90	110.2 Å²	110.2	46%	0.462	61%	0.605	S	S	.	*	H	α-helix	trans	-67.3	-42.4	178.1	-65.4	165	0	0	110.5	F24 Q25 S30 Q31	F24-I28 VanDerWaalsContact O-CG1 3.32Å; F24-I28 WeakPolarHBondContact O-CG1 3.29Å; F24-I28 PolarHBondContact O-N 3.39Å; Q25-I28 PolarHBondContact O-N 3.28Å; I28-S30 VanDerWaalsContact C-N 3.29Å; I28-S30 PolarHBondContact O-N 3.15Å; I28-Q31 PolarHBondContact O-N 3.41Å; I28-Q31 VanDerWaalsContact O-N 3.14Å
29	S	86.2	Confident	81.5	Confident	105 Å²	105	111.2 Å²	111.2	73%	0.734	62%	0.618	S	S	*	*	H	α-helix	trans	-65.3	-32	178.2	-176	0	0	0	113.1	Q25 Q31	Q25-S29 VanDerWaalsContact O-CB 3.28Å; Q25-S29 WeakPolarHBondContact O-CB 3.31Å; Q25-S29 PolarHBondContact O-N 3.5Å; S29-Q31 VanDerWaalsContact C-N 3.28Å
30	S	81.2	Confident	79.6	Confident	86 Å²	86	116 Å²	116	60%	0.601	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.1	-11.6	177.6	-57.2	0	0	0	112.6	L26 K27 I28 T32	L26-S30 WeakPolarHBondContact O-CB 3.22Å; L26-S30 PolarHBondContact O-N 3.04Å; L26-S30 VanDerWaalsContact O-N 3.11Å; L26-S30 PolarHBondContact O-OG 3.32Å; K27-S30 PolarHBondContact O-N 3.36Å; I28-S30 VanDerWaalsContact C-N 3.29Å; I28-S30 PolarHBondContact O-N 3.15Å; S30-T32 PolarHBondContact O-N 3.48Å
31	Q	81	Confident	77.6	Confident	119 Å²	119	116 Å²	116	56%	0.556	64%	0.64	S	S	*	*			trans	-88.3	100.2	-179.3	-163.4	153.3	50.7	0	109.1	K27 I28 S29 F33	K27-Q31 PolarHBondContact O-N 2.83Å; I28-Q31 PolarHBondContact O-N 3.41Å; I28-Q31 VanDerWaalsContact O-N 3.14Å; S29-Q31 VanDerWaalsContact C-N 3.28Å; Q31-F33 HydrophobicContact CB-CE2 4.25Å; Q31-F33 HydrophobicContact CB-CZ 4.38Å; Q31-F33 HydrophobicContact CG-CE1 4.41Å; Q31-F33 HydrophobicContact CG-CE2 4.39Å; Q31-F33 HydrophobicContact CG-CZ 4.15Å; Q31-F33 VanDerWaalsContact O-CD2 3.31Å; Q31-F33 WeakPolarHBondContact O-CD2 3.42Å; Q31-F33 PolarHBondContact O-N 3Å
32	T	77	Confident	75.7	Confident	137 Å²	137	117.1 Å²	117.1	84%	0.84	65%	0.651	S	S	*	*			trans	-71.2	98.4	172.7	-17	0	0	0	108.4	S30	S30-T32 PolarHBondContact O-N 3.48Å
33	F	73.8	Confident	73.5	Confident	138 Å²	138	117.5 Å²	117.5	61%	0.605	66%	0.659	S	S	*	*	P	Polyproline II helix	trans	-65.9	129.9	171	-66.9	-81.8	0	0	108.3	Q31 L35	Q31-F33 HydrophobicContact CB-CE2 4.25Å; Q31-F33 HydrophobicContact CB-CZ 4.38Å; Q31-F33 HydrophobicContact CG-CE1 4.41Å; Q31-F33 HydrophobicContact CG-CE2 4.39Å; Q31-F33 HydrophobicContact CG-CZ 4.15Å; Q31-F33 VanDerWaalsContact O-CD2 3.31Å; Q31-F33 WeakPolarHBondContact O-CD2 3.42Å; Q31-F33 PolarHBondContact O-N 3Å; F33-L35 PolarHBondContact O-N 3.34Å; F33-L35 VanDerWaalsContact O-N 3.17Å
34	P	72.2	Confident	71.6	Confident	118 Å²	118	118.3 Å²	118.3	77%	0.766	67%	0.668	S	S	*	*	P	Polyproline II helix	trans	-57.1	128.2	170.6	24.8	-31.4	0	0	107.2	A36	P34-A36 PolarHBondContact O-N 3.48Å; P34-A36 VanDerWaalsContact O-N 3.11Å
35	L	71.8	Confident	69.7	Low	152 Å²	152	120.1 Å²	120.1	80%	0.796	68%	0.68	S	S	*	*	P	Polyproline II helix	trans	-50.8	125.6	172.8	-169.2	75.3	0	0	106.6	F33	F33-L35 PolarHBondContact O-N 3.34Å; F33-L35 VanDerWaalsContact O-N 3.17Å
36	A	65	Low	68.1	Low	77 Å²	77	124.1 Å²	124.1	64%	0.636	70%	0.696	S	S	*	*			trans	-45.7	132	168.5	0	0	0	0	106.4	P34 S38	P34-A36 PolarHBondContact O-N 3.48Å; P34-A36 VanDerWaalsContact O-N 3.11Å; A36-S38 PolarHBondContact O-N 2.98Å
37	P	63.3	Low	66.8	Low	128 Å²	128	123.6 Å²	123.6	83%	0.831	70%	0.697	S	S	*	*			trans	-58.2	95.5	-176.3	23.5	-32.7	0	0	107.3
38	S	58.2	Low	65.6	Low	80 Å²	80	123.7 Å²	123.7	56%	0.559	70%	0.698	S	S	*	*			trans	-59.5	128.6	170.8	178.4	0	0	0	103.4	A36 K40	A36-S38 PolarHBondContact O-N 2.98Å; S38-K40 PolarHBondContact O-N 3.4Å
39	P	58.3	Low	64.5	Low	114 Å²	114	122.6 Å²	122.6	74%	0.74	70%	0.695	S	S	*	*			trans	-56	103	166	24.1	-28.8	0	0	103.3	S41	P39-S41 PolarHBondContact O-N 3.49Å
40	K	54.3	Low	63.5	Low	179 Å²	179	123 Å²	123	78%	0.778	70%	0.695	S	S	*	*			trans	-44	116	174.3	-69.7	177.4	-179.8	176.8	102.1	S38 L42	S38-K40 PolarHBondContact O-N 3.4Å; K40-L42 PolarHBondContact O-N 2.9Å
41	S	53.4	Low	62.8	Low	95 Å²	95	126.2 Å²	126.2	66%	0.664	69%	0.694	S	S	*	*			trans	-53	110	169.1	67	0	0	0	101.1	P39 T43	P39-S41 PolarHBondContact O-N 3.49Å; S41-T43 PolarHBondContact O-N 2.92Å
42	L	57.4	Low	62.4	Low	151 Å²	151	125.9 Å²	125.9	79%	0.791	69%	0.693	S	S	*	*			trans	-66.2	78.4	167.4	-65.7	172.1	0	0	100.2	K40 T44	K40-L42 PolarHBondContact O-N 2.9Å; L42-T44 WeakPolarHBondContact O-CA 3.42Å; L42-T44 PolarHBondContact O-N 3.05Å; L42-T44 PolarHBondContact O-OG1 3.45Å
43	T	49	Very low	62	Low	113 Å²	113	122.7 Å²	122.7	69%	0.693	68%	0.676	S	S	*	*			trans	-44	109.2	156.2	33.1	0	0	0	99.8	S41 M45	S41-T43 PolarHBondContact O-N 2.92Å; T43-M45 PolarHBondContact O-N 3.5Å
44	T	54.8	Low	61.7	Low	122 Å²	122	122 Å²	122	75%	0.748	67%	0.673	S	S	*	*			trans	-65.3	77.5	-167.6	-55.1	0	0	0	104.2	L42 K46	L42-T44 WeakPolarHBondContact O-CA 3.42Å; L42-T44 PolarHBondContact O-N 3.05Å; L42-T44 PolarHBondContact O-OG1 3.45Å; T44-K46 PolarHBondContact O-N 3.4Å
45	M	53.5	Low	61.5	Low	159 Å²	159	120.7 Å²	120.7	78%	0.783	65%	0.652	S	S	*	*			trans	-57.5	100.8	148.9	-171.3	174.9	-177.5	0	98.9	T43 V47	T43-M45 PolarHBondContact O-N 3.5Å; M45-V47 HydrophobicContact CB-CG2 4.17Å; M45-V47 HydrophobicContact CG-CG2 3.92Å; M45-V47 PolarHBondContact O-N 3.01Å; M45-V47 HydrophobicContact SD-CG2 4.27Å
46	K	56.3	Low	61.5	Low	173 Å²	173	117.1 Å²	117.1	75%	0.752	64%	0.637	S	S	*	*			trans	-61.9	67.5	175.1	-157.4	-175.9	-167.2	-177.6	104.2	T44 K48	T44-K46 PolarHBondContact O-N 3.4Å; K46-K48 PolarHBondContact O-N 3.44Å
47	V	60.9	Low	61.5	Low	102 Å²	102	121.7 Å²	121.7	62%	0.618	64%	0.643	S	S	*	*			trans	-66.2	93.5	171.7	175	0	0	0	99.9	M45 T49	M45-V47 HydrophobicContact CB-CG2 4.17Å; M45-V47 HydrophobicContact CG-CG2 3.92Å; M45-V47 PolarHBondContact O-N 3.01Å; M45-V47 HydrophobicContact SD-CG2 4.27Å; V47-T49 PolarHBondContact O-N 3.5Å
48	K	62	Low	61.8	Low	160 Å²	160	120.7 Å²	120.7	70%	0.696	63%	0.629	S	S	*	*			trans	-57.7	99.7	175.1	-54.7	-174	-172.6	-177.2	102.9	K46	K46-K48 PolarHBondContact O-N 3.44Å
49	T	64.1	Low	62.1	Low	66 Å²	66	124.7 Å²	124.7	41%	0.405	63%	0.633	S	S	.	*			trans	-56.1	142.2	179	46.6	0	0	0	105.3	V47 W51 E52 S53	V47-T49 PolarHBondContact O-N 3.5Å; T49-W51 CarbonylContact O-C 3.58Å; T49-W51 PolarHBondContact O-N 3.44Å; T49-E52 PolarHBondContact O-N 3.34Å; T49-E52 WeakPolarHBondContact OG1-CG 3.42Å; T49-S53 PolarHBondContact O-N 3.17Å
50	P	66.7	Low	62.5	Low	113 Å²	113	124.3 Å²	124.3	73%	0.734	63%	0.625	S	S	*	*	H	α-helix	trans	-52.8	-24.6	179.1	16.7	-28.6	0	0	111.5	K54	P50-K54 WeakPolarHBondContact O-CB 3.45Å; P50-K54 PolarHBondContact O-N 3.45Å
51	W	66.4	Low	62.6	Low	155 Å²	155	121.2 Å²	121.2	59%	0.587	62%	0.623	S	S	*	*	H	α-helix	trans	-60.3	-53.7	169.1	-166.6	-119.3	0	0	114.9	T49 S53 K54 W55	T49-W51 CarbonylContact O-C 3.58Å; T49-W51 PolarHBondContact O-N 3.44Å; W51-S53 VanDerWaalsContact C-N 3.28Å; W51-S53 PolarHBondContact O-N 2.85Å; W51-K54 WeakPolarHBondContact O-CA 3.34Å; W51-K54 WeakPolarHBondContact O-CB 3.33Å; W51-K54 PolarHBondContact O-N 2.96Å; W51-W55 AromaticContact CD1-CD1 3.69Å; W51-W55 AromaticContact CD1-NE1 3.54Å; W51-W55 AromaticContact CD2-CD1 3.98Å; W51-W55 AromaticContact CD2-NE1 3.56Å; W51-W55 AromaticContact CE2-CD1 3.75Å; W51-W55 AromaticContact CE2-CE2 3.84Å; W51-W55 AromaticContact CE2-NE1 2.91Å; W51-W55 AromaticContact CG-CD1 3.98Å; W51-W55 AromaticContact CG-NE1 3.93Å; W51-W55 HydrophobicContact CH2-CZ2 4.13Å; W51-W55 AromaticContact CH2-NE1 4Å; W51-W55 AromaticContact CZ2-CE2 3.62Å; W51-W55 AromaticContact CZ2-CZ2 3.6Å; W51-W55 HydrophobicContact CZ2-CZ2 3.6Å; W51-W55 AromaticContact CZ2-NE1 3.18Å; W51-W55 AromaticContact NE1-CD1 3.59Å; W51-W55 AromaticContact NE1-NE1 2.93Å; W51-W55 PolarHBondContact O-N 3.19Å
52	E	71.4	Confident	62.9	Low	111 Å²	111	124.7 Å²	124.7	52%	0.519	63%	0.628	S	S	.	*	H	α-helix	trans	-59.5	-38.7	175.3	-79.4	-74.1	117.5	0	111.9	T49 W55 T56	T49-E52 PolarHBondContact O-N 3.34Å; T49-E52 WeakPolarHBondContact OG1-CG 3.42Å; E52-W55 PolarHBondContact O-N 3.18Å; E52-T56 WeakPolarHBondContact O-CB 3.46Å; E52-T56 PolarHBondContact O-N 3.38Å; E52-T56 PolarHBondContact O-OG1 3.5Å
53	S	68.4	Low	62.9	Low	70 Å²	70	122.4 Å²	122.4	49%	0.49	63%	0.625	S	S	.	*	H	α-helix	trans	-64.2	-40.1	173.8	-173.8	0	0	0	111.7	T49 W51 K57	T49-S53 PolarHBondContact O-N 3.17Å; W51-S53 VanDerWaalsContact C-N 3.28Å; W51-S53 PolarHBondContact O-N 2.85Å; S53-K57 WeakPolarHBondContact O-CB 3.38Å; S53-K57 PolarHBondContact O-N 3.3Å
54	K	68.3	Low	62.9	Low	125 Å²	125	124.2 Å²	124.2	54%	0.543	63%	0.629	S	S	.	*	H	α-helix	trans	-63.4	-44.4	174.9	-131.7	176.1	-179.2	-79.9	111.5	P50 W51 K57 I58	P50-K54 WeakPolarHBondContact O-CB 3.45Å; P50-K54 PolarHBondContact O-N 3.45Å; W51-K54 WeakPolarHBondContact O-CA 3.34Å; W51-K54 WeakPolarHBondContact O-CB 3.33Å; W51-K54 PolarHBondContact O-N 2.96Å; K54-K57 PolarHBondContact O-N 2.83Å; K54-I58 HydrophobicContact CG-CD1 4.44Å; K54-I58 WeakPolarHBondContact O-CD1 3.36Å; K54-I58 WeakPolarHBondContact O-CG1 3.38Å; K54-I58 PolarHBondContact O-N 3.02Å
55	W	69.1	Low	62.5	Low	89 Å²	89	123.5 Å²	123.5	34%	0.337	63%	0.627	S	S	.	*	H	α-helix	trans	-67	-46.1	177.6	-75.3	115.9	0	0	112.8	W51 E52 K57 I58 Y59	W51-W55 AromaticContact CD1-CD1 3.69Å; W51-W55 AromaticContact CD1-NE1 3.54Å; W51-W55 AromaticContact CD2-CD1 3.98Å; W51-W55 AromaticContact CD2-NE1 3.56Å; W51-W55 AromaticContact CE2-CD1 3.75Å; W51-W55 AromaticContact CE2-CE2 3.84Å; W51-W55 AromaticContact CE2-NE1 2.91Å; W51-W55 AromaticContact CG-CD1 3.98Å; W51-W55 AromaticContact CG-NE1 3.93Å; W51-W55 HydrophobicContact CH2-CZ2 4.13Å; W51-W55 AromaticContact CH2-NE1 4Å; W51-W55 AromaticContact CZ2-CE2 3.62Å; W51-W55 AromaticContact CZ2-CZ2 3.6Å; W51-W55 HydrophobicContact CZ2-CZ2 3.6Å; W51-W55 AromaticContact CZ2-NE1 3.18Å; W51-W55 AromaticContact NE1-CD1 3.59Å; W51-W55 AromaticContact NE1-NE1 2.93Å; W51-W55 PolarHBondContact O-N 3.19Å; E52-W55 PolarHBondContact O-N 3.18Å; W55-K57 PolarHBondContact O-N 3.29Å; W55-I58 PolarHBondContact O-N 2.98Å; W55-I58 VanDerWaalsContact O-N 3.1Å; W55-Y59 HydrophobicContact CB-CD2 4.21Å; W55-Y59 HydrophobicContact CB-CE2 4.33Å; W55-Y59 AromaticContact CD2-CE2 3.93Å; W55-Y59 HydrophobicContact CD2-CE2 3.93Å; W55-Y59 AromaticContact CE3-CD2 3.84Å; W55-Y59 HydrophobicContact CE3-CD2 3.84Å; W55-Y59 AromaticContact CE3-CE2 3.07Å; W55-Y59 HydrophobicContact CE3-CE2 3.07Å; W55-Y59 AromaticContact CE3-CZ 3.67Å; W55-Y59 HydrophobicContact CG-CE2 4.48Å; W55-Y59 AromaticContact CZ3-CE2 3.57Å; W55-Y59 HydrophobicContact CZ3-CE2 3.57Å; W55-Y59 AromaticContact CZ3-CZ 3.64Å; W55-Y59 WeakPolarHBondContact CZ3-OH 3.45Å; W55-Y59 WeakPolarHBondContact O-CB 3.16Å; W55-Y59 WeakPolarHBondContact O-CD2 3.11Å; W55-Y59 PolarHBondContact O-N 2.9Å
56	T	70.1	Confident	62.4	Low	78 Å²	78	125.2 Å²	125.2	48%	0.479	63%	0.633	S	S	.	*	H	α-helix	trans	-57.9	-38.2	174.8	-50.3	0	0	0	110.3	E52 L60	E52-T56 WeakPolarHBondContact O-CB 3.46Å; E52-T56 PolarHBondContact O-N 3.38Å; E52-T56 PolarHBondContact O-OG1 3.5Å; T56-L60 HydrophobicContact CG2-CD1 3.88Å; T56-L60 WeakPolarHBondContact O-CB 3.33Å; T56-L60 VanDerWaalsContact O-CD1 3.27Å; T56-L60 WeakPolarHBondContact O-CD1 3.29Å; T56-L60 PolarHBondContact O-N 2.84Å
57	K	65.6	Low	61.8	Low	172 Å²	172	129.2 Å²	129.2	75%	0.748	65%	0.654	S	S	*	*	H	α-helix	trans	-71.6	-30.1	177.6	-166.3	171.7	-164.1	171.4	114.2	S53 K54 W55	S53-K57 WeakPolarHBondContact O-CB 3.38Å; S53-K57 PolarHBondContact O-N 3.3Å; K54-K57 PolarHBondContact O-N 2.83Å; W55-K57 PolarHBondContact O-N 3.29Å
58	I	70.2	Confident	61.9	Low	108 Å²	108	130.6 Å²	130.6	55%	0.554	66%	0.656	S	S	*	*	H	α-helix	trans	-83.3	-36.7	179.4	-67.7	161.6	0	0	111.1	K54 W55	K54-I58 HydrophobicContact CG-CD1 4.44Å; K54-I58 WeakPolarHBondContact O-CD1 3.36Å; K54-I58 WeakPolarHBondContact O-CG1 3.38Å; K54-I58 PolarHBondContact O-N 3.02Å; W55-I58 PolarHBondContact O-N 2.98Å; W55-I58 VanDerWaalsContact O-N 3.1Å
59	Y	64.1	Low	61.9	Low	164 Å²	164	129.1 Å²	129.1	64%	0.643	65%	0.654	S	S	*	*	H	α-helix	trans	-86.6	-14	-180	-70.5	-63.7	0	0	114.1	W55 P61	W55-Y59 HydrophobicContact CB-CD2 4.21Å; W55-Y59 HydrophobicContact CB-CE2 4.33Å; W55-Y59 AromaticContact CD2-CE2 3.93Å; W55-Y59 HydrophobicContact CD2-CE2 3.93Å; W55-Y59 AromaticContact CE3-CD2 3.84Å; W55-Y59 HydrophobicContact CE3-CD2 3.84Å; W55-Y59 AromaticContact CE3-CE2 3.07Å; W55-Y59 HydrophobicContact CE3-CE2 3.07Å; W55-Y59 AromaticContact CE3-CZ 3.67Å; W55-Y59 HydrophobicContact CG-CE2 4.48Å; W55-Y59 AromaticContact CZ3-CE2 3.57Å; W55-Y59 HydrophobicContact CZ3-CE2 3.57Å; W55-Y59 AromaticContact CZ3-CZ 3.64Å; W55-Y59 WeakPolarHBondContact CZ3-OH 3.45Å; W55-Y59 WeakPolarHBondContact O-CB 3.16Å; W55-Y59 WeakPolarHBondContact O-CD2 3.11Å; W55-Y59 PolarHBondContact O-N 2.9Å; Y59-P61 WeakPolarHBondContact O-CD 3.43Å
60	L	66.9	Low	61.7	Low	106 Å²	106	132.6 Å²	132.6	56%	0.555	67%	0.668	S	S	*	*	S	Bend	trans	-70.7	108.2	165.7	-107	68.8	0	0	107.7	T56 H62	T56-L60 HydrophobicContact CG2-CD1 3.88Å; T56-L60 WeakPolarHBondContact O-CB 3.33Å; T56-L60 VanDerWaalsContact O-CD1 3.27Å; T56-L60 WeakPolarHBondContact O-CD1 3.29Å; T56-L60 PolarHBondContact O-N 2.84Å; L60-H62 PolarHBondContact O-N 3.28Å; L60-H62 VanDerWaalsContact O-N 3.09Å
61	P	56.5	Low	61.4	Low	113 Å²	113	133.7 Å²	133.7	73%	0.734	66%	0.664	S	S	*	*			trans	-64	120.6	171.3	29.7	-29.5	0	0	105.7	Y59 S63	Y59-P61 WeakPolarHBondContact O-CD 3.43Å; P61-S63 PolarHBondContact O-N 2.81Å
62	H	59.1	Low	61.1	Low	169 Å²	169	132.4 Å²	132.4	78%	0.782	67%	0.669	S	S	*	*			trans	-24.9	102.8	173.2	-169.6	77.1	0	0	110.7	L60 L64	L60-H62 PolarHBondContact O-N 3.28Å; L60-H62 VanDerWaalsContact O-N 3.09Å; H62-L64 VanDerWaalsContact C-N 3.34Å; H62-L64 PolarHBondContact O-N 2.97Å
63	S	57.3	Low	60.5	Low	103 Å²	103	133.8 Å²	133.8	72%	0.72	68%	0.679	S	S	*	*			trans	-53.2	104.8	175.7	-50.9	0	0	0	106.7	P61	P61-S63 PolarHBondContact O-N 2.81Å
64	L	48.8	Very low	59.9	Low	151 Å²	151	138.4 Å²	138.4	79%	0.791	69%	0.692	S	S	*	*			trans	-46.7	132	174.7	-88.7	145.3	0	0	107.8	H62 Q66	H62-L64 VanDerWaalsContact C-N 3.34Å; H62-L64 PolarHBondContact O-N 2.97Å; L64-Q66 PolarHBondContact O-N 2.98Å
65	P	47.1	Very low	59.2	Low	106 Å²	106	139.4 Å²	139.4	69%	0.688	70%	0.704	S	S	*	*			trans	-61.8	111	166.2	27.3	-29.1	0	0	105.6	Q67	P65-Q67 PolarHBondContact O-N 3.04Å
66	Q	50.1	Low	58.4	Low	195 Å²	195	143.6 Å²	143.6	91%	0.911	73%	0.734	S	S	*	*			trans	-66.1	103.9	173.5	-165	172.5	-31.5	0	106.1	L64	L64-Q66 PolarHBondContact O-N 2.98Å
67	Q	45.2	Very low	57.4	Low	258 Å²	258	149.5 Å²	149.5	100%	1.206	76%	0.757	S	S	*	*			trans	-60.8	0	168.6	-101.2	-174.8	-92.2	0	111.1	P65	P65-Q67 PolarHBondContact O-N 3.04Å

Retrieved 67 of 67 residues in 12.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).