A0A075X768_HUMAN Loading...

NADH-ubiquinone oxidoreductase chain 3

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity of complex I.

AlphaFold DB , UniProt , Accession A0A075X768, Species HUMAN (Homo sapiens, Human), Gene ND3, Length 93 aa.

						>A0A075X768_HUMAN|A0A075X768|ND3
WLPQLNGYMEKSTPYECGFDPMSPARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSLAYEWLQKGLDWTE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	W	70.5	Confident	79.9	Confident	296 Å²	296	149 Å²	149	100%	1.121	74%	0.743	S	S	*	*				0	107.2	0	-133.3	84.4	0	0	0	106.4
2	L	74.9	Confident	80.4	Confident	156 Å²	156	144.7 Å²	144.7	82%	0.817	74%	0.738	S	S	*	*			trans	-91	135.8	-178.3	-79.8	162.2	0	0	0	109.2	Q4	L2-Q4 PolarHBondContact O-N 3.4Å
3	P	81.9	Confident	80.8	Confident	106 Å²	106	138.9 Å²	138.9	69%	0.688	71%	0.714	S	S	*	*			trans	-65.8	129.1	177.5	26.2	-31.2	0	0	0	109.8	L5	P3-L5 PolarHBondContact O-N 3.4Å
4	Q	80.5	Confident	81.1	Confident	177 Å²	177	135.4 Å²	135.4	83%	0.827	71%	0.705	S	S	*	*			trans	-80	113.4	174	-69.6	-166	-27.7	0	0	109.7	L2 N6	L2-Q4 PolarHBondContact O-N 3.4Å; Q4-N6 PolarHBondContact O-N 3.1Å; Q4-N6 VanDerWaalsContact O-N 3.14Å
5	L	79.4	Confident	81.4	Confident	173 Å²	173	139.2 Å²	139.2	91%	0.906	71%	0.708	S	S	*	*			trans	-80.3	91.5	173.9	-69.2	169.8	0	0	0	109.2	P3	P3-L5 PolarHBondContact O-N 3.4Å
6	N	79.3	Confident	81.8	Confident	72 Å²	72	135.6 Å²	135.6	39%	0.385	69%	0.687	S	S	.	*			trans	-115.1	88.7	179.1	-136.1	-0.4	0	0	0	109.4	Q4 Y8 K11	Q4-N6 PolarHBondContact O-N 3.1Å; Q4-N6 VanDerWaalsContact O-N 3.14Å; N6-Y8 HydrophobicContact CB-CD2 4.4Å; N6-Y8 HydrophobicContact CB-CE2 3.88Å; N6-Y8 WeakPolarHBondContact ND2-CE2 3.32Å; N6-Y8 PolarHBondContact ND2-OH 3Å; N6-Y8 VanDerWaalsContact ND2-OH 3.1Å; N6-Y8 PolarHBondContact O-N 3.14Å; N6-Y8 WeakPolarHBondContact OD1-CE2 3.42Å; N6-Y8 PolarHBondContact OD1-OH 3.25Å; N6-K11 WeakPolarHBondContact O-CD 3.24Å
7	G	81.4	Confident	82.1	Confident	82 Å²	82	133.4 Å²	133.4	85%	0.845	69%	0.686	S	S	*	*			trans	-89.9	77	-171.9	0	0	0	0	0	113
8	Y	84.5	Confident	82.2	Confident	133 Å²	133	129.8 Å²	129.8	52%	0.522	69%	0.687	S	S	.	*			trans	-90.4	150	171.2	-54.1	-71.5	0	0	0	110.6	N6 E10 K11 S12	N6-Y8 HydrophobicContact CB-CD2 4.4Å; N6-Y8 HydrophobicContact CB-CE2 3.88Å; N6-Y8 WeakPolarHBondContact ND2-CE2 3.32Å; N6-Y8 PolarHBondContact ND2-OH 3Å; N6-Y8 VanDerWaalsContact ND2-OH 3.1Å; N6-Y8 PolarHBondContact O-N 3.14Å; N6-Y8 WeakPolarHBondContact OD1-CE2 3.42Å; N6-Y8 PolarHBondContact OD1-OH 3.25Å; Y8-E10 VanDerWaalsContact C-N 3.27Å; Y8-E10 PolarHBondContact O-N 3.3Å; Y8-K11 HydrophobicContact CD2-CD 4.3Å; Y8-K11 WeakPolarHBondContact O-CB 3.48Å; Y8-K11 PolarHBondContact O-N 2.94Å; Y8-S12 PolarHBondContact O-N 3.46Å
9	M	81.3	Confident	82.4	Confident	153 Å²	153	131.6 Å²	131.6	75%	0.754	69%	0.689	S	S	*	*	G	3₁₀ helix	trans	-54.7	-41.4	-178.4	-167.8	-178.1	-64.9	0	0	112.5	K11 S12 T13	M9-K11 PolarHBondContact O-N 3Å; M9-S12 WeakPolarHBondContact CA-OG 3.48Å; M9-S12 WeakPolarHBondContact O-CA 3.47Å; M9-S12 PolarHBondContact O-N 3.34Å; M9-S12 PolarHBondContact O-OG 2.66Å; M9-T13 PolarHBondContact O-N 2.91Å
10	E	80.9	Confident	82.6	Confident	147 Å²	147	131.9 Å²	131.9	69%	0.687	69%	0.691	S	S	*	*	G	3₁₀ helix	trans	-62.9	-19.9	176.7	-57.4	-57.4	152.9	0	0	114.7	Y8 T13	Y8-E10 VanDerWaalsContact C-N 3.27Å; Y8-E10 PolarHBondContact O-N 3.3Å; E10-T13 PolarHBondContact O-OG1 3.18Å
11	K	84.3	Confident	82.6	Confident	144 Å²	144	128.5 Å²	128.5	63%	0.626	68%	0.677	S	S	*	*	G	3₁₀ helix	trans	-89.6	-11.2	173.9	-68.1	-176	177.1	-178.3	0	112.6	N6 Y8 M9	N6-K11 WeakPolarHBondContact O-CD 3.24Å; Y8-K11 HydrophobicContact CD2-CD 4.3Å; Y8-K11 WeakPolarHBondContact O-CB 3.48Å; Y8-K11 PolarHBondContact O-N 2.94Å; M9-K11 PolarHBondContact O-N 3Å
12	S	85.8	Confident	83.1	Confident	97 Å²	97	122.9 Å²	122.9	68%	0.678	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.2	-5	178.3	65.2	0	0	0	0	113.4	Y8 M9	Y8-S12 PolarHBondContact O-N 3.46Å; M9-S12 WeakPolarHBondContact CA-OG 3.48Å; M9-S12 WeakPolarHBondContact O-CA 3.47Å; M9-S12 PolarHBondContact O-N 3.34Å; M9-S12 PolarHBondContact O-OG 2.66Å
13	T	85.4	Confident	83.4	Confident	70 Å²	70	119.1 Å²	119.1	43%	0.429	65%	0.652	S	S	.	*	S	Bend	trans	-78.1	149.5	173.5	50.3	0	0	0	0	111.1	M9 E10	M9-T13 PolarHBondContact O-N 2.91Å; E10-T13 PolarHBondContact O-OG1 3.18Å
14	P	85.3	Confident	83.3	Confident	89 Å²	89	119 Å²	119	58%	0.578	65%	0.651	S	S	*	*	P	Polyproline II helix	trans	-66.1	143.1	178.9	27	-33.3	0	0	0	111.4	P21	P14-P21 HydrophobicContact CG-CB 4.31Å; P14-P21 HydrophobicContact CG-CG 3.98Å
15	Y	85.8	Confident	83.3	Confident	193 Å²	193	115.3 Å²	115.3	76%	0.757	65%	0.652	S	S	*	*	P	Polyproline II helix	trans	-81.5	117.7	178.9	177.1	-97	0	0	0	111.2
16	E	87.1	Confident	83.4	Confident	81 Å²	81	118.3 Å²	118.3	38%	0.379	65%	0.651	S	S	.	*	B	Isolated β-bridge	trans	-121.4	60.2	174.6	-162.7	96.2	-164	0	0	109.8	G18 F19	E16-G18 PolarHBondContact O-N 3.06Å; E16-F19 WeakPolarHBondContact CB-O 3.42Å; E16-F19 PolarHBondContact O-N 2.95Å
17	C	87.1	Confident	83.3	Confident	99 Å²	99	120.7 Å²	120.7	67%	0.669	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	56.3	28.4	178.9	-63.1	0	0	0	0	114.7
18	G	84.8	Confident	83.3	Confident	68 Å²	68	122.6 Å²	122.6	70%	0.701	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	90	6.6	-177.8	0	0	0	0	0	115.1	E16	E16-G18 PolarHBondContact O-N 3.06Å
19	F	84.8	Confident	83.1	Confident	164 Å²	164	123 Å²	123	72%	0.719	67%	0.67	S	S	*	*	B	Isolated β-bridge	trans	-109.9	167.4	173.8	-63.3	-83.5	0	0	0	111.7	E16	E16-F19 WeakPolarHBondContact CB-O 3.42Å; E16-F19 PolarHBondContact O-N 2.95Å
20	D	86.5	Confident	83.3	Confident	137 Å²	137	118 Å²	118	73%	0.733	65%	0.65	S	S	*	*			trans	-71.3	142.6	167.6	-68.9	-37.9	0	0	0	110.1	M22	D20-M22 PolarHBondContact O-N 3.19Å
21	P	83.4	Confident	83.5	Confident	62 Å²	62	117.5 Å²	117.5	40%	0.403	65%	0.649	S	S	.	*			trans	-61	121.2	-177.1	25.3	-35.1	0	0	0	111.1	P14	P14-P21 HydrophobicContact CG-CB 4.31Å; P14-P21 HydrophobicContact CG-CG 3.98Å
22	M	80.6	Confident	83.5	Confident	177 Å²	177	115.6 Å²	115.6	87%	0.872	64%	0.641	S	S	*	*	S	Bend	trans	-73.2	-27.8	-178.6	-72.8	-76.6	-141.5	0	0	112.9	D20	D20-M22 PolarHBondContact O-N 3.19Å
23	S	80.6	Confident	83.4	Confident	77 Å²	77	116.6 Å²	116.6	54%	0.538	63%	0.633	S	S	.	*	S	Bend	trans	-152.3	158.8	-179.1	70.8	0	0	0	0	110.1	A25	S23-A25 PolarHBondContact O-N 2.9Å
24	P	81.6	Confident	83.6	Confident	103 Å²	103	118 Å²	118	67%	0.669	63%	0.634	S	S	*	*			trans	-62.3	137.1	174.8	26.5	-34.4	0	0	0	110.5	R26	P24-R26 PolarHBondContact O-N 3.44Å
25	A	80.3	Confident	83.7	Confident	101 Å²	101	117.9 Å²	117.9	84%	0.835	63%	0.628	S	S	*	*	S	Bend	trans	-61	-7.6	178.2	0	0	0	0	0	114.8	S23 V27	S23-A25 PolarHBondContact O-N 2.9Å; A25-V27 PolarHBondContact O-N 3.42Å
26	R	80.9	Confident	84	Confident	235 Å²	235	110.9 Å²	110.9	89%	0.887	61%	0.605	S	S	*	*			trans	-89.7	101.6	176.9	-62.9	-172.3	-169.2	-172.9	3.8	109.4	P24	P24-R26 PolarHBondContact O-N 3.44Å
27	V	78.1	Confident	84.2	Confident	122 Å²	122	109.7 Å²	109.7	74%	0.739	61%	0.609	S	S	*	*	P	Polyproline II helix	trans	-91.6	142.5	176.7	-155.7	0	0	0	0	108.9	A25 F29	A25-V27 PolarHBondContact O-N 3.42Å; V27-F29 PolarHBondContact O-N 3.43Å
28	P	80.9	Confident	84.5	Confident	122 Å²	122	108.2 Å²	108.2	79%	0.792	59%	0.594	S	S	*	*	P	Polyproline II helix	trans	-55.4	137.7	171.3	22.5	-34.4	0	0	0	111
29	F	80.2	Confident	84.8	Confident	143 Å²	143	106.1 Å²	106.1	63%	0.627	57%	0.567	S	S	*	*	P	Polyproline II helix	trans	-74.4	132.6	-179.6	178.2	-110.1	0	0	0	110.8	V27 F34	V27-F29 PolarHBondContact O-N 3.43Å; F29-F34 HydrophobicContact CE1-CB 3.55Å; F29-F34 HydrophobicContact CE1-CD2 4.08Å; F29-F34 HydrophobicContact CE1-CG 4.02Å; F29-F34 HydrophobicContact CZ-CB 3.78Å; F29-F34 HydrophobicContact CZ-CD2 4.23Å; F29-F34 HydrophobicContact CZ-CG 4.39Å
30	S	84.7	Confident	85.2	Confident	47 Å²	47	105 Å²	105	33%	0.329	56%	0.562	S	S	.	*	P	Polyproline II helix	trans	-82.8	121.1	178.2	163.2	0	0	0	0	110.8	K32 F33	S30-K32 PolarHBondContact O-N 3.16Å; S30-K32 PolarHBondContact OG-N 3.02Å; S30-F33 PolarHBondContact O-N 3.21Å
31	M	84.8	Confident	85.6	Confident	136 Å²	136	103.7 Å²	103.7	67%	0.67	56%	0.555	S	S	*	*	H	α-helix	trans	-61.8	-22.4	177.6	-69	-61.7	-138.4	0	0	113.3	F34 L35	M31-F34 WeakPolarHBondContact O-CB 3.48Å; M31-F34 PolarHBondContact O-N 3.02Å; M31-L35 WeakPolarHBondContact O-CG 3.47Å; M31-L35 PolarHBondContact O-N 3.27Å; M31-L35 VanDerWaalsContact O-N 3.09Å
32	K	84.3	Confident	86.1	Confident	104 Å²	104	105.2 Å²	105.2	45%	0.452	56%	0.559	S	S	.	*	H	α-helix	trans	-65.7	-45.5	178.6	-65.4	-170.9	177.7	-173.8	0	111.4	S30 F34 L35 V36	S30-K32 PolarHBondContact O-N 3.16Å; S30-K32 PolarHBondContact OG-N 3.02Å; K32-F34 PolarHBondContact O-N 3.34Å; K32-L35 PolarHBondContact O-N 3.09Å; K32-V36 WeakPolarHBondContact O-CG2 3.49Å; K32-V36 PolarHBondContact O-N 3.09Å; K32-V36 VanDerWaalsContact O-N 3.13Å
33	F	85.2	Confident	86.7	Confident	119 Å²	119	98.7 Å²	98.7	52%	0.522	53%	0.526	S	S	.	.	H	α-helix	trans	-64	-32.2	177.1	-66.5	-63.7	0	0	0	112.3	S30 A37 W91	S30-F33 PolarHBondContact O-N 3.21Å; F33-A37 WeakPolarHBondContact O-CB 3.37Å; F33-A37 PolarHBondContact O-N 3.32Å; F33-W91 HydrophobicContact CD1-CH2 4.28Å; F33-W91 AromaticContact CE1-CH2 3.62Å; F33-W91 HydrophobicContact CE1-CH2 3.62Å; F33-W91 HydrophobicContact CE1-CZ2 4.33Å; F33-W91 AromaticContact CE1-CZ3 3.94Å; F33-W91 HydrophobicContact CE1-CZ3 3.94Å
34	F	88.4	Confident	87.5	Confident	99 Å²	99	99.5 Å²	99.5	43%	0.434	52%	0.524	S	S	.	.	H	α-helix	trans	-65.1	-46.3	175.3	-174.4	-116.8	0	0	0	112.9	F29 M31 K32 A37 I38	F29-F34 HydrophobicContact CE1-CB 3.55Å; F29-F34 HydrophobicContact CE1-CD2 4.08Å; F29-F34 HydrophobicContact CE1-CG 4.02Å; F29-F34 HydrophobicContact CZ-CB 3.78Å; F29-F34 HydrophobicContact CZ-CD2 4.23Å; F29-F34 HydrophobicContact CZ-CG 4.39Å; M31-F34 WeakPolarHBondContact O-CB 3.48Å; M31-F34 PolarHBondContact O-N 3.02Å; K32-F34 PolarHBondContact O-N 3.34Å; F34-A37 PolarHBondContact O-N 3.34Å; F34-I38 HydrophobicContact CD1-CD1 3.77Å; F34-I38 HydrophobicContact CD2-CD1 4.46Å; F34-I38 HydrophobicContact CE1-CD1 3.3Å; F34-I38 HydrophobicContact CE1-CG1 4.44Å; F34-I38 HydrophobicContact CE2-CD1 4.05Å; F34-I38 HydrophobicContact CE2-CG1 4.44Å; F34-I38 HydrophobicContact CG-CD1 4.34Å; F34-I38 HydrophobicContact CZ-CD1 3.46Å; F34-I38 VanDerWaalsContact CZ-CD1 3.46Å; F34-I38 HydrophobicContact CZ-CG1 4.28Å; F34-I38 WeakPolarHBondContact O-CG1 3.41Å; F34-I38 PolarHBondContact O-N 3.41Å
35	L	88.8	Confident	88.2	Confident	87 Å²	87	99.3 Å²	99.3	46%	0.455	52%	0.517	S	S	.	.	H	α-helix	trans	-61.2	-46.3	178.4	-72.4	168.6	0	0	0	110.7	M31 K32 A37 I38 T39	M31-L35 WeakPolarHBondContact O-CG 3.47Å; M31-L35 PolarHBondContact O-N 3.27Å; M31-L35 VanDerWaalsContact O-N 3.09Å; K32-L35 PolarHBondContact O-N 3.09Å; L35-A37 VanDerWaalsContact C-N 3.29Å; L35-A37 PolarHBondContact O-N 3.13Å; L35-I38 PolarHBondContact O-N 3.2Å; L35-I38 VanDerWaalsContact O-N 3.16Å; L35-T39 WeakPolarHBondContact O-CG2 3.44Å; L35-T39 PolarHBondContact O-N 3.19Å; L35-T39 PolarHBondContact O-OG1 3.26Å
36	V	90.1	Very high	88.8	Confident	45 Å²	45	96.3 Å²	96.3	27%	0.273	49%	0.486	S	S	.	.	H	α-helix	trans	-59.1	-39.5	175.4	175.6	0	0	0	0	111.9	K32 T39 F40	K32-V36 WeakPolarHBondContact O-CG2 3.49Å; K32-V36 PolarHBondContact O-N 3.09Å; K32-V36 VanDerWaalsContact O-N 3.13Å; V36-T39 PolarHBondContact O-N 3.14Å; V36-T39 PolarHBondContact O-OG1 2.94Å; V36-F40 VanDerWaalsContact O-CB 3.3Å; V36-F40 WeakPolarHBondContact O-CB 3.18Å; V36-F40 PolarHBondContact O-N 3.08Å
37	A	92.3	Very high	89.5	Confident	56 Å²	56	89.7 Å²	89.7	46%	0.463	47%	0.467	S	S	.	.	H	α-helix	trans	-66.2	-39.1	177.7	0	0	0	0	0	112.5	F33 F34 L35 L41	F33-A37 WeakPolarHBondContact O-CB 3.37Å; F33-A37 PolarHBondContact O-N 3.32Å; F34-A37 PolarHBondContact O-N 3.34Å; L35-A37 VanDerWaalsContact C-N 3.29Å; L35-A37 PolarHBondContact O-N 3.13Å; A37-L41 WeakPolarHBondContact O-CB 2.96Å; A37-L41 PolarHBondContact O-N 3.33Å; A37-L41 VanDerWaalsContact O-N 3.09Å
38	I	92.4	Very high	90.4	Very high	69 Å²	69	86.8 Å²	86.8	35%	0.354	46%	0.456	S	S	.	.	H	α-helix	trans	-66.2	-44.1	175.5	-69.4	165.7	0	0	0	110.5	F34 L35 L41 L42	F34-I38 HydrophobicContact CD1-CD1 3.77Å; F34-I38 HydrophobicContact CD2-CD1 4.46Å; F34-I38 HydrophobicContact CE1-CD1 3.3Å; F34-I38 HydrophobicContact CE1-CG1 4.44Å; F34-I38 HydrophobicContact CE2-CD1 4.05Å; F34-I38 HydrophobicContact CE2-CG1 4.44Å; F34-I38 HydrophobicContact CG-CD1 4.34Å; F34-I38 HydrophobicContact CZ-CD1 3.46Å; F34-I38 VanDerWaalsContact CZ-CD1 3.46Å; F34-I38 HydrophobicContact CZ-CG1 4.28Å; F34-I38 WeakPolarHBondContact O-CG1 3.41Å; F34-I38 PolarHBondContact O-N 3.41Å; L35-I38 PolarHBondContact O-N 3.2Å; L35-I38 VanDerWaalsContact O-N 3.16Å; I38-L41 WeakPolarHBondContact O-CB 3.36Å; I38-L41 PolarHBondContact O-N 3.47Å; I38-L41 VanDerWaalsContact O-N 3.15Å; I38-L42 HydrophobicContact CG2-CD1 4.21Å; I38-L42 HydrophobicContact CG2-CG 4.48Å; I38-L42 WeakPolarHBondContact O-CG 3.46Å; I38-L42 PolarHBondContact O-N 3.2Å
39	T	91.5	Very high	91	Very high	24 Å²	24	85.7 Å²	85.7	15%	0.147	44%	0.442	C	S	.	.	H	α-helix	trans	-71.6	-35.6	-176.2	59.3	0	0	0	0	111.4	L35 V36 L41 L42 F43 E83	L35-T39 WeakPolarHBondContact O-CG2 3.44Å; L35-T39 PolarHBondContact O-N 3.19Å; L35-T39 PolarHBondContact O-OG1 3.26Å; V36-T39 PolarHBondContact O-N 3.14Å; V36-T39 PolarHBondContact O-OG1 2.94Å; T39-L41 PolarHBondContact O-N 3.29Å; T39-L42 PolarHBondContact O-N 3.42Å; T39-F43 WeakPolarHBondContact O-CD2 3.3Å; T39-F43 PolarHBondContact O-N 3.46Å; T39-E83 WeakPolarHBondContact CB-OE1 3.47Å; T39-E83 VanDerWaalsContact CB-OE2 3.26Å; T39-E83 WeakPolarHBondContact CB-OE2 3.43Å; T39-E83 WeakPolarHBondContact CG2-OE1 3.42Å; T39-E83 WeakPolarHBondContact CG2-OE2 3.47Å; T39-E83 PolarHBondContact OG1-OE1 3.26Å
40	F	92.9	Very high	91.7	Very high	139 Å²	139	80.5 Å²	80.5	61%	0.61	42%	0.421	S	S	*	.	H	α-helix	trans	-55.1	-47.4	165.3	172.5	-102.1	0	0	0	112.6	V36 L42 F43 D44	V36-F40 VanDerWaalsContact O-CB 3.3Å; V36-F40 WeakPolarHBondContact O-CB 3.18Å; V36-F40 PolarHBondContact O-N 3.08Å; F40-L42 PolarHBondContact O-N 2.89Å; F40-F43 PolarHBondContact O-N 3.48Å; F40-D44 WeakPolarHBondContact O-CB 3.07Å; F40-D44 PolarHBondContact O-N 3.35Å
41	L	95	Very high	92.2	Very high	110 Å²	110	83.8 Å²	83.8	58%	0.576	44%	0.435	S	S	*	.	H	α-helix	trans	-62.7	-41.5	-179.7	-174.2	155.2	0	0	0	112.2	A37 I38 T39 D44 L45	A37-L41 WeakPolarHBondContact O-CB 2.96Å; A37-L41 PolarHBondContact O-N 3.33Å; A37-L41 VanDerWaalsContact O-N 3.09Å; I38-L41 WeakPolarHBondContact O-CB 3.36Å; I38-L41 PolarHBondContact O-N 3.47Å; I38-L41 VanDerWaalsContact O-N 3.15Å; T39-L41 PolarHBondContact O-N 3.29Å; L41-D44 PolarHBondContact O-N 2.97Å; L41-L45 PolarHBondContact O-N 3Å
42	L	93.8	Very high	92.6	Very high	94 Å²	94	80.2 Å²	80.2	49%	0.492	42%	0.421	S	S	.	.	H	α-helix	trans	-65.9	-44.6	176.9	-68.1	176.1	0	0	0	111.7	I38 T39 F40 D44 L45 E46	I38-L42 HydrophobicContact CG2-CD1 4.21Å; I38-L42 HydrophobicContact CG2-CG 4.48Å; I38-L42 WeakPolarHBondContact O-CG 3.46Å; I38-L42 PolarHBondContact O-N 3.2Å; T39-L42 PolarHBondContact O-N 3.42Å; F40-L42 PolarHBondContact O-N 2.89Å; L42-D44 VanDerWaalsContact C-N 3.34Å; L42-D44 PolarHBondContact O-N 3.45Å; L42-L45 PolarHBondContact O-N 3.45Å; L42-E46 PolarHBondContact O-N 2.92Å; L42-E46 VanDerWaalsContact O-N 3.08Å
43	F	94.6	Very high	93	Very high	41 Å²	41	77.7 Å²	77.7	18%	0.18	41%	0.412	C	S	.	.	H	α-helix	trans	-64.4	-36.6	176.5	-76.1	-55.8	0	0	0	112.6	T39 F40 L45 E46 I47 L76 L80	T39-F43 WeakPolarHBondContact O-CD2 3.3Å; T39-F43 PolarHBondContact O-N 3.46Å; F40-F43 PolarHBondContact O-N 3.48Å; F43-L45 VanDerWaalsContact C-N 3.32Å; F43-L45 PolarHBondContact O-N 3.15Å; F43-E46 PolarHBondContact O-N 3.26Å; F43-I47 VanDerWaalsContact O-CG1 3.28Å; F43-I47 WeakPolarHBondContact O-CG1 3.16Å; F43-I47 PolarHBondContact O-N 2.91Å; F43-L76 HydrophobicContact CD1-CD1 4.24Å; F43-L76 HydrophobicContact CD1-CD2 4.11Å; F43-L76 HydrophobicContact CD1-CG 3.79Å; F43-L76 HydrophobicContact CE1-CD2 3.9Å; F43-L76 HydrophobicContact CE1-CG 3.76Å; F43-L80 HydrophobicContact CE1-CB 4.32Å; F43-L80 HydrophobicContact CE2-CD1 4.02Å; F43-L80 HydrophobicContact CZ-CB 3.74Å; F43-L80 HydrophobicContact CZ-CD1 3.89Å; F43-L80 HydrophobicContact CZ-CG 4.37Å
44	D	96.3	Very high	93.4	Very high	93 Å²	93	76 Å²	76	50%	0.497	41%	0.414	S	S	.	.	H	α-helix	trans	-63	-39.8	176.3	-166.9	35.6	0	0	0	111.5	F40 L41 L42 I47 A48	F40-D44 WeakPolarHBondContact O-CB 3.07Å; F40-D44 PolarHBondContact O-N 3.35Å; L41-D44 PolarHBondContact O-N 2.97Å; L42-D44 VanDerWaalsContact C-N 3.34Å; L42-D44 PolarHBondContact O-N 3.45Å; D44-I47 PolarHBondContact O-N 3.35Å; D44-A48 WeakPolarHBondContact O-CB 3.45Å; D44-A48 PolarHBondContact O-N 3.42Å
45	L	95.9	Very high	93.6	Very high	100 Å²	100	79.9 Å²	79.9	52%	0.524	43%	0.426	S	S	.	.	H	α-helix	trans	-63.1	-44.9	173.5	-172.8	157.3	0	0	0	111.7	L41 L42 F43 A48 L49	L41-L45 PolarHBondContact O-N 3Å; L42-L45 PolarHBondContact O-N 3.45Å; F43-L45 VanDerWaalsContact C-N 3.32Å; F43-L45 PolarHBondContact O-N 3.15Å; L45-A48 WeakPolarHBondContact O-CB 3.13Å; L45-A48 PolarHBondContact O-N 2.95Å; L45-L49 HydrophobicContact CD2-CD1 3.87Å; L45-L49 HydrophobicContact CD2-CG 4.34Å; L45-L49 PolarHBondContact O-N 3.26Å; L45-L49 VanDerWaalsContact O-N 3.14Å
46	E	94.2	Very high	93.7	Very high	38 Å²	38	76.9 Å²	76.9	18%	0.178	41%	0.413	C	S	.	.	H	α-helix	trans	-65.6	-37.7	178.3	-69.2	-176.5	174	0	0	112.2	L42 F43 A48 L49 L50 L72 L76	L42-E46 PolarHBondContact O-N 2.92Å; L42-E46 VanDerWaalsContact O-N 3.08Å; F43-E46 PolarHBondContact O-N 3.26Å; E46-A48 VanDerWaalsContact C-N 3.35Å; E46-L49 WeakPolarHBondContact O-CB 3.29Å; E46-L49 PolarHBondContact O-N 3.09Å; E46-L50 WeakPolarHBondContact O-CG 3.42Å; E46-L50 PolarHBondContact O-N 3.25Å; E46-L50 VanDerWaalsContact O-N 3.14Å; E46-L72 HydrophobicContact CB-CD2 4.46Å; E46-L76 HydrophobicContact CB-CD1 4.05Å; E46-L76 WeakPolarHBondContact OE2-CA 3.26Å; E46-L76 VanDerWaalsContact OE2-CB 3.26Å; E46-L76 WeakPolarHBondContact OE2-CB 3.38Å; E46-L76 WeakPolarHBondContact OE2-CD1 3.34Å; E46-L76 VanDerWaalsContact OE2-CG 3.22Å; E46-L76 WeakPolarHBondContact OE2-CG 3.48Å
47	I	95.1	Very high	93.8	Very high	95 Å²	95	80 Å²	80	49%	0.487	43%	0.428	S	S	.	.	H	α-helix	trans	-64.7	-40.2	173.6	-69.1	166.7	0	0	0	110.7	F43 D44 L49 L50 L51	F43-I47 VanDerWaalsContact O-CG1 3.28Å; F43-I47 WeakPolarHBondContact O-CG1 3.16Å; F43-I47 PolarHBondContact O-N 2.91Å; D44-I47 PolarHBondContact O-N 3.35Å; I47-L49 PolarHBondContact O-N 3.03Å; I47-L50 PolarHBondContact O-N 3.22Å; I47-L51 PolarHBondContact O-N 3.13Å
48	A	96.6	Very high	93.7	Very high	61 Å²	61	85.4 Å²	85.4	50%	0.504	44%	0.444	S	S	.	.	H	α-helix	trans	-59.5	-34.5	174.7	0	0	0	0	0	112	D44 L45 E46 L51	D44-A48 WeakPolarHBondContact O-CB 3.45Å; D44-A48 PolarHBondContact O-N 3.42Å; L45-A48 WeakPolarHBondContact O-CB 3.13Å; L45-A48 PolarHBondContact O-N 2.95Å; E46-A48 VanDerWaalsContact C-N 3.35Å; A48-L51 WeakPolarHBondContact O-CB 3.46Å
49	L	94.1	Very high	93.7	Very high	99 Å²	99	85.2 Å²	85.2	52%	0.518	45%	0.446	S	S	.	.	H	α-helix	trans	-71.4	-27.7	173.5	-66.1	173.2	0	0	0	113.4	L45 E46 I47 P52 L72	L45-L49 HydrophobicContact CD2-CD1 3.87Å; L45-L49 HydrophobicContact CD2-CG 4.34Å; L45-L49 PolarHBondContact O-N 3.26Å; L45-L49 VanDerWaalsContact O-N 3.14Å; E46-L49 WeakPolarHBondContact O-CB 3.29Å; E46-L49 PolarHBondContact O-N 3.09Å; I47-L49 PolarHBondContact O-N 3.03Å; L49-P52 WeakPolarHBondContact O-CD 3.22Å; L49-L72 HydrophobicContact CB-CD1 4.06Å
50	L	94.4	Very high	93.5	Very high	35 Å²	35	90.6 Å²	90.6	18%	0.183	48%	0.479	C	S	.	.	H	α-helix	trans	-82.7	-21.7	176.1	-67.2	172.4	0	0	0	113.2	E46 I47 P52 L53 L72 I73 L76	E46-L50 WeakPolarHBondContact O-CG 3.42Å; E46-L50 PolarHBondContact O-N 3.25Å; E46-L50 VanDerWaalsContact O-N 3.14Å; I47-L50 PolarHBondContact O-N 3.22Å; L50-P52 VanDerWaalsContact C-CD 3.44Å; L50-L53 HydrophobicContact CB-CD1 4.15Å; L50-L53 HydrophobicContact CD2-CD1 3.67Å; L50-L53 VanDerWaalsContact O-CB 3.29Å; L50-L53 WeakPolarHBondContact O-CB 3.28Å; L50-L53 WeakPolarHBondContact O-CD1 3.49Å; L50-L53 WeakPolarHBondContact O-CG 3.33Å; L50-L53 PolarHBondContact O-N 2.97Å; L50-L53 VanDerWaalsContact O-N 3.13Å; L50-L72 HydrophobicContact CD2-CB 4.31Å; L50-L72 HydrophobicContact CD2-CD1 4.29Å; L50-L72 HydrophobicContact CD2-CD2 4.18Å; L50-L72 HydrophobicContact CD2-CG 4.49Å; L50-L72 HydrophobicContact CG-CD2 4.26Å; L50-I73 HydrophobicContact CD1-CG1 4.41Å; L50-I73 HydrophobicContact CD2-CG1 4.13Å; L50-L76 HydrophobicContact CD1-CD1 4.34Å
51	L	95.5	Very high	93.5	Very high	116 Å²	116	88.8 Å²	88.8	61%	0.607	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.3	-40.3	-179.5	-160.3	152.9	0	0	0	115.1	I47 A48 L53 P54 W55	I47-L51 PolarHBondContact O-N 3.13Å; A48-L51 WeakPolarHBondContact O-CB 3.46Å; L51-L53 PolarHBondContact O-N 3Å; L51-P54 WeakPolarHBondContact O-CD 3.47Å; L51-W55 HydrophobicContact CD2-CZ3 4.45Å
52	P	93.4	Very high	93.4	Very high	60 Å²	60	87.5 Å²	87.5	39%	0.39	47%	0.468	S	S	.	.	T	Hydrogen-bonded Turn	trans	-76.1	0.5	179.8	30.2	-36.6	0	0	0	115.2	L49 L50 P54 W55 A56	L49-P52 WeakPolarHBondContact O-CD 3.22Å; L50-P52 VanDerWaalsContact C-CD 3.44Å; P52-P54 VanDerWaalsContact C-CD 3.44Å; P52-W55 HydrophobicContact CB-CE3 4.04Å; P52-W55 HydrophobicContact CB-CZ3 4.48Å; P52-W55 PolarHBondContact O-N 3.3Å; P52-W55 VanDerWaalsContact O-N 3.09Å; P52-A56 PolarHBondContact O-N 3.04Å
53	L	93	Very high	93.4	Very high	51 Å²	51	87.6 Å²	87.6	27%	0.267	48%	0.475	S	S	.	.	H	α-helix	trans	-55.5	-39.3	-178.4	-73.9	175.3	0	0	0	115.2	L50 L51 W55 A56 L57	L50-L53 HydrophobicContact CB-CD1 4.15Å; L50-L53 HydrophobicContact CD2-CD1 3.67Å; L50-L53 VanDerWaalsContact O-CB 3.29Å; L50-L53 WeakPolarHBondContact O-CB 3.28Å; L50-L53 WeakPolarHBondContact O-CD1 3.49Å; L50-L53 WeakPolarHBondContact O-CG 3.33Å; L50-L53 PolarHBondContact O-N 2.97Å; L50-L53 VanDerWaalsContact O-N 3.13Å; L51-L53 PolarHBondContact O-N 3Å; L53-W55 PolarHBondContact O-N 3.37Å; L53-A56 WeakPolarHBondContact O-CB 3.26Å; L53-A56 PolarHBondContact O-N 3.36Å; L53-L57 PolarHBondContact O-N 3.14Å
54	P	92.4	Very high	93.3	Very high	85 Å²	85	91.4 Å²	91.4	55%	0.552	50%	0.496	S	S	*	.	H	α-helix	trans	-59.2	-34.5	176.8	-25.4	36.3	0	0	0	113.1	L51 P52	L51-P54 WeakPolarHBondContact O-CD 3.47Å; P52-P54 VanDerWaalsContact C-CD 3.44Å
55	W	92.8	Very high	93.2	Very high	180 Å²	180	88 Å²	88	68%	0.682	48%	0.478	S	S	*	.	H	α-helix	trans	-77.4	-34.6	174.3	-59.6	-46.6	0	0	0	111.8	L51 P52 L53 L57 Q58	L51-W55 HydrophobicContact CD2-CZ3 4.45Å; P52-W55 HydrophobicContact CB-CE3 4.04Å; P52-W55 HydrophobicContact CB-CZ3 4.48Å; P52-W55 PolarHBondContact O-N 3.3Å; P52-W55 VanDerWaalsContact O-N 3.09Å; L53-W55 PolarHBondContact O-N 3.37Å; W55-L57 PolarHBondContact O-N 3.48Å; W55-Q58 PolarHBondContact O-N 3.35Å; W55-Q58 VanDerWaalsContact O-N 3.1Å
56	A	91.9	Very high	93.1	Very high	24 Å²	24	86.3 Å²	86.3	20%	0.198	47%	0.472	C	S	.	.	H	α-helix	trans	-62.9	-21.8	177.8	0	0	0	0	0	113.3	P52 L53 Q58 T59 M65	P52-A56 PolarHBondContact O-N 3.04Å; L53-A56 WeakPolarHBondContact O-CB 3.26Å; L53-A56 PolarHBondContact O-N 3.36Å; A56-Q58 PolarHBondContact O-N 3.19Å; A56-T59 WeakPolarHBondContact O-CB 3.4Å; A56-T59 VanDerWaalsContact O-CG2 3.27Å; A56-T59 WeakPolarHBondContact O-CG2 3.28Å; A56-T59 PolarHBondContact O-N 3.21Å; A56-T59 VanDerWaalsContact O-N 3.16Å; A56-T59 PolarHBondContact O-OG1 3.24Å; A56-M65 HydrophobicContact CB-CG 3.81Å; A56-M65 HydrophobicContact CB-SD 4.43Å; A56-M65 WeakPolarHBondContact O-CE 3.44Å
57	L	91.2	Very high	93.1	Very high	111 Å²	111	90.5 Å²	90.5	58%	0.581	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.9	-18.2	173.1	-72.8	165.9	0	0	0	114.1	L53 W55 T59 L62 M65	L53-L57 PolarHBondContact O-N 3.14Å; W55-L57 PolarHBondContact O-N 3.48Å; L57-T59 VanDerWaalsContact C-N 3.32Å; L57-L62 WeakPolarHBondContact O-CD2 3.27Å; L57-M65 HydrophobicContact CB-CE 4.36Å; L57-M65 HydrophobicContact CD2-CE 3.65Å; L57-M65 HydrophobicContact CG-CE 4.07Å
58	Q	91.5	Very high	93	Very high	169 Å²	169	89.1 Å²	89.1	79%	0.79	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.8	2	179	-59.6	177.1	-1.8	0	0	112.9	W55 A56	W55-Q58 PolarHBondContact O-N 3.35Å; W55-Q58 VanDerWaalsContact O-N 3.1Å; A56-Q58 PolarHBondContact O-N 3.19Å
59	T	91	Very high	92.9	Very high	65 Å²	65	87 Å²	87	40%	0.399	47%	0.473	S	S	.	.	S	Bend	trans	-74.9	153.8	-178	60.1	0	0	0	0	112.6	A56 L57 N61	A56-T59 WeakPolarHBondContact O-CB 3.4Å; A56-T59 VanDerWaalsContact O-CG2 3.27Å; A56-T59 WeakPolarHBondContact O-CG2 3.28Å; A56-T59 PolarHBondContact O-N 3.21Å; A56-T59 VanDerWaalsContact O-N 3.16Å; A56-T59 PolarHBondContact O-OG1 3.24Å; L57-T59 VanDerWaalsContact C-N 3.32Å; T59-N61 VanDerWaalsContact C-N 3.3Å; T59-N61 PolarHBondContact O-N 3.13Å
60	T	88.5	Confident	92.9	Very high	136 Å²	136	86.2 Å²	86.2	83%	0.834	47%	0.469	S	S	*	.	S	Bend	trans	-67.6	-30.3	179.7	52	0	0	0	0	112.8
61	N	92.9	Very high	93	Very high	101 Å²	101	89.6 Å²	89.6	54%	0.54	49%	0.487	S	S	.	.			trans	-104.3	65.9	-177.8	-69.7	-38.3	0	0	0	112	T59 P63 L64 M65	T59-N61 VanDerWaalsContact C-N 3.3Å; T59-N61 PolarHBondContact O-N 3.13Å; N61-P63 VanDerWaalsContact C-CD 3.47Å; N61-L64 HydrophobicContact CB-CB 4.27Å; N61-L64 PolarHBondContact O-N 3.1Å; N61-M65 PolarHBondContact O-N 3.19Å
62	L	92.2	Very high	93	Very high	83 Å²	83	86.2 Å²	86.2	44%	0.435	47%	0.469	S	S	.	.	H	α-helix	trans	-50.1	-47.1	174.5	-72.7	174.8	0	0	0	115.4	L57 L64 M65 V66	L57-L62 WeakPolarHBondContact O-CD2 3.27Å; L62-L64 VanDerWaalsContact C-N 3.32Å; L62-L64 PolarHBondContact O-N 3.18Å; L62-M65 HydrophobicContact CD2-CE 3.82Å; L62-M65 PolarHBondContact O-N 3.19Å; L62-V66 WeakPolarHBondContact O-CG2 3.38Å; L62-V66 PolarHBondContact O-N 3.05Å
63	P	93.1	Very high	93.1	Very high	96 Å²	96	87.1 Å²	87.1	62%	0.623	47%	0.47	S	S	*	.	H	α-helix	trans	-64.9	-36.5	-176.1	23.6	-33.4	0	0	0	112.5	N61 M67	N61-P63 VanDerWaalsContact C-CD 3.47Å; P63-M67 WeakPolarHBondContact O-CB 3.31Å; P63-M67 WeakPolarHBondContact O-CG 3.37Å; P63-M67 PolarHBondContact O-N 3.08Å
64	L	93.3	Very high	93.2	Very high	121 Å²	121	89.5 Å²	89.5	63%	0.634	48%	0.482	S	S	*	.	H	α-helix	trans	-67.3	-44.4	176.9	-179.3	64.7	0	0	0	111.1	N61 L62 M67 S68	N61-L64 HydrophobicContact CB-CB 4.27Å; N61-L64 PolarHBondContact O-N 3.1Å; L62-L64 VanDerWaalsContact C-N 3.32Å; L62-L64 PolarHBondContact O-N 3.18Å; L64-M67 PolarHBondContact O-N 2.86Å; L64-S68 PolarHBondContact O-N 3.16Å; L64-S68 PolarHBondContact O-OG 2.95Å
65	M	93.9	Very high	93.4	Very high	21 Å²	21	89.6 Å²	89.6	10%	0.103	48%	0.476	C	S	.	.	H	α-helix	trans	-59.7	-49.2	177.4	175.5	-86.6	-80.3	0	0	111	A56 L57 N61 L62 M67 S68 S69	A56-M65 HydrophobicContact CB-CG 3.81Å; A56-M65 HydrophobicContact CB-SD 4.43Å; A56-M65 WeakPolarHBondContact O-CE 3.44Å; L57-M65 HydrophobicContact CB-CE 4.36Å; L57-M65 HydrophobicContact CD2-CE 3.65Å; L57-M65 HydrophobicContact CG-CE 4.07Å; N61-M65 PolarHBondContact O-N 3.19Å; L62-M65 HydrophobicContact CD2-CE 3.82Å; L62-M65 PolarHBondContact O-N 3.19Å; M65-M67 VanDerWaalsContact C-N 3.35Å; M65-M67 PolarHBondContact O-N 3.37Å; M65-S68 PolarHBondContact O-N 2.73Å; M65-S68 VanDerWaalsContact O-N 3.17Å; M65-S68 PolarHBondContact O-OG 3.33Å; M65-S69 PolarHBondContact O-N 3.04Å; M65-S69 PolarHBondContact O-OG 3.42Å
66	V	93.6	Very high	93.5	Very high	66 Å²	66	82.9 Å²	82.9	40%	0.4	45%	0.454	S	S	.	.	H	α-helix	trans	-61.9	-41.2	178.8	172.4	0	0	0	0	111.7	L62 S68 S69 L70	L62-V66 WeakPolarHBondContact O-CG2 3.38Å; L62-V66 PolarHBondContact O-N 3.05Å; V66-S68 PolarHBondContact O-N 3.25Å; V66-S69 WeakPolarHBondContact CA-OG 3.38Å; V66-S69 PolarHBondContact O-N 3.19Å; V66-S69 PolarHBondContact O-OG 2.98Å; V66-L70 HydrophobicContact CG1-CD1 3.81Å; V66-L70 HydrophobicContact CG1-CG 4.33Å; V66-L70 WeakPolarHBondContact O-CB 3.3Å; V66-L70 VanDerWaalsContact O-CG 3.25Å; V66-L70 WeakPolarHBondContact O-CG 3.32Å; V66-L70 PolarHBondContact O-N 3.39Å
67	M	94.8	Very high	93.6	Very high	125 Å²	125	84.3 Å²	84.3	62%	0.616	47%	0.466	S	S	*	.	H	α-helix	trans	-61	-45	175.2	-72.5	-95.7	82.3	0	0	111.5	P63 L64 M65 L71	P63-M67 WeakPolarHBondContact O-CB 3.31Å; P63-M67 WeakPolarHBondContact O-CG 3.37Å; P63-M67 PolarHBondContact O-N 3.08Å; L64-M67 PolarHBondContact O-N 2.86Å; M65-M67 VanDerWaalsContact C-N 3.35Å; M65-M67 PolarHBondContact O-N 3.37Å; M67-L71 WeakPolarHBondContact O-CB 3.49Å; M67-L71 PolarHBondContact O-N 2.94Å
68	S	93	Very high	93.8	Very high	67 Å²	67	84.4 Å²	84.4	47%	0.469	47%	0.466	S	S	.	.	H	α-helix	trans	-66.8	-40.2	179.5	68.6	0	0	0	0	112.9	L64 M65 V66 L71 L72	L64-S68 PolarHBondContact O-N 3.16Å; L64-S68 PolarHBondContact O-OG 2.95Å; M65-S68 PolarHBondContact O-N 2.73Å; M65-S68 VanDerWaalsContact O-N 3.17Å; M65-S68 PolarHBondContact O-OG 3.33Å; V66-S68 PolarHBondContact O-N 3.25Å; S68-L71 PolarHBondContact O-N 3.32Å; S68-L72 PolarHBondContact O-N 3.44Å
69	S	94	Very high	93.9	Very high	17 Å²	17	78.5 Å²	78.5	12%	0.119	44%	0.443	C	S	.	.	H	α-helix	trans	-68.6	-40.4	178.3	65.6	0	0	0	0	111.8	M65 V66 L71 L72 I73	M65-S69 PolarHBondContact O-N 3.04Å; M65-S69 PolarHBondContact O-OG 3.42Å; V66-S69 WeakPolarHBondContact CA-OG 3.38Å; V66-S69 PolarHBondContact O-N 3.19Å; V66-S69 PolarHBondContact O-OG 2.98Å; S69-L71 VanDerWaalsContact C-N 3.35Å; S69-L72 PolarHBondContact O-N 3.4Å; S69-I73 VanDerWaalsContact O-CG1 3.31Å; S69-I73 WeakPolarHBondContact O-CG1 3.37Å; S69-I73 PolarHBondContact O-N 3.26Å
70	L	95.3	Very high	94	Very high	82 Å²	82	78.9 Å²	78.9	43%	0.429	44%	0.443	S	S	.	.	H	α-helix	trans	-63.6	-41.6	174.7	-75.2	171.4	0	0	0	111.5	V66 L72 I73 I74	V66-L70 HydrophobicContact CG1-CD1 3.81Å; V66-L70 HydrophobicContact CG1-CG 4.33Å; V66-L70 WeakPolarHBondContact O-CB 3.3Å; V66-L70 VanDerWaalsContact O-CG 3.25Å; V66-L70 WeakPolarHBondContact O-CG 3.32Å; V66-L70 PolarHBondContact O-N 3.39Å; L70-L72 VanDerWaalsContact C-N 3.31Å; L70-L72 PolarHBondContact O-N 3.41Å; L70-I73 PolarHBondContact O-N 3.43Å; L70-I74 WeakPolarHBondContact O-CB 3.42Å; L70-I74 WeakPolarHBondContact O-CD1 3.29Å; L70-I74 VanDerWaalsContact O-CG1 3.24Å; L70-I74 WeakPolarHBondContact O-CG1 3.38Å; L70-I74 PolarHBondContact O-N 3.31Å
71	L	95.6	Very high	94.2	Very high	106 Å²	106	74.6 Å²	74.6	56%	0.555	42%	0.421	S	S	*	.	H	α-helix	trans	-60	-43	176.1	-176.9	147.8	0	0	0	111.4	M67 S68 S69 I74 I75	M67-L71 WeakPolarHBondContact O-CB 3.49Å; M67-L71 PolarHBondContact O-N 2.94Å; S68-L71 PolarHBondContact O-N 3.32Å; S69-L71 VanDerWaalsContact C-N 3.35Å; L71-I74 PolarHBondContact O-N 3.06Å; L71-I75 HydrophobicContact CD2-CD1 3.55Å; L71-I75 HydrophobicContact CD2-CG1 4.46Å; L71-I75 HydrophobicContact CG-CD1 4.41Å; L71-I75 WeakPolarHBondContact O-CG1 3.47Å; L71-I75 PolarHBondContact O-N 3.31Å
72	L	94.8	Very high	94.3	Very high	44 Å²	44	77.1 Å²	77.1	23%	0.23	42%	0.424	C	S	.	.	H	α-helix	trans	-63.3	-45.2	177.9	-145.9	166.6	0	0	0	111.3	E46 L49 L50 S68 S69 L70 I74 I75 L76	E46-L72 HydrophobicContact CB-CD2 4.46Å; L49-L72 HydrophobicContact CB-CD1 4.06Å; L50-L72 HydrophobicContact CD2-CB 4.31Å; L50-L72 HydrophobicContact CD2-CD1 4.29Å; L50-L72 HydrophobicContact CD2-CD2 4.18Å; L50-L72 HydrophobicContact CD2-CG 4.49Å; L50-L72 HydrophobicContact CG-CD2 4.26Å; S68-L72 PolarHBondContact O-N 3.44Å; S69-L72 PolarHBondContact O-N 3.4Å; L70-L72 VanDerWaalsContact C-N 3.31Å; L70-L72 PolarHBondContact O-N 3.41Å; L72-I74 VanDerWaalsContact C-N 3.33Å; L72-I74 PolarHBondContact O-N 3.34Å; L72-I75 PolarHBondContact O-N 3.07Å; L72-L76 PolarHBondContact O-N 3.01Å; L72-L76 VanDerWaalsContact O-N 3.08Å
73	I	95.6	Very high	94.2	Very high	80 Å²	80	74.5 Å²	74.5	41%	0.41	41%	0.41	S	S	.	.	H	α-helix	trans	-63.2	-38.4	176.9	-65.8	163.2	0	0	0	111.6	L50 S69 L70 L76 A77	L50-I73 HydrophobicContact CD1-CG1 4.41Å; L50-I73 HydrophobicContact CD2-CG1 4.13Å; S69-I73 VanDerWaalsContact O-CG1 3.31Å; S69-I73 WeakPolarHBondContact O-CG1 3.37Å; S69-I73 PolarHBondContact O-N 3.26Å; L70-I73 PolarHBondContact O-N 3.43Å; I73-L76 PolarHBondContact O-N 3.35Å; I73-A77 WeakPolarHBondContact O-CB 3.45Å; I73-A77 PolarHBondContact O-N 3.06Å
74	I	96.7	Very high	94.1	Very high	100 Å²	100	78.2 Å²	78.2	51%	0.513	41%	0.412	S	S	.	.	H	α-helix	trans	-64.2	-42.3	177	-71.8	164.3	0	0	0	110.9	L70 L71 L72 A77 L78	L70-I74 WeakPolarHBondContact O-CB 3.42Å; L70-I74 WeakPolarHBondContact O-CD1 3.29Å; L70-I74 VanDerWaalsContact O-CG1 3.24Å; L70-I74 WeakPolarHBondContact O-CG1 3.38Å; L70-I74 PolarHBondContact O-N 3.31Å; L71-I74 PolarHBondContact O-N 3.06Å; L72-I74 VanDerWaalsContact C-N 3.33Å; L72-I74 PolarHBondContact O-N 3.34Å; I74-A77 PolarHBondContact O-N 2.9Å; I74-L78 HydrophobicContact CG2-CD1 3.85Å; I74-L78 HydrophobicContact CG2-CG 4.32Å; I74-L78 WeakPolarHBondContact O-CB 3.35Å; I74-L78 VanDerWaalsContact O-CG 3.3Å; I74-L78 WeakPolarHBondContact O-CG 3.37Å; I74-L78 PolarHBondContact O-N 3.08Å
75	I	95.1	Very high	94.1	Very high	87 Å²	87	79 Å²	79	45%	0.446	42%	0.416	S	S	.	.	H	α-helix	trans	-62	-45.3	177.3	-68.7	170.2	0	0	0	110.5	L71 L72 A77 L78 S79	L71-I75 HydrophobicContact CD2-CD1 3.55Å; L71-I75 HydrophobicContact CD2-CG1 4.46Å; L71-I75 HydrophobicContact CG-CD1 4.41Å; L71-I75 WeakPolarHBondContact O-CG1 3.47Å; L71-I75 PolarHBondContact O-N 3.31Å; L72-I75 PolarHBondContact O-N 3.07Å; I75-A77 VanDerWaalsContact C-N 3.34Å; I75-A77 PolarHBondContact O-N 2.93Å; I75-L78 PolarHBondContact O-N 3.43Å; I75-S79 PolarHBondContact O-N 3.32Å; I75-S79 PolarHBondContact O-OG 3.33Å
76	L	94.9	Very high	93.9	Very high	39 Å²	39	83.8 Å²	83.8	20%	0.204	44%	0.438	C	S	.	.	H	α-helix	trans	-59	-44.1	176	-170.3	157	0	0	0	111.7	F43 E46 L50 L72 I73 S79 L80	F43-L76 HydrophobicContact CD1-CD1 4.24Å; F43-L76 HydrophobicContact CD1-CD2 4.11Å; F43-L76 HydrophobicContact CD1-CG 3.79Å; F43-L76 HydrophobicContact CE1-CD2 3.9Å; F43-L76 HydrophobicContact CE1-CG 3.76Å; E46-L76 HydrophobicContact CB-CD1 4.05Å; E46-L76 WeakPolarHBondContact OE2-CA 3.26Å; E46-L76 VanDerWaalsContact OE2-CB 3.26Å; E46-L76 WeakPolarHBondContact OE2-CB 3.38Å; E46-L76 WeakPolarHBondContact OE2-CD1 3.34Å; E46-L76 VanDerWaalsContact OE2-CG 3.22Å; E46-L76 WeakPolarHBondContact OE2-CG 3.48Å; L50-L76 HydrophobicContact CD1-CD1 4.34Å; L72-L76 PolarHBondContact O-N 3.01Å; L72-L76 VanDerWaalsContact O-N 3.08Å; I73-L76 PolarHBondContact O-N 3.35Å; L76-S79 PolarHBondContact O-OG 3.17Å; L76-L80 PolarHBondContact O-N 3.39Å
77	A	95.1	Very high	93.4	Very high	54 Å²	54	87.6 Å²	87.6	45%	0.446	45%	0.449	S	S	.	.	H	α-helix	trans	-66.1	-38.8	177.5	0	0	0	0	0	112.3	I73 I74 I75 A81	I73-A77 WeakPolarHBondContact O-CB 3.45Å; I73-A77 PolarHBondContact O-N 3.06Å; I74-A77 PolarHBondContact O-N 2.9Å; I75-A77 VanDerWaalsContact C-N 3.34Å; I75-A77 PolarHBondContact O-N 2.93Å; A77-A81 VanDerWaalsContact O-CB 3.3Å; A77-A81 WeakPolarHBondContact O-CB 3.25Å; A77-A81 PolarHBondContact O-N 2.72Å
78	L	95.7	Very high	92.8	Very high	113 Å²	113	82.7 Å²	82.7	59%	0.592	43%	0.431	S	S	*	.	H	α-helix	trans	-69.5	-39.9	178.2	-75	172.3	0	0	0	112.4	I74 I75 A81 Y82	I74-L78 HydrophobicContact CG2-CD1 3.85Å; I74-L78 HydrophobicContact CG2-CG 4.32Å; I74-L78 WeakPolarHBondContact O-CB 3.35Å; I74-L78 VanDerWaalsContact O-CG 3.3Å; I74-L78 WeakPolarHBondContact O-CG 3.37Å; I74-L78 PolarHBondContact O-N 3.08Å; I75-L78 PolarHBondContact O-N 3.43Å; L78-A81 PolarHBondContact O-N 3.17Å; L78-Y82 WeakPolarHBondContact O-CB 3.3Å; L78-Y82 PolarHBondContact O-N 3.36Å
79	S	92.8	Very high	92.2	Very high	45 Å²	45	81.9 Å²	81.9	32%	0.315	42%	0.421	S	S	.	.	H	α-helix	trans	-62.8	-45.4	177	62.7	0	0	0	0	110.9	I75 L76 Y82 E83	I75-S79 PolarHBondContact O-N 3.32Å; I75-S79 PolarHBondContact O-OG 3.33Å; L76-S79 PolarHBondContact O-OG 3.17Å; S79-Y82 PolarHBondContact O-N 3.28Å; S79-E83 PolarHBondContact O-N 2.96Å
80	L	92.6	Very high	91.7	Very high	73 Å²	73	84.3 Å²	84.3	38%	0.382	43%	0.432	S	S	.	.	H	α-helix	trans	-62	-45.6	174.9	-174.8	64.6	0	0	0	112.1	F43 L76 Y82 E83 W84 L89	F43-L80 HydrophobicContact CE1-CB 4.32Å; F43-L80 HydrophobicContact CE2-CD1 4.02Å; F43-L80 HydrophobicContact CZ-CB 3.74Å; F43-L80 HydrophobicContact CZ-CD1 3.89Å; F43-L80 HydrophobicContact CZ-CG 4.37Å; L76-L80 PolarHBondContact O-N 3.39Å; L80-Y82 VanDerWaalsContact C-N 3.3Å; L80-Y82 PolarHBondContact O-N 3.41Å; L80-E83 PolarHBondContact O-N 3.01Å; L80-W84 WeakPolarHBondContact O-CB 3.24Å; L80-W84 PolarHBondContact O-N 3.36Å; L80-L89 HydrophobicContact CD1-CD1 4.2Å
81	A	94.3	Very high	90.6	Very high	47 Å²	47	89.2 Å²	89.2	39%	0.388	45%	0.445	S	S	.	.	H	α-helix	trans	-61.9	-39	178.9	0	0	0	0	0	112	A77 L78 L85	A77-A81 VanDerWaalsContact O-CB 3.3Å; A77-A81 WeakPolarHBondContact O-CB 3.25Å; A77-A81 PolarHBondContact O-N 2.72Å; L78-A81 PolarHBondContact O-N 3.17Å; A81-L85 WeakPolarHBondContact O-CB 3.5Å; A81-L85 WeakPolarHBondContact O-CD1 3.49Å; A81-L85 VanDerWaalsContact O-CG 3.29Å; A81-L85 WeakPolarHBondContact O-CG 3.47Å; A81-L85 PolarHBondContact O-N 3.5Å
82	Y	93.5	Very high	89.1	Confident	154 Å²	154	89.1 Å²	89.1	60%	0.604	45%	0.449	S	S	*	.	H	α-helix	trans	-63.3	-48.1	175.6	179	-98	0	0	0	111.6	L78 S79 L80 W84 L85 Q86	L78-Y82 WeakPolarHBondContact O-CB 3.3Å; L78-Y82 PolarHBondContact O-N 3.36Å; S79-Y82 PolarHBondContact O-N 3.28Å; L80-Y82 VanDerWaalsContact C-N 3.3Å; L80-Y82 PolarHBondContact O-N 3.41Å; Y82-W84 VanDerWaalsContact C-N 3.31Å; Y82-W84 PolarHBondContact O-N 3.33Å; Y82-L85 PolarHBondContact O-N 2.92Å; Y82-Q86 HydrophobicContact CD1-CG 4.39Å; Y82-Q86 HydrophobicContact CE1-CG 4Å; Y82-Q86 HydrophobicContact CE2-CG 4.29Å; Y82-Q86 WeakPolarHBondContact O-CG 3.43Å; Y82-Q86 PolarHBondContact O-N 3.36Å; Y82-Q86 VanDerWaalsContact O-N 3.08Å
83	E	91.6	Very high	87.3	Confident	27 Å²	27	99.4 Å²	99.4	13%	0.126	50%	0.496	C	S	.	.	H	α-helix	trans	-63.9	-38.1	179.7	-166.3	-179.8	177.3	0	0	112.3	T39 S79 L80 Q86 K87 G88 L89	T39-E83 WeakPolarHBondContact CB-OE1 3.47Å; T39-E83 VanDerWaalsContact CB-OE2 3.26Å; T39-E83 WeakPolarHBondContact CB-OE2 3.43Å; T39-E83 WeakPolarHBondContact CG2-OE1 3.42Å; T39-E83 WeakPolarHBondContact CG2-OE2 3.47Å; T39-E83 PolarHBondContact OG1-OE1 3.26Å; S79-E83 PolarHBondContact O-N 2.96Å; L80-E83 PolarHBondContact O-N 3.01Å; E83-Q86 PolarHBondContact O-N 2.9Å; E83-K87 PolarHBondContact O-N 2.97Å; E83-G88 PolarHBondContact O-N 2.99Å; E83-L89 HydrophobicContact CG-CG 4.33Å
84	W	90.3	Very high	86.8	Confident	175 Å²	175	100.4 Å²	100.4	66%	0.663	50%	0.501	S	S	*	.	H	α-helix	trans	-61.4	-47.9	173.6	-170	-68.9	0	0	0	111.9	L80 Y82 Q86 K87 L89	L80-W84 WeakPolarHBondContact O-CB 3.24Å; L80-W84 PolarHBondContact O-N 3.36Å; Y82-W84 VanDerWaalsContact C-N 3.31Å; Y82-W84 PolarHBondContact O-N 3.33Å; W84-Q86 PolarHBondContact O-N 3.46Å; W84-K87 PolarHBondContact O-N 3.32Å; W84-L89 HydrophobicContact CB-CD1 4.45Å; W84-L89 HydrophobicContact CE3-CD1 3.93Å
85	L	92.5	Very high	86.3	Confident	137 Å²	137	100.4 Å²	100.4	72%	0.717	50%	0.5	S	S	*	.	H	α-helix	trans	-62.4	-32.5	178.9	-77.4	165.2	0	0	0	112.5	A81 Y82 K87	A81-L85 WeakPolarHBondContact O-CB 3.5Å; A81-L85 WeakPolarHBondContact O-CD1 3.49Å; A81-L85 VanDerWaalsContact O-CG 3.29Å; A81-L85 WeakPolarHBondContact O-CG 3.47Å; A81-L85 PolarHBondContact O-N 3.5Å; Y82-L85 PolarHBondContact O-N 2.92Å; L85-K87 PolarHBondContact O-N 3.44Å
86	Q	89.4	Confident	85.8	Confident	121 Å²	121	101.2 Å²	101.2	57%	0.565	50%	0.503	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.9	4.6	176.8	-64.5	-61.7	-13.7	0	0	113.8	Y82 E83 W84 G88	Y82-Q86 HydrophobicContact CD1-CG 4.39Å; Y82-Q86 HydrophobicContact CE1-CG 4Å; Y82-Q86 HydrophobicContact CE2-CG 4.29Å; Y82-Q86 WeakPolarHBondContact O-CG 3.43Å; Y82-Q86 PolarHBondContact O-N 3.36Å; Y82-Q86 VanDerWaalsContact O-N 3.08Å; E83-Q86 PolarHBondContact O-N 2.9Å; W84-Q86 PolarHBondContact O-N 3.46Å; Q86-G88 PolarHBondContact O-N 2.92Å; Q86-G88 VanDerWaalsContact O-N 3.13Å
87	K	84.9	Confident	85.3	Confident	146 Å²	146	104.8 Å²	104.8	64%	0.635	52%	0.521	S	S	*	.	T	Hydrogen-bonded Turn	trans	56.7	23.9	-176.5	-55.4	-173.6	175.6	-173.9	0	113.5	E83 W84 L85 L89 D90	E83-K87 PolarHBondContact O-N 2.97Å; W84-K87 PolarHBondContact O-N 3.32Å; L85-K87 PolarHBondContact O-N 3.44Å; K87-L89 PolarHBondContact O-N 3.22Å; K87-D90 HydrophobicContact CB-CB 4.2Å; K87-D90 WeakPolarHBondContact CB-OD2 3.37Å; K87-D90 WeakPolarHBondContact CD-OD2 3.42Å; K87-D90 VanDerWaalsContact CG-OD2 3.28Å; K87-D90 WeakPolarHBondContact CG-OD2 3.13Å; K87-D90 PolarHBondContact O-N 2.96Å
88	G	80.7	Confident	84.7	Confident	23 Å²	23	108 Å²	108	24%	0.237	53%	0.525	C	S	.	.	T	Hydrogen-bonded Turn	trans	-62.3	-24.9	175.5	0	0	0	0	0	112.3	E83 Q86	E83-G88 PolarHBondContact O-N 2.99Å; Q86-G88 PolarHBondContact O-N 2.92Å; Q86-G88 VanDerWaalsContact O-N 3.13Å
89	L	81.3	Confident	84	Confident	49 Å²	49	107.7 Å²	107.7	26%	0.257	52%	0.521	S	S	.	.	T	Hydrogen-bonded Turn	trans	-101.9	7.1	-178	-60.4	169.3	0	0	0	113.6	L80 E83 W84 K87 W91	L80-L89 HydrophobicContact CD1-CD1 4.2Å; E83-L89 HydrophobicContact CG-CG 4.33Å; W84-L89 HydrophobicContact CB-CD1 4.45Å; W84-L89 HydrophobicContact CE3-CD1 3.93Å; K87-L89 PolarHBondContact O-N 3.22Å; L89-W91 VanDerWaalsContact O-CD1 3.24Å; L89-W91 PolarHBondContact O-N 3.06Å
90	D	82.1	Confident	83.3	Confident	68 Å²	68	112.1 Å²	112.1	36%	0.364	54%	0.535	S	S	.	.			trans	-81.5	113.2	178.6	-83.2	-17.4	0	0	0	111.2	K87 T92	K87-D90 HydrophobicContact CB-CB 4.2Å; K87-D90 WeakPolarHBondContact CB-OD2 3.37Å; K87-D90 WeakPolarHBondContact CD-OD2 3.42Å; K87-D90 VanDerWaalsContact CG-OD2 3.28Å; K87-D90 WeakPolarHBondContact CG-OD2 3.13Å; K87-D90 PolarHBondContact O-N 2.96Å; D90-T92 VanDerWaalsContact C-N 3.3Å; D90-T92 PolarHBondContact O-N 3Å
91	W	73.1	Confident	82.6	Confident	185 Å²	185	115.2 Å²	115.2	70%	0.701	55%	0.547	S	S	*	.			trans	-96.3	56.9	174.9	-68.9	52.4	0	0	0	109.8	F33 L89	F33-W91 HydrophobicContact CD1-CH2 4.28Å; F33-W91 AromaticContact CE1-CH2 3.62Å; F33-W91 HydrophobicContact CE1-CH2 3.62Å; F33-W91 HydrophobicContact CE1-CZ2 4.33Å; F33-W91 AromaticContact CE1-CZ3 3.94Å; F33-W91 HydrophobicContact CE1-CZ3 3.94Å; L89-W91 VanDerWaalsContact O-CD1 3.24Å; L89-W91 PolarHBondContact O-N 3.06Å
92	T	64.3	Low	81.7	Confident	104 Å²	104	120.8 Å²	120.8	64%	0.638	56%	0.561	S	S	*	*			trans	-124.8	112.7	164.7	57.3	0	0	0	0	106.8	D90	D90-T92 VanDerWaalsContact C-N 3.3Å; D90-T92 PolarHBondContact O-N 3Å
93	E	56.1	Low	80.6	Confident	261 Å²	261	117.8 Å²	117.8	100%	1.22	56%	0.557	S	S	*	*			trans	-64.7	0	154.5	-65.8	-167.6	164.3	0	0	109.8

Retrieved 93 of 93 residues in 15.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).