A0A075X6N5_HUMAN Loading...

ATP synthase complex subunit 8

AlphaFold DB , UniProt , Accession A0A075X6N5, Species HUMAN (Homo sapiens, Human), Gene ATP8, Length 56 aa.

						>A0A075X6N5_HUMAN|A0A075X6N5|ATP8
ITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	I	66.6	Low	89.2	Confident	170 Å²	170	111.6 Å²	111.6	87%	0.872	59%	0.594	S	S	*	*				0	-50.3	0	-59.4	167.5	0	0	110.7	M4 L5	I1-M4 PolarHBondContact O-N 3Å; I1-L5 HydrophobicContact CG2-CD1 3.86Å; I1-L5 HydrophobicContact CG2-CG 4.44Å; I1-L5 PolarHBondContact O-N 3.41Å
2	T	81	Confident	89.3	Confident	118 Å²	118	108.8 Å²	108.8	72%	0.724	58%	0.584	S	S	*	*	H	α-helix	trans	-51	-46.3	177.3	-37.1	0	0	0	116.4	M4 L5 L6	T2-M4 VanDerWaalsContact C-N 3.34Å; T2-M4 PolarHBondContact O-N 3.08Å; T2-L5 PolarHBondContact O-N 3.35Å; T2-L6 PolarHBondContact O-N 3.27Å; T2-L6 VanDerWaalsContact O-N 3.1Å
3	P	86	Confident	89.4	Confident	82 Å²	82	108 Å²	108	53%	0.532	57%	0.574	S	S	.	*	H	α-helix	trans	-71	-30.5	-179	27	-34.8	0	0	112.8	L6 T7	P3-L6 PolarHBondContact O-N 2.71Å; P3-T7 PolarHBondContact O-N 3Å; P3-T7 PolarHBondContact O-OG1 3.08Å
4	M	91.9	Very high	89.4	Confident	142 Å²	142	107.9 Å²	107.9	70%	0.7	57%	0.573	S	S	*	*	H	α-helix	trans	-68.8	-42.5	178.2	-68	-73.1	132.9	0	111.3	I1 T2 T7 L8	I1-M4 PolarHBondContact O-N 3Å; T2-M4 VanDerWaalsContact C-N 3.34Å; T2-M4 PolarHBondContact O-N 3.08Å; M4-T7 PolarHBondContact O-N 3.45Å; M4-L8 PolarHBondContact O-N 3.45Å
5	L	94.1	Very high	89	Confident	109 Å²	109	110.7 Å²	110.7	57%	0.571	58%	0.579	S	S	*	*	H	α-helix	trans	-65.7	-39.3	175.6	-70.9	170.7	0	0	111.8	I1 T2 L8 F9	I1-L5 HydrophobicContact CG2-CD1 3.86Å; I1-L5 HydrophobicContact CG2-CG 4.44Å; I1-L5 PolarHBondContact O-N 3.41Å; T2-L5 PolarHBondContact O-N 3.35Å; L5-L8 PolarHBondContact O-N 2.96Å; L5-F9 WeakPolarHBondContact O-CB 3.34Å; L5-F9 PolarHBondContact O-N 3.4Å
6	L	93.9	Very high	88.7	Confident	104 Å²	104	110.4 Å²	110.4	55%	0.545	58%	0.575	S	S	.	*	H	α-helix	trans	-63.6	-44.3	176.4	-174.5	62.5	0	0	111.6	T2 P3 F9 L10	T2-L6 PolarHBondContact O-N 3.27Å; T2-L6 VanDerWaalsContact O-N 3.1Å; P3-L6 PolarHBondContact O-N 2.71Å; L6-F9 PolarHBondContact O-N 3.44Å; L6-L10 HydrophobicContact CG-CD1 4.31Å; L6-L10 VanDerWaalsContact O-CG 3.31Å; L6-L10 WeakPolarHBondContact O-CG 3.19Å; L6-L10 PolarHBondContact O-N 2.97Å
7	T	94.2	Very high	88.4	Confident	75 Å²	75	110.2 Å²	110.2	46%	0.46	57%	0.574	S	S	.	*	H	α-helix	trans	-62.2	-44.1	176.6	-58.5	0	0	0	111.8	P3 M4 F9 L10 I11	P3-T7 PolarHBondContact O-N 3Å; P3-T7 PolarHBondContact O-OG1 3.08Å; M4-T7 PolarHBondContact O-N 3.45Å; T7-F9 VanDerWaalsContact C-N 3.33Å; T7-F9 PolarHBondContact O-N 3.03Å; T7-L10 PolarHBondContact O-N 2.83Å; T7-I11 HydrophobicContact CG2-CD1 3.87Å; T7-I11 WeakPolarHBondContact O-CD1 3.39Å; T7-I11 VanDerWaalsContact O-CG1 3.27Å; T7-I11 WeakPolarHBondContact O-CG1 3.49Å; T7-I11 PolarHBondContact O-N 3.45Å
8	L	93.1	Very high	87.6	Confident	108 Å²	108	110.1 Å²	110.1	57%	0.565	57%	0.574	S	S	*	*	H	α-helix	trans	-64	-39.4	177.9	-175.3	61.1	0	0	112.1	M4 L5 T12	M4-L8 PolarHBondContact O-N 3.45Å; L5-L8 PolarHBondContact O-N 2.96Å; L8-T12 WeakPolarHBondContact O-CB 3.41Å; L8-T12 PolarHBondContact O-N 2.97Å; L8-T12 PolarHBondContact O-OG1 2.73Å
9	F	93.3	Very high	86.7	Confident	120 Å²	120	109.2 Å²	109.2	53%	0.526	57%	0.574	S	S	.	*	H	α-helix	trans	-61	-49.3	174.7	-179.7	-107	0	0	111.4	L5 L6 T7 I11 T12 Q13	L5-F9 WeakPolarHBondContact O-CB 3.34Å; L5-F9 PolarHBondContact O-N 3.4Å; L6-F9 PolarHBondContact O-N 3.44Å; T7-F9 VanDerWaalsContact C-N 3.33Å; T7-F9 PolarHBondContact O-N 3.03Å; F9-I11 PolarHBondContact O-N 3.08Å; F9-T12 PolarHBondContact O-N 3.11Å; F9-Q13 HydrophobicContact CD1-CG 4.27Å; F9-Q13 HydrophobicContact CD2-CG 4.38Å; F9-Q13 HydrophobicContact CE1-CG 3.95Å; F9-Q13 HydrophobicContact CE2-CG 4.06Å; F9-Q13 HydrophobicContact CG-CG 4.48Å; F9-Q13 HydrophobicContact CZ-CG 3.83Å; F9-Q13 VanDerWaalsContact O-CG 3.28Å; F9-Q13 WeakPolarHBondContact O-CG 3.22Å; F9-Q13 PolarHBondContact O-N 3.19Å
10	L	93.9	Very high	85.4	Confident	101 Å²	101	107.9 Å²	107.9	53%	0.529	57%	0.568	S	S	.	*	H	α-helix	trans	-61.2	-41.7	179.1	-68.6	171.4	0	0	112.7	L6 T7 T12 Q13 L14	L6-L10 HydrophobicContact CG-CD1 4.31Å; L6-L10 VanDerWaalsContact O-CG 3.31Å; L6-L10 WeakPolarHBondContact O-CG 3.19Å; L6-L10 PolarHBondContact O-N 2.97Å; T7-L10 PolarHBondContact O-N 2.83Å; L10-T12 VanDerWaalsContact C-N 3.34Å; L10-T12 PolarHBondContact O-N 3.16Å; L10-Q13 PolarHBondContact O-N 2.95Å; L10-L14 WeakPolarHBondContact O-CB 3.31Å; L10-L14 PolarHBondContact O-N 3.18Å
11	I	93.4	Very high	84	Confident	99 Å²	99	112.1 Å²	112.1	51%	0.508	58%	0.577	S	S	.	*	H	α-helix	trans	-63.5	-41.3	176.9	-66.9	164.9	0	0	111.1	T7 F9 L14 K15	T7-I11 HydrophobicContact CG2-CD1 3.87Å; T7-I11 WeakPolarHBondContact O-CD1 3.39Å; T7-I11 VanDerWaalsContact O-CG1 3.27Å; T7-I11 WeakPolarHBondContact O-CG1 3.49Å; T7-I11 PolarHBondContact O-N 3.45Å; F9-I11 PolarHBondContact O-N 3.08Å; I11-L14 PolarHBondContact O-N 3.3Å; I11-K15 WeakPolarHBondContact O-CB 3.34Å; I11-K15 PolarHBondContact O-N 3.11Å
12	T	90.5	Very high	83.8	Confident	78 Å²	78	111.6 Å²	111.6	48%	0.479	57%	0.571	S	S	.	*	H	α-helix	trans	-67.3	-44.4	180	-56.9	0	0	0	111.1	L8 F9 L10 L14 K15 M16	L8-T12 WeakPolarHBondContact O-CB 3.41Å; L8-T12 PolarHBondContact O-N 2.97Å; L8-T12 PolarHBondContact O-OG1 2.73Å; F9-T12 PolarHBondContact O-N 3.11Å; L10-T12 VanDerWaalsContact C-N 3.34Å; L10-T12 PolarHBondContact O-N 3.16Å; T12-L14 PolarHBondContact O-N 2.96Å; T12-K15 PolarHBondContact O-N 2.63Å; T12-M16 VanDerWaalsContact O-CB 3.31Å; T12-M16 WeakPolarHBondContact O-CB 3.4Å; T12-M16 PolarHBondContact O-N 2.81Å
13	Q	90.3	Very high	83.1	Confident	98 Å²	98	112.3 Å²	112.3	46%	0.458	57%	0.57	S	S	.	*	H	α-helix	trans	-60.6	-43.8	175.5	-69	-65.9	100.7	0	111.5	F9 L10 M16 L17	F9-Q13 HydrophobicContact CD1-CG 4.27Å; F9-Q13 HydrophobicContact CD2-CG 4.38Å; F9-Q13 HydrophobicContact CE1-CG 3.95Å; F9-Q13 HydrophobicContact CE2-CG 4.06Å; F9-Q13 HydrophobicContact CG-CG 4.48Å; F9-Q13 HydrophobicContact CZ-CG 3.83Å; F9-Q13 VanDerWaalsContact O-CG 3.28Å; F9-Q13 WeakPolarHBondContact O-CG 3.22Å; F9-Q13 PolarHBondContact O-N 3.19Å; L10-Q13 PolarHBondContact O-N 2.95Å; Q13-M16 PolarHBondContact O-N 2.91Å; Q13-L17 WeakPolarHBondContact O-CB 3.28Å; Q13-L17 PolarHBondContact O-N 2.87Å
14	L	88.6	Confident	82.1	Confident	106 Å²	106	113.3 Å²	113.3	56%	0.555	58%	0.576	S	S	*	*	H	α-helix	trans	-63.7	-45.1	178	-176.9	64.1	0	0	111.6	L10 I11 T12 L17 N18	L10-L14 WeakPolarHBondContact O-CB 3.31Å; L10-L14 PolarHBondContact O-N 3.18Å; I11-L14 PolarHBondContact O-N 3.3Å; T12-L14 PolarHBondContact O-N 2.96Å; L14-L17 PolarHBondContact O-N 2.81Å; L14-N18 WeakPolarHBondContact CD1-ND2 3.4Å; L14-N18 WeakPolarHBondContact O-CB 3.27Å; L14-N18 PolarHBondContact O-N 2.79Å; L14-N18 PolarHBondContact O-ND2 2.79Å
15	K	84.5	Confident	81	Confident	151 Å²	151	111.9 Å²	111.9	66%	0.657	58%	0.577	S	S	*	*	H	α-helix	trans	-62.9	-45.3	177.8	-169.3	178	178.6	-164.9	110.9	I11 T12 N18 T19	I11-K15 WeakPolarHBondContact O-CB 3.34Å; I11-K15 PolarHBondContact O-N 3.11Å; T12-K15 PolarHBondContact O-N 2.63Å; K15-N18 PolarHBondContact O-N 2.95Å; K15-T19 HydrophobicContact CG-CG2 4.41Å; K15-T19 WeakPolarHBondContact O-CB 3.48Å; K15-T19 VanDerWaalsContact O-CG2 3.27Å; K15-T19 WeakPolarHBondContact O-CG2 3.41Å; K15-T19 PolarHBondContact O-N 3.29Å; K15-T19 PolarHBondContact O-OG1 3.06Å
16	M	83.4	Confident	79.8	Confident	106 Å²	106	111.2 Å²	111.2	52%	0.522	58%	0.582	S	S	.	*	H	α-helix	trans	-58.1	-52.6	176.4	-171.5	-89.5	-157.1	0	110.4	T12 Q13 N18 T19 N20	T12-M16 VanDerWaalsContact O-CB 3.31Å; T12-M16 WeakPolarHBondContact O-CB 3.4Å; T12-M16 PolarHBondContact O-N 2.81Å; Q13-M16 PolarHBondContact O-N 2.91Å; M16-N18 VanDerWaalsContact C-N 3.34Å; M16-N18 PolarHBondContact O-N 2.69Å; M16-T19 WeakPolarHBondContact CA-OG1 3.43Å; M16-T19 PolarHBondContact O-N 2.73Å; M16-T19 VanDerWaalsContact O-N 3.07Å; M16-T19 PolarHBondContact O-OG1 2.7Å; M16-N20 WeakPolarHBondContact CG-ND2 3.37Å; M16-N20 PolarHBondContact O-N 2.98Å; M16-N20 PolarHBondContact O-ND2 2.9Å; M16-N20 PolarHBondContact SD-ND2 2.67Å
17	L	84.3	Confident	78.5	Confident	106 Å²	106	111.8 Å²	111.8	56%	0.555	59%	0.592	S	S	*	*	H	α-helix	trans	-57	-43.7	177.8	-174.7	65.5	0	0	112.9	Q13 L14 T19 N20	Q13-L17 WeakPolarHBondContact O-CB 3.28Å; Q13-L17 PolarHBondContact O-N 2.87Å; L14-L17 PolarHBondContact O-N 2.81Å; L17-T19 VanDerWaalsContact C-N 3.35Å; L17-N20 PolarHBondContact O-N 2.69Å
18	N	74.4	Confident	77.5	Confident	109 Å²	109	117.1 Å²	117.1	58%	0.583	61%	0.609	S	S	*	*	H	α-helix	trans	-68.2	-32.4	177.4	-79.1	-74	0	0	112.9	L14 K15 M16	L14-N18 WeakPolarHBondContact CD1-ND2 3.4Å; L14-N18 WeakPolarHBondContact O-CB 3.27Å; L14-N18 PolarHBondContact O-N 2.79Å; L14-N18 PolarHBondContact O-ND2 2.79Å; K15-N18 PolarHBondContact O-N 2.95Å; M16-N18 VanDerWaalsContact C-N 3.34Å; M16-N18 PolarHBondContact O-N 2.69Å
19	T	69.3	Low	76.2	Confident	92 Å²	92	117.8 Å²	117.8	56%	0.564	62%	0.619	S	S	*	*	H	α-helix	trans	-82.4	-13.6	177.9	55	0	0	0	114.2	K15 M16 L17 Y21	K15-T19 HydrophobicContact CG-CG2 4.41Å; K15-T19 WeakPolarHBondContact O-CB 3.48Å; K15-T19 VanDerWaalsContact O-CG2 3.27Å; K15-T19 WeakPolarHBondContact O-CG2 3.41Å; K15-T19 PolarHBondContact O-N 3.29Å; K15-T19 PolarHBondContact O-OG1 3.06Å; M16-T19 WeakPolarHBondContact CA-OG1 3.43Å; M16-T19 PolarHBondContact O-N 2.73Å; M16-T19 VanDerWaalsContact O-N 3.07Å; M16-T19 PolarHBondContact O-OG1 2.7Å; L17-T19 VanDerWaalsContact C-N 3.35Å; T19-Y21 VanDerWaalsContact C-N 3.26Å; T19-Y21 PolarHBondContact O-N 2.88Å
20	N	61.3	Low	75.1	Confident	84 Å²	84	120.6 Å²	120.6	45%	0.449	64%	0.636	S	S	.	*	T	Hydrogen-bonded Turn	trans	-81.4	7.9	-176.6	-91.1	-85.2	0	0	115.1	M16 L17	M16-N20 WeakPolarHBondContact CG-ND2 3.37Å; M16-N20 PolarHBondContact O-N 2.98Å; M16-N20 PolarHBondContact O-ND2 2.9Å; M16-N20 PolarHBondContact SD-ND2 2.67Å; L17-N20 PolarHBondContact O-N 2.69Å
21	Y	56.6	Low	73.7	Confident	197 Å²	197	125 Å²	125	77%	0.773	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.5	-2.8	179.6	-82.3	-81.5	0	0	115.1	T19	T19-Y21 VanDerWaalsContact C-N 3.26Å; T19-Y21 PolarHBondContact O-N 2.88Å
22	H	61.9	Low	72.4	Confident	158 Å²	158	128.5 Å²	128.5	73%	0.731	67%	0.667	S	S	*	*			trans	-103.2	68.5	167.3	-160.5	-85.6	0	0	109.2
23	L	66.8	Low	71.2	Confident	134 Å²	134	132.5 Å²	132.5	70%	0.702	68%	0.678	S	S	*	*	P	Polyproline II helix	trans	-54.1	130.2	157.6	-89	86.8	0	0	106.4
24	P	65.3	Low	69.8	Low	102 Å²	102	134.1 Å²	134.1	66%	0.662	69%	0.69	S	S	*	*	P	Polyproline II helix	trans	-52	131.8	165.8	23.4	-30.8	0	0	106.5	S26	P24-S26 PolarHBondContact O-N 3.07Å
25	P	67.9	Low	68.6	Low	112 Å²	112	137.7 Å²	137.7	73%	0.727	70%	0.698	S	S	*	*	P	Polyproline II helix	trans	-52.3	120.5	-179	21.1	-31.8	0	0	107.1	P27	P25-P27 VanDerWaalsContact O-N 3.15Å
26	S	68.1	Low	67.6	Low	96 Å²	96	136 Å²	136	67%	0.671	70%	0.696	S	S	*	*	P	Polyproline II helix	trans	-46.9	128.6	176.4	176.6	0	0	0	107	P24 K28	P24-S26 PolarHBondContact O-N 3.07Å; S26-K28 PolarHBondContact O-N 3.32Å
27	P	68.3	Low	66.9	Low	116 Å²	116	136.5 Å²	136.5	75%	0.753	70%	0.695	S	S	*	*			trans	-53.2	112	176.4	18.9	-28.4	0	0	106.3	P25	P25-P27 VanDerWaalsContact O-N 3.15Å
28	K	71.5	Confident	66	Low	187 Å²	187	137.1 Å²	137.1	81%	0.813	71%	0.705	S	S	*	*			trans	-53.7	131.7	178.1	-74.4	174.6	-179.8	172.1	105.2	S26 M30	S26-K28 PolarHBondContact O-N 3.32Å; K28-M30 PolarHBondContact O-N 3.42Å
29	P	67.2	Low	65.5	Low	122 Å²	122	137.4 Å²	137.4	79%	0.792	70%	0.698	S	S	*	*			trans	-57.1	101.6	170.4	21.9	-29.6	0	0	105.7	K31	P29-K31 VanDerWaalsContact C-N 3.3Å; P29-K31 PolarHBondContact O-N 3.1Å
30	M	70.8	Confident	65.9	Low	178 Å²	178	136.9 Å²	136.9	88%	0.877	69%	0.689	S	S	*	*			trans	-64.3	105.3	175.9	-157.5	176.9	-160.9	0	101.9	K28 M32	K28-M30 PolarHBondContact O-N 3.42Å; M30-M32 PolarHBondContact O-N 3.48Å
31	K	64.6	Low	66.6	Low	194 Å²	194	135.9 Å²	135.9	84%	0.843	69%	0.687	S	S	*	*			trans	-57.7	102.7	171.4	-66.7	-154.2	178.4	-171.2	103.7	P29 K33	P29-K31 VanDerWaalsContact C-N 3.3Å; P29-K31 PolarHBondContact O-N 3.1Å; K31-K33 PolarHBondContact O-N 3.46Å
32	M	65.3	Low	67.4	Low	172 Å²	172	133.4 Å²	133.4	85%	0.847	68%	0.68	S	S	*	*			trans	-59.1	88.7	163.1	-88.4	-176.3	170	0	103.5	M30 N34	M30-M32 PolarHBondContact O-N 3.48Å; M32-N34 PolarHBondContact O-N 3.21Å
33	K	64.4	Low	67.9	Low	162 Å²	162	133.1 Å²	133.1	70%	0.704	67%	0.673	S	S	*	*			trans	-60.3	107	161.3	-174.2	172.4	178.1	179.4	101.2	K31 Y35	K31-K33 PolarHBondContact O-N 3.46Å; K33-Y35 HydrophobicContact CD-CD2 4.41Å; K33-Y35 HydrophobicContact CD-CE2 4.31Å; K33-Y35 HydrophobicContact CG-CD2 4.43Å; K33-Y35 PolarHBondContact O-N 3.22Å
34	N	62.6	Low	68.5	Low	133 Å²	133	130.7 Å²	130.7	71%	0.711	66%	0.664	S	S	*	*			trans	-55.2	87.9	167.8	-68.9	-54.6	0	0	104.7	M32 N36	M32-N34 PolarHBondContact O-N 3.21Å; N34-N36 PolarHBondContact O-N 3.45Å
35	Y	62.5	Low	68.9	Low	181 Å²	181	133.3 Å²	133.3	71%	0.71	67%	0.665	S	S	*	*			trans	-68.8	88.9	166.4	-118.2	-87.7	0	0	100.9	K33 K37	K33-Y35 HydrophobicContact CD-CD2 4.41Å; K33-Y35 HydrophobicContact CD-CE2 4.31Å; K33-Y35 HydrophobicContact CG-CD2 4.43Å; K33-Y35 PolarHBondContact O-N 3.22Å; Y35-K37 PolarHBondContact O-N 3.34Å
36	N	63.6	Low	69.3	Low	116 Å²	116	131.2 Å²	131.2	62%	0.62	65%	0.647	S	S	*	*			trans	-56.9	93.2	165.2	-71.8	-23.4	0	0	103.5	N34	N34-N36 PolarHBondContact O-N 3.45Å
37	K	67.9	Low	69.7	Low	116 Å²	116	130 Å²	130	50%	0.504	64%	0.638	S	S	.	*			trans	-58.2	135.3	178.1	-66.2	178.8	-178.2	178.9	103.7	Y35 W39 E40 P41	Y35-K37 PolarHBondContact O-N 3.34Å; K37-W39 HydrophobicContact CB-CD2 4.11Å; K37-W39 HydrophobicContact CB-CG 3.9Å; K37-W39 HydrophobicContact CB-CZ2 4.36Å; K37-W39 HydrophobicContact CD-CZ2 3.82Å; K37-W39 PolarHBondContact O-N 2.99Å; K37-E40 WeakPolarHBondContact O-CB 3.31Å; K37-E40 PolarHBondContact O-N 3.46Å; K37-P41 WeakPolarHBondContact O-CD 3.38Å
38	P	66.2	Low	70.1	Confident	118 Å²	118	127.7 Å²	127.7	77%	0.766	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.7	-13.9	-176.5	17	-29	0	0	113.5
39	W	64.6	Low	70.2	Confident	115 Å²	115	124.5 Å²	124.5	44%	0.436	62%	0.615	S	S	.	*	T	Hydrogen-bonded Turn	trans	-72.1	-32.6	169.4	69.5	-117.6	0	0	115.1	K37 K42 W43	K37-W39 HydrophobicContact CB-CD2 4.11Å; K37-W39 HydrophobicContact CB-CG 3.9Å; K37-W39 HydrophobicContact CB-CZ2 4.36Å; K37-W39 HydrophobicContact CD-CZ2 3.82Å; K37-W39 PolarHBondContact O-N 2.99Å; W39-K42 WeakPolarHBondContact O-CA 3.31Å; W39-K42 VanDerWaalsContact O-CB 3.27Å; W39-K42 WeakPolarHBondContact O-CB 3.41Å; W39-K42 PolarHBondContact O-N 3.06Å; W39-W43 AromaticContact CE3-CD1 3.45Å; W39-W43 VanDerWaalsContact CE3-CD1 3.45Å; W39-W43 HydrophobicContact CE3-CG 4.23Å; W39-W43 VanDerWaalsContact O-CD1 3.28Å; W39-W43 PolarHBondContact O-N 3.04Å
40	E	76.7	Confident	70.5	Confident	81 Å²	81	125.7 Å²	125.7	38%	0.379	61%	0.61	S	S	.	*	H	α-helix	trans	-52.1	-56.3	-178.4	-89.2	-89	97	0	111.1	K37 K42 W43 T44	K37-E40 WeakPolarHBondContact O-CB 3.31Å; K37-E40 PolarHBondContact O-N 3.46Å; E40-K42 PolarHBondContact O-N 3.33Å; E40-K42 VanDerWaalsContact O-N 3.16Å; E40-W43 PolarHBondContact O-N 2.95Å; E40-W43 VanDerWaalsContact O-N 3.11Å; E40-T44 PolarHBondContact O-N 3.41Å; E40-T44 PolarHBondContact O-OG1 3.45Å; E40-T44 VanDerWaalsContact O-OG1 3.11Å
41	P	76.4	Confident	70.4	Confident	63 Å²	63	121.9 Å²	121.9	41%	0.409	60%	0.601	S	S	.	*	H	α-helix	trans	-65.4	-22.7	178.6	24.5	-33	0	0	112.9	K37 K45	K37-P41 WeakPolarHBondContact O-CD 3.38Å; P41-K45 WeakPolarHBondContact O-CB 3.42Å; P41-K45 WeakPolarHBondContact O-CG 3.36Å; P41-K45 PolarHBondContact O-N 3.46Å
42	K	72.2	Confident	70.6	Confident	145 Å²	145	118.3 Å²	118.3	63%	0.63	59%	0.591	S	S	*	*	H	α-helix	trans	-70.9	-43.2	174.5	-166.5	175.5	-178.9	179	110.8	W39 E40 I46	W39-K42 WeakPolarHBondContact O-CA 3.31Å; W39-K42 VanDerWaalsContact O-CB 3.27Å; W39-K42 WeakPolarHBondContact O-CB 3.41Å; W39-K42 PolarHBondContact O-N 3.06Å; E40-K42 PolarHBondContact O-N 3.33Å; E40-K42 VanDerWaalsContact O-N 3.16Å; K42-I46 HydrophobicContact CG-CD1 4.09Å; K42-I46 WeakPolarHBondContact O-CD1 3.27Å; K42-I46 WeakPolarHBondContact O-CG1 3.5Å; K42-I46 PolarHBondContact O-N 2.96Å; K42-I46 VanDerWaalsContact O-N 3.08Å
43	W	72.8	Confident	70.8	Confident	153 Å²	153	115.2 Å²	115.2	58%	0.58	58%	0.583	S	S	*	*	H	α-helix	trans	-69.1	-44.9	177	-79.3	96.6	0	0	112.4	W39 E40 K45 I46 C47	W39-W43 AromaticContact CE3-CD1 3.45Å; W39-W43 VanDerWaalsContact CE3-CD1 3.45Å; W39-W43 HydrophobicContact CE3-CG 4.23Å; W39-W43 VanDerWaalsContact O-CD1 3.28Å; W39-W43 PolarHBondContact O-N 3.04Å; E40-W43 PolarHBondContact O-N 2.95Å; E40-W43 VanDerWaalsContact O-N 3.11Å; W43-K45 VanDerWaalsContact C-N 3.26Å; W43-K45 PolarHBondContact O-N 3.02Å; W43-I46 PolarHBondContact O-N 3.49Å; W43-C47 PolarHBondContact O-N 3.07Å; W43-C47 PolarHBondContact O-SG 2.96Å; W43-C47 VanDerWaalsContact O-SG 3.4Å
44	T	79.2	Confident	70.7	Confident	83 Å²	83	113.4 Å²	113.4	51%	0.509	59%	0.588	S	S	.	*	H	α-helix	trans	-57.7	-41.1	175.6	-48.3	0	0	0	111.5	E40 S48	E40-T44 PolarHBondContact O-N 3.41Å; E40-T44 PolarHBondContact O-OG1 3.45Å; E40-T44 VanDerWaalsContact O-OG1 3.11Å; T44-S48 VanDerWaalsContact O-CB 3.31Å; T44-S48 WeakPolarHBondContact O-CB 3.44Å; T44-S48 PolarHBondContact O-N 3.44Å; T44-S48 PolarHBondContact O-OG 2.85Å
45	K	74.8	Confident	70.9	Confident	157 Å²	157	116.7 Å²	116.7	68%	0.683	60%	0.599	S	S	*	*	H	α-helix	trans	-64.9	-44.9	176.3	-78.5	177.1	-179.4	-176.1	112.6	P41 W43 S48 L49	P41-K45 WeakPolarHBondContact O-CB 3.42Å; P41-K45 WeakPolarHBondContact O-CG 3.36Å; P41-K45 PolarHBondContact O-N 3.46Å; W43-K45 VanDerWaalsContact C-N 3.26Å; W43-K45 PolarHBondContact O-N 3.02Å; K45-S48 PolarHBondContact O-N 3.42Å; K45-L49 WeakPolarHBondContact O-CB 3.27Å; K45-L49 PolarHBondContact O-N 3.45Å
46	I	76.3	Confident	70.4	Confident	68 Å²	68	116.8 Å²	116.8	35%	0.349	63%	0.627	S	S	.	*	H	α-helix	trans	-64.7	-45.7	-179.4	-67.9	164.1	0	0	110.9	K42 W43 L49 H50	K42-I46 HydrophobicContact CG-CD1 4.09Å; K42-I46 WeakPolarHBondContact O-CD1 3.27Å; K42-I46 WeakPolarHBondContact O-CG1 3.5Å; K42-I46 PolarHBondContact O-N 2.96Å; K42-I46 VanDerWaalsContact O-N 3.08Å; W43-I46 PolarHBondContact O-N 3.49Å; I46-L49 PolarHBondContact O-N 2.91Å; I46-H50 PolarHBondContact O-N 3.42Å; I46-H50 VanDerWaalsContact O-N 3.08Å; I46-H50 PolarHBondContact O-ND1 3.22Å
47	C	75.3	Confident	70.8	Confident	70 Å²	70	116.9 Å²	116.9	47%	0.473	63%	0.627	S	S	.	*	H	α-helix	trans	-65.1	-40.8	178.3	-64.1	0	0	0	111.9	W43 H50 S51	W43-C47 PolarHBondContact O-N 3.07Å; W43-C47 PolarHBondContact O-SG 2.96Å; W43-C47 VanDerWaalsContact O-SG 3.4Å; C47-H50 PolarHBondContact O-N 2.91Å; C47-S51 WeakPolarHBondContact O-CB 3.42Å; C47-S51 PolarHBondContact O-N 3.36Å; C47-S51 PolarHBondContact O-OG 2.98Å
48	S	77.3	Confident	70.9	Confident	67 Å²	67	116.9 Å²	116.9	47%	0.469	63%	0.633	S	S	.	*	H	α-helix	trans	-65.6	-41.3	178.2	-57.5	0	0	0	112	T44 K45 S51 L52	T44-S48 VanDerWaalsContact O-CB 3.31Å; T44-S48 WeakPolarHBondContact O-CB 3.44Å; T44-S48 PolarHBondContact O-N 3.44Å; T44-S48 PolarHBondContact O-OG 2.85Å; K45-S48 PolarHBondContact O-N 3.42Å; S48-S51 PolarHBondContact O-N 2.96Å; S48-L52 PolarHBondContact O-N 3.49Å
49	L	74.2	Confident	71.2	Confident	121 Å²	121	116.8 Å²	116.8	63%	0.634	63%	0.626	S	S	*	*	H	α-helix	trans	-63.8	-42.9	177.3	-169.8	113.5	0	0	111.9	K45 I46 S51 L52	K45-L49 WeakPolarHBondContact O-CB 3.27Å; K45-L49 PolarHBondContact O-N 3.45Å; I46-L49 PolarHBondContact O-N 2.91Å; L49-S51 VanDerWaalsContact C-N 3.28Å; L49-S51 PolarHBondContact O-N 2.78Å; L49-L52 WeakPolarHBondContact O-CB 3.35Å; L49-L52 PolarHBondContact O-N 2.88Å
50	H	72.1	Confident	71.6	Confident	146 Å²	146	116.9 Å²	116.9	68%	0.676	64%	0.637	S	S	*	*	H	α-helix	trans	-73.1	-18.7	177	-73.6	100.9	0	0	113.8	I46 C47 L52	I46-H50 PolarHBondContact O-N 3.42Å; I46-H50 VanDerWaalsContact O-N 3.08Å; I46-H50 PolarHBondContact O-ND1 3.22Å; C47-H50 PolarHBondContact O-N 2.91Å; H50-L52 VanDerWaalsContact C-N 3.31Å
51	S	69.8	Low	71.3	Confident	99 Å²	99	119.2 Å²	119.2	69%	0.692	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.1	-7.6	175.8	-56.8	0	0	0	112.8	C47 S48 L49	C47-S51 WeakPolarHBondContact O-CB 3.42Å; C47-S51 PolarHBondContact O-N 3.36Å; C47-S51 PolarHBondContact O-OG 2.98Å; S48-S51 PolarHBondContact O-N 2.96Å; L49-S51 VanDerWaalsContact C-N 3.28Å; L49-S51 PolarHBondContact O-N 2.78Å
52	L	68.1	Low	70.9	Confident	119 Å²	119	122.9 Å²	122.9	62%	0.623	67%	0.67	S	S	*	*	S	Bend	trans	-69.9	133.1	171.7	-70.6	170.1	0	0	108.9	S48 L49 H50	S48-L52 PolarHBondContact O-N 3.49Å; L49-L52 WeakPolarHBondContact O-CB 3.35Å; L49-L52 PolarHBondContact O-N 2.88Å; H50-L52 VanDerWaalsContact C-N 3.31Å
53	P	69.3	Low	70.8	Confident	106 Å²	106	121.4 Å²	121.4	69%	0.688	67%	0.672	S	S	*	*	P	Polyproline II helix	trans	-59	140.6	174.7	25.3	-32.1	0	0	108.8	Q55	P53-Q55 PolarHBondContact O-N 3.33Å; P53-Q55 VanDerWaalsContact O-N 3.08Å
54	P	62.7	Low	70.7	Confident	125 Å²	125	118.9 Å²	118.9	81%	0.812	68%	0.679	S	S	*	*	P	Polyproline II helix	trans	-54.6	122.7	174.2	21.4	-29.7	0	0	107.7	S56	P54-S56 PolarHBondContact O-N 2.97Å
55	Q	66.5	Low	70	Confident	201 Å²	201	121.9 Å²	121.9	94%	0.939	69%	0.694	S	S	*	*			trans	-59.3	113.7	177	-108.1	-161.3	-43.5	0	107.9	P53	P53-Q55 PolarHBondContact O-N 3.33Å; P53-Q55 VanDerWaalsContact O-N 3.08Å
56	S	53.3	Low	69.5	Low	184 Å²	184	118.7 Å²	118.7	100%	1.287	70%	0.695	S	S	*	*			trans	-69.9	0	169.9	60	0	0	0	111.1	P54	P54-S56 PolarHBondContact O-N 2.97Å

Retrieved 56 of 56 residues in 77.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).