A0A075X867_HUMAN Loading...

NADH-ubiquinone oxidoreductase chain 2

AlphaFold DB , UniProt , Accession A0A075X867, Species HUMAN (Homo sapiens, Human), Gene ND2, Length 53 aa.

						>A0A075X867_HUMAN|A0A075X867|ND2
MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNPRST
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67.2	Low	84	Confident	111 Å²	111	83.9 Å²	83.9	55%	0.547	47%	0.466	S	S	.	.				0	140.9	0	-65.2	166.7	74.9	0	0	108.2	Q6 I9 P42 K46	M1-Q6 HydrophobicContact CB-CG 4.36Å; M1-I9 HydrophobicContact CE-CD1 3.08Å; M1-P42 HydrophobicContact CE-CB 4.08Å; M1-K46 HydrophobicContact SD-CG 4.38Å
2	N	76.1	Confident	84.6	Confident	101 Å²	101	81.3 Å²	81.3	54%	0.54	46%	0.455	S	S	.	.			trans	-56.1	131.6	174.1	-173.8	3	0	0	0	109.3	L4 A5	N2-L4 PolarHBondContact O-N 2.87Å; N2-A5 HydrophobicContact CB-CB 4.28Å; N2-A5 WeakPolarHBondContact O-CB 3.38Å; N2-A5 PolarHBondContact O-N 3.03Å
3	P	76.8	Confident	85.2	Confident	96 Å²	96	77.4 Å²	77.4	62%	0.623	43%	0.431	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.7	-29.4	177.2	-29.9	34.3	0	0	0	113.9	P7	P3-P7 WeakPolarHBondContact O-CD 3.49Å
4	L	85.4	Confident	85.7	Confident	130 Å²	130	81.7 Å²	81.7	68%	0.681	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.8	-26	176.7	-60.7	177.5	0	0	0	114.1	N2 P7	N2-L4 PolarHBondContact O-N 2.87Å; L4-P7 WeakPolarHBondContact O-CD 3.44Å; L4-P7 WeakPolarHBondContact O-CG 3.49Å
5	A	84.3	Confident	86.1	Confident	36 Å²	36	79 Å²	79	30%	0.298	44%	0.437	S	S	.	.	H	α-helix	trans	-81.4	-24.8	-178.2	0	0	0	0	0	112.9	N2 V8 I9	N2-A5 HydrophobicContact CB-CB 4.28Å; N2-A5 WeakPolarHBondContact O-CB 3.38Å; N2-A5 PolarHBondContact O-N 3.03Å; A5-V8 PolarHBondContact O-N 3.46Å; A5-I9 WeakPolarHBondContact O-CD1 3.38Å; A5-I9 WeakPolarHBondContact O-CG1 3.13Å; A5-I9 PolarHBondContact O-N 3.39Å; A5-I9 VanDerWaalsContact O-N 3.12Å
6	Q	84.1	Confident	86.4	Confident	63 Å²	63	74.1 Å²	74.1	29%	0.294	41%	0.409	S	S	.	.	H	α-helix	trans	-61.8	-50.3	178.7	-62.7	-174.1	-79.8	0	0	114	M1 V8 I9 Y10	M1-Q6 HydrophobicContact CB-CG 4.36Å; Q6-V8 VanDerWaalsContact C-N 3.27Å; Q6-V8 PolarHBondContact O-N 3.45Å; Q6-I9 PolarHBondContact O-N 3.11Å; Q6-Y10 HydrophobicContact CB-CE2 4.49Å; Q6-Y10 WeakPolarHBondContact O-CD2 3.26Å; Q6-Y10 PolarHBondContact O-N 3.3Å
7	P	88.8	Confident	86.8	Confident	79 Å²	79	73.9 Å²	73.9	51%	0.513	41%	0.411	S	S	.	.	H	α-helix	trans	-64.4	-34.1	179	25.1	-34.9	0	0	0	112.1	P3 L4 Y10 S11	P3-P7 WeakPolarHBondContact O-CD 3.49Å; L4-P7 WeakPolarHBondContact O-CD 3.44Å; L4-P7 WeakPolarHBondContact O-CG 3.49Å; P7-Y10 PolarHBondContact O-N 3.38Å; P7-S11 WeakPolarHBondContact O-CB 3.38Å; P7-S11 PolarHBondContact O-N 3.12Å; P7-S11 PolarHBondContact O-OG 2.97Å
8	V	89.9	Confident	87.2	Confident	88 Å²	88	74.1 Å²	74.1	53%	0.533	41%	0.411	S	S	.	.	H	α-helix	trans	-60.5	-50.4	175.8	178.5	0	0	0	0	110	A5 Q6 Y10 S11 T12	A5-V8 PolarHBondContact O-N 3.46Å; Q6-V8 VanDerWaalsContact C-N 3.27Å; Q6-V8 PolarHBondContact O-N 3.45Å; V8-Y10 PolarHBondContact O-N 2.62Å; V8-S11 WeakPolarHBondContact O-CB 3.46Å; V8-S11 PolarHBondContact O-N 2.8Å; V8-S11 VanDerWaalsContact O-N 3.11Å; V8-S11 PolarHBondContact O-OG 3.3Å; V8-T12 PolarHBondContact O-N 3.02Å; V8-T12 PolarHBondContact O-OG1 3.18Å
9	I	90.8	Very high	87.3	Confident	24 Å²	24	73.2 Å²	73.2	12%	0.123	41%	0.405	C	S	.	.	H	α-helix	trans	-60.7	-43.3	-179.2	-70.8	162.1	0	0	0	112.3	M1 A5 Q6 S11 T12 I13 A39 P42 V43	M1-I9 HydrophobicContact CE-CD1 3.08Å; A5-I9 WeakPolarHBondContact O-CD1 3.38Å; A5-I9 WeakPolarHBondContact O-CG1 3.13Å; A5-I9 PolarHBondContact O-N 3.39Å; A5-I9 VanDerWaalsContact O-N 3.12Å; Q6-I9 PolarHBondContact O-N 3.11Å; I9-S11 VanDerWaalsContact C-N 3.31Å; I9-S11 PolarHBondContact O-N 3.47Å; I9-T12 PolarHBondContact O-N 3.43Å; I9-T12 PolarHBondContact O-OG1 3.5Å; I9-I13 HydrophobicContact CG2-CD1 4.32Å; I9-I13 WeakPolarHBondContact O-CG1 3.34Å; I9-I13 PolarHBondContact O-N 3.37Å; I9-I13 VanDerWaalsContact O-N 3.13Å; I9-A39 WeakPolarHBondContact CG2-O 3.1Å; I9-P42 HydrophobicContact CD1-CB 3.89Å; I9-P42 HydrophobicContact CD1-CG 3.71Å; I9-P42 HydrophobicContact CG1-CG 4.17Å; I9-P42 HydrophobicContact CG2-CG 4.24Å; I9-V43 HydrophobicContact CG2-CG2 3.68Å
10	Y	90.2	Very high	87.5	Confident	126 Å²	126	71.4 Å²	71.4	49%	0.494	40%	0.396	S	S	.	.	H	α-helix	trans	-65.2	-36.3	176.7	-69.3	-56.9	0	0	0	112.3	Q6 P7 V8 T12 I13 F14	Q6-Y10 HydrophobicContact CB-CE2 4.49Å; Q6-Y10 WeakPolarHBondContact O-CD2 3.26Å; Q6-Y10 PolarHBondContact O-N 3.3Å; P7-Y10 PolarHBondContact O-N 3.38Å; V8-Y10 PolarHBondContact O-N 2.62Å; Y10-T12 VanDerWaalsContact C-N 3.34Å; Y10-I13 HydrophobicContact CD1-CD1 4.42Å; Y10-I13 PolarHBondContact O-N 3.15Å; Y10-F14 PolarHBondContact O-N 3.43Å; Y10-F14 VanDerWaalsContact O-N 3.15Å
11	S	90.4	Very high	87.7	Confident	69 Å²	69	71.8 Å²	71.8	48%	0.483	41%	0.408	S	S	.	.	H	α-helix	trans	-64.8	-37.3	174.9	75.5	0	0	0	0	112.3	P7 V8 I9 F14 A15	P7-S11 WeakPolarHBondContact O-CB 3.38Å; P7-S11 PolarHBondContact O-N 3.12Å; P7-S11 PolarHBondContact O-OG 2.97Å; V8-S11 WeakPolarHBondContact O-CB 3.46Å; V8-S11 PolarHBondContact O-N 2.8Å; V8-S11 VanDerWaalsContact O-N 3.11Å; V8-S11 PolarHBondContact O-OG 3.3Å; I9-S11 VanDerWaalsContact C-N 3.31Å; I9-S11 PolarHBondContact O-N 3.47Å; S11-F14 PolarHBondContact O-N 3.13Å; S11-A15 WeakPolarHBondContact O-CB 3.41Å; S11-A15 PolarHBondContact O-N 3.26Å
12	T	91	Very high	88.9	Confident	53 Å²	53	73 Å²	73	33%	0.325	42%	0.417	S	S	.	.	H	α-helix	trans	-68.2	-38.4	177.4	-8.5	0	0	0	0	112.5	V8 I9 Y10 F14 A15 G16	V8-T12 PolarHBondContact O-N 3.02Å; V8-T12 PolarHBondContact O-OG1 3.18Å; I9-T12 PolarHBondContact O-N 3.43Å; I9-T12 PolarHBondContact O-OG1 3.5Å; Y10-T12 VanDerWaalsContact C-N 3.34Å; T12-F14 VanDerWaalsContact C-N 3.35Å; T12-A15 PolarHBondContact O-N 3.33Å; T12-G16 PolarHBondContact O-N 2.89Å
13	I	92.4	Very high	89.4	Confident	30 Å²	30	69.6 Å²	69.6	15%	0.154	40%	0.4	C	S	.	.	H	α-helix	trans	-60.6	-46.6	174.1	-65.9	171.1	0	0	0	110.3	I9 Y10 G16 T17 A39 F40 V43	I9-I13 HydrophobicContact CG2-CD1 4.32Å; I9-I13 WeakPolarHBondContact O-CG1 3.34Å; I9-I13 PolarHBondContact O-N 3.37Å; I9-I13 VanDerWaalsContact O-N 3.13Å; Y10-I13 HydrophobicContact CD1-CD1 4.42Å; Y10-I13 PolarHBondContact O-N 3.15Å; I13-G16 PolarHBondContact O-N 3.33Å; I13-T17 PolarHBondContact O-N 3.1Å; I13-T17 VanDerWaalsContact O-N 3.12Å; I13-T17 PolarHBondContact O-OG1 2.99Å; I13-A39 HydrophobicContact CG1-CB 3.6Å; I13-F40 HydrophobicContact CD1-CD2 4.27Å; I13-F40 HydrophobicContact CD1-CE2 4.19Å; I13-F40 HydrophobicContact CG1-CD2 4.42Å; I13-F40 HydrophobicContact CG1-CE2 4.48Å; I13-F40 HydrophobicContact CG2-CE2 4.13Å; I13-V43 HydrophobicContact CD1-CG2 4.31Å
14	F	92.8	Very high	89.9	Confident	138 Å²	138	71.2 Å²	71.2	61%	0.605	41%	0.414	S	S	*	.	H	α-helix	trans	-64.3	-45.3	178.8	-171.3	-105.9	0	0	0	111.7	Y10 S11 T12 T17 L18	Y10-F14 PolarHBondContact O-N 3.43Å; Y10-F14 VanDerWaalsContact O-N 3.15Å; S11-F14 PolarHBondContact O-N 3.13Å; T12-F14 VanDerWaalsContact C-N 3.35Å; F14-T17 PolarHBondContact O-N 2.87Å; F14-L18 HydrophobicContact CD1-CD1 3.79Å; F14-L18 HydrophobicContact CD1-CG 4.38Å; F14-L18 HydrophobicContact CE1-CD1 3.41Å; F14-L18 VanDerWaalsContact CE1-CD1 3.41Å; F14-L18 HydrophobicContact CE1-CG 4.11Å; F14-L18 HydrophobicContact CZ-CD1 4.04Å; F14-L18 HydrophobicContact CZ-CG 4.35Å; F14-L18 PolarHBondContact O-N 3.01Å
15	A	91.7	Very high	90.1	Very high	41 Å²	41	70.9 Å²	70.9	34%	0.339	41%	0.409	S	S	.	.	H	α-helix	trans	-61.5	-44.5	177.1	0	0	0	0	0	112.4	S11 T12 T17 L18 I19	S11-A15 WeakPolarHBondContact O-CB 3.41Å; S11-A15 PolarHBondContact O-N 3.26Å; T12-A15 PolarHBondContact O-N 3.33Å; A15-T17 VanDerWaalsContact C-N 3.31Å; A15-T17 PolarHBondContact O-N 3.06Å; A15-L18 PolarHBondContact O-N 3.29Å; A15-I19 VanDerWaalsContact O-CG1 3.26Å; A15-I19 WeakPolarHBondContact O-CG1 3.37Å; A15-I19 PolarHBondContact O-N 2.81Å
16	G	91.2	Very high	90.2	Very high	0 Å²	0	79.9 Å²	79.9	0%	0	44%	0.435	C	S	.	.	H	α-helix	trans	-59.1	-42.2	176.7	0	0	0	0	0	112.2	T12 I13 I19 T20	T12-G16 PolarHBondContact O-N 2.89Å; I13-G16 PolarHBondContact O-N 3.33Å; G16-I19 PolarHBondContact O-N 2.83Å; G16-T20 PolarHBondContact O-N 3.1Å; G16-T20 PolarHBondContact O-OG1 3.45Å; G16-T20 VanDerWaalsContact O-OG1 3.1Å
17	T	91.9	Very high	90.5	Very high	71 Å²	71	82.7 Å²	82.7	44%	0.436	45%	0.447	S	S	.	.	H	α-helix	trans	-64.8	-41.9	177.2	-47.7	0	0	0	0	112	I13 F14 A15 T20 A21 N36	I13-T17 PolarHBondContact O-N 3.1Å; I13-T17 VanDerWaalsContact O-N 3.12Å; I13-T17 PolarHBondContact O-OG1 2.99Å; F14-T17 PolarHBondContact O-N 2.87Å; A15-T17 VanDerWaalsContact C-N 3.31Å; A15-T17 PolarHBondContact O-N 3.06Å; T17-T20 PolarHBondContact O-N 3.03Å; T17-A21 WeakPolarHBondContact O-CB 3.41Å; T17-A21 PolarHBondContact O-N 3.34Å; T17-N36 PolarHBondContact OG1-ND2 3.45Å
18	L	94.1	Very high	90.4	Very high	78 Å²	78	84.7 Å²	84.7	41%	0.408	45%	0.447	S	S	.	.	H	α-helix	trans	-64.6	-41.5	175.4	-73.9	177.6	0	0	0	112.2	F14 A15 A21 L22	F14-L18 HydrophobicContact CD1-CD1 3.79Å; F14-L18 HydrophobicContact CD1-CG 4.38Å; F14-L18 HydrophobicContact CE1-CD1 3.41Å; F14-L18 VanDerWaalsContact CE1-CD1 3.41Å; F14-L18 HydrophobicContact CE1-CG 4.11Å; F14-L18 HydrophobicContact CZ-CD1 4.04Å; F14-L18 HydrophobicContact CZ-CG 4.35Å; F14-L18 PolarHBondContact O-N 3.01Å; A15-L18 PolarHBondContact O-N 3.29Å; L18-A21 PolarHBondContact O-N 2.76Å; L18-L22 VanDerWaalsContact O-CB 3.31Å; L18-L22 WeakPolarHBondContact O-CB 3.41Å; L18-L22 VanDerWaalsContact O-CG 3.31Å; L18-L22 WeakPolarHBondContact O-CG 3.44Å; L18-L22 PolarHBondContact O-N 3.37Å
19	I	90.4	Very high	90.4	Very high	57 Å²	57	82.4 Å²	82.4	29%	0.292	43%	0.434	S	S	.	.	H	α-helix	trans	-62.2	-44.7	177.4	-68.1	162.9	0	0	0	110.1	A15 G16 A21 S23 F28 M35	A15-I19 VanDerWaalsContact O-CG1 3.26Å; A15-I19 WeakPolarHBondContact O-CG1 3.37Å; A15-I19 PolarHBondContact O-N 2.81Å; G16-I19 PolarHBondContact O-N 2.83Å; I19-A21 PolarHBondContact O-N 2.9Å; I19-S23 WeakPolarHBondContact O-CB 3.43Å; I19-S23 PolarHBondContact O-N 2.88Å; I19-F28 HydrophobicContact CG2-CD1 4.27Å; I19-M35 HydrophobicContact CD1-SD 4.11Å
20	T	91.3	Very high	90.4	Very high	37 Å²	37	87.6 Å²	87.6	23%	0.227	45%	0.452	C	S	.	.	H	α-helix	trans	-62.7	-41.9	176.3	-57.3	0	0	0	0	111.9	G16 T17 T29 G32 L33	G16-T20 PolarHBondContact O-N 3.1Å; G16-T20 PolarHBondContact O-OG1 3.45Å; G16-T20 VanDerWaalsContact O-OG1 3.1Å; T17-T20 PolarHBondContact O-N 3.03Å; T20-T29 HydrophobicContact CG2-CG2 3.85Å; T20-G32 VanDerWaalsContact OG1-C 3.32Å; T20-G32 WeakPolarHBondContact OG1-CA 3.47Å; T20-L33 HydrophobicContact CG2-CD2 4.32Å; T20-L33 HydrophobicContact CG2-CG 4.33Å
21	A	90.6	Very high	90.5	Very high	80 Å²	80	83.4 Å²	83.4	66%	0.661	44%	0.439	S	S	*	.	H	α-helix	trans	-73	-35.1	-177.6	0	0	0	0	0	113.7	T17 L18 I19	T17-A21 WeakPolarHBondContact O-CB 3.41Å; T17-A21 PolarHBondContact O-N 3.34Å; L18-A21 PolarHBondContact O-N 2.76Å; I19-A21 PolarHBondContact O-N 2.9Å
22	L	92.1	Very high	90.6	Very high	137 Å²	137	80.1 Å²	80.1	72%	0.717	42%	0.416	S	S	*	.	H	α-helix	trans	-89.7	-11.9	-178.6	-64.7	174.2	0	0	0	113.1	L18 S24	L18-L22 VanDerWaalsContact O-CB 3.31Å; L18-L22 WeakPolarHBondContact O-CB 3.41Å; L18-L22 VanDerWaalsContact O-CG 3.31Å; L18-L22 WeakPolarHBondContact O-CG 3.44Å; L18-L22 PolarHBondContact O-N 3.37Å; L22-S24 PolarHBondContact O-N 3.29Å
23	S	88.3	Confident	90.6	Very high	29 Å²	29	82.2 Å²	82.2	20%	0.203	43%	0.425	C	S	.	.			trans	-73.5	125.9	-177.8	177.5	0	0	0	0	112.2	I19 H25 F28 T29	I19-S23 WeakPolarHBondContact O-CB 3.43Å; I19-S23 PolarHBondContact O-N 2.88Å; S23-H25 PolarHBondContact OG-N 3.23Å; S23-H25 PolarHBondContact OG-O 2.98Å; S23-F28 WeakPolarHBondContact OG-CB 3.28Å; S23-T29 PolarHBondContact OG-N 3.43Å; S23-T29 PolarHBondContact OG-OG1 2.8Å
24	S	85.6	Confident	90.7	Very high	130 Å²	130	84.5 Å²	84.5	91%	0.909	44%	0.435	S	S	*	.			trans	-94	-7.1	168.8	-45.9	0	0	0	0	113.2	L22	L22-S24 PolarHBondContact O-N 3.29Å
25	H	89.8	Confident	90.6	Very high	122 Å²	122	81.9 Å²	81.9	57%	0.565	43%	0.426	S	S	*	.	S	Bend	trans	-113.5	132.3	-177.6	-170	-81.5	0	0	0	111	S23 F27 F28 T29	S23-H25 PolarHBondContact OG-N 3.23Å; S23-H25 PolarHBondContact OG-O 2.98Å; H25-F27 VanDerWaalsContact C-N 3.25Å; H25-F27 VanDerWaalsContact ND1-CB 3.26Å; H25-F27 WeakPolarHBondContact ND1-CB 3.14Å; H25-F27 PolarHBondContact ND1-N 3.12Å; H25-F27 VanDerWaalsContact ND1-N 3.12Å; H25-F27 PolarHBondContact O-N 3.39Å; H25-F27 VanDerWaalsContact O-N 3.14Å; H25-F28 PolarHBondContact O-N 3.27Å; H25-T29 PolarHBondContact O-N 3.48Å; H25-T29 VanDerWaalsContact O-N 3.16Å; H25-T29 PolarHBondContact O-OG1 3.4Å
26	W	86.8	Confident	90.7	Very high	225 Å²	225	81.5 Å²	81.5	85%	0.852	42%	0.418	S	S	*	.	H	α-helix	trans	-54.8	-38.8	-175.1	-117.6	83.6	0	0	0	113.7	F28 T29 W30	W26-F28 PolarHBondContact O-N 2.91Å; W26-T29 WeakPolarHBondContact O-CB 3.31Å; W26-T29 PolarHBondContact O-N 3.02Å; W26-W30 PolarHBondContact O-N 3.33Å
27	F	89.8	Confident	90.7	Very high	123 Å²	123	86.9 Å²	86.9	54%	0.539	44%	0.444	S	S	.	.	H	α-helix	trans	-60.1	-44.7	176.1	-176.8	-103.2	0	0	0	113.2	H25 T29 W30 V31	H25-F27 VanDerWaalsContact C-N 3.25Å; H25-F27 VanDerWaalsContact ND1-CB 3.26Å; H25-F27 WeakPolarHBondContact ND1-CB 3.14Å; H25-F27 PolarHBondContact ND1-N 3.12Å; H25-F27 VanDerWaalsContact ND1-N 3.12Å; H25-F27 PolarHBondContact O-N 3.39Å; H25-F27 VanDerWaalsContact O-N 3.14Å; F27-T29 VanDerWaalsContact C-N 3.31Å; F27-T29 PolarHBondContact O-N 3.26Å; F27-W30 HydrophobicContact CE2-CE3 4.36Å; F27-W30 HydrophobicContact CE2-CZ3 4.49Å; F27-W30 PolarHBondContact O-N 3.17Å; F27-V31 HydrophobicContact CD1-CG2 4.24Å; F27-V31 HydrophobicContact CE1-CG2 3.86Å; F27-V31 HydrophobicContact CE2-CG2 4.46Å; F27-V31 HydrophobicContact CZ-CG2 3.98Å; F27-V31 WeakPolarHBondContact O-CG2 3.34Å; F27-V31 PolarHBondContact O-N 3.37Å
28	F	87.3	Confident	90.6	Very high	121 Å²	121	88.3 Å²	88.3	53%	0.531	45%	0.449	S	S	.	.	H	α-helix	trans	-69.7	-32.8	179.8	-98.1	-79.8	0	0	0	111.7	I19 S23 H25 W26 W30 V31 G32	I19-F28 HydrophobicContact CG2-CD1 4.27Å; S23-F28 WeakPolarHBondContact OG-CB 3.28Å; H25-F28 PolarHBondContact O-N 3.27Å; W26-F28 PolarHBondContact O-N 2.91Å; F28-W30 VanDerWaalsContact C-N 3.34Å; F28-V31 PolarHBondContact O-N 3.1Å; F28-G32 PolarHBondContact O-N 3.01Å
29	T	90.4	Very high	90.3	Very high	40 Å²	40	85 Å²	85	25%	0.245	43%	0.433	C	S	.	.	H	α-helix	trans	-62.1	-43.7	172.6	-51.6	0	0	0	0	110.8	T20 S23 H25 W26 F27 G32 L33	T20-T29 HydrophobicContact CG2-CG2 3.85Å; S23-T29 PolarHBondContact OG-N 3.43Å; S23-T29 PolarHBondContact OG-OG1 2.8Å; H25-T29 PolarHBondContact O-N 3.48Å; H25-T29 VanDerWaalsContact O-N 3.16Å; H25-T29 PolarHBondContact O-OG1 3.4Å; W26-T29 WeakPolarHBondContact O-CB 3.31Å; W26-T29 PolarHBondContact O-N 3.02Å; F27-T29 VanDerWaalsContact C-N 3.31Å; F27-T29 PolarHBondContact O-N 3.26Å; T29-G32 PolarHBondContact O-N 3.46Å; T29-L33 WeakPolarHBondContact O-CG 3.31Å; T29-L33 PolarHBondContact O-N 3.22Å; T29-L33 VanDerWaalsContact O-N 3.09Å
30	W	91.2	Very high	90.1	Very high	132 Å²	132	86.8 Å²	86.8	50%	0.5	44%	0.439	S	S	.	.	H	α-helix	trans	-63.9	-45.9	175.8	-179.9	74.5	0	0	0	112.4	W26 F27 F28 G32 L33 E34	W26-W30 PolarHBondContact O-N 3.33Å; F27-W30 HydrophobicContact CE2-CE3 4.36Å; F27-W30 HydrophobicContact CE2-CZ3 4.49Å; F27-W30 PolarHBondContact O-N 3.17Å; F28-W30 VanDerWaalsContact C-N 3.34Å; W30-G32 VanDerWaalsContact C-N 3.29Å; W30-G32 PolarHBondContact O-N 3.47Å; W30-L33 PolarHBondContact O-N 3.42Å; W30-L33 VanDerWaalsContact O-N 3.12Å; W30-E34 HydrophobicContact CD2-CG 4.02Å; W30-E34 HydrophobicContact CE3-CG 4.37Å; W30-E34 HydrophobicContact CH2-CG 3.99Å; W30-E34 VanDerWaalsContact CZ2-CD 3.43Å; W30-E34 HydrophobicContact CZ2-CG 3.61Å; W30-E34 WeakPolarHBondContact CZ2-OE1 3.31Å; W30-E34 HydrophobicContact CZ3-CG 4.36Å; W30-E34 PolarHBondContact O-N 3.18Å
31	V	92.3	Very high	89.8	Confident	38 Å²	38	89.1 Å²	89.1	23%	0.23	45%	0.449	C	S	.	.	H	α-helix	trans	-60.1	-39.7	176	173.1	0	0	0	0	111.5	F27 F28 L33 E34 M35	F27-V31 HydrophobicContact CD1-CG2 4.24Å; F27-V31 HydrophobicContact CE1-CG2 3.86Å; F27-V31 HydrophobicContact CE2-CG2 4.46Å; F27-V31 HydrophobicContact CZ-CG2 3.98Å; F27-V31 WeakPolarHBondContact O-CG2 3.34Å; F27-V31 PolarHBondContact O-N 3.37Å; F28-V31 PolarHBondContact O-N 3.1Å; V31-L33 VanDerWaalsContact C-N 3.35Å; V31-L33 PolarHBondContact O-N 3.41Å; V31-E34 PolarHBondContact O-N 3.09Å; V31-M35 HydrophobicContact CG1-CE 4.32Å; V31-M35 WeakPolarHBondContact O-CG 3.37Å; V31-M35 PolarHBondContact O-N 3.18Å
32	G	91.8	Very high	89.2	Confident	0 Å²	0	87.1 Å²	87.1	0%	0	43%	0.429	C	S	.	.	H	α-helix	trans	-63.3	-38.5	175.2	0	0	0	0	0	113.2	T20 F28 T29 W30 N36	T20-G32 VanDerWaalsContact OG1-C 3.32Å; T20-G32 WeakPolarHBondContact OG1-CA 3.47Å; F28-G32 PolarHBondContact O-N 3.01Å; T29-G32 PolarHBondContact O-N 3.46Å; W30-G32 VanDerWaalsContact C-N 3.29Å; W30-G32 PolarHBondContact O-N 3.47Å; G32-N36 PolarHBondContact O-N 3.08Å
33	L	91.3	Very high	88.8	Confident	98 Å²	98	82.6 Å²	82.6	51%	0.513	41%	0.407	S	S	.	.	H	α-helix	trans	-69.1	-44	175.5	-72.3	172.4	0	0	0	112.4	T20 T29 W30 V31 M35 N36 M37	T20-L33 HydrophobicContact CG2-CD2 4.32Å; T20-L33 HydrophobicContact CG2-CG 4.33Å; T29-L33 WeakPolarHBondContact O-CG 3.31Å; T29-L33 PolarHBondContact O-N 3.22Å; T29-L33 VanDerWaalsContact O-N 3.09Å; W30-L33 PolarHBondContact O-N 3.42Å; W30-L33 VanDerWaalsContact O-N 3.12Å; V31-L33 VanDerWaalsContact C-N 3.35Å; V31-L33 PolarHBondContact O-N 3.41Å; L33-M35 PolarHBondContact O-N 3.41Å; L33-N36 WeakPolarHBondContact O-CB 3.26Å; L33-N36 PolarHBondContact O-N 3.03Å; L33-M37 PolarHBondContact O-N 2.94Å
34	E	93.9	Very high	88.5	Confident	77 Å²	77	86.9 Å²	86.9	36%	0.36	43%	0.427	S	S	.	.	H	α-helix	trans	-58.1	-45.5	174.6	-78.9	-98	147.9	0	0	111.7	W30 V31 N36 M37 L38	W30-E34 HydrophobicContact CD2-CG 4.02Å; W30-E34 HydrophobicContact CE3-CG 4.37Å; W30-E34 HydrophobicContact CH2-CG 3.99Å; W30-E34 VanDerWaalsContact CZ2-CD 3.43Å; W30-E34 HydrophobicContact CZ2-CG 3.61Å; W30-E34 WeakPolarHBondContact CZ2-OE1 3.31Å; W30-E34 HydrophobicContact CZ3-CG 4.36Å; W30-E34 PolarHBondContact O-N 3.18Å; V31-E34 PolarHBondContact O-N 3.09Å; E34-N36 VanDerWaalsContact C-N 3.29Å; E34-N36 PolarHBondContact O-N 3.44Å; E34-M37 PolarHBondContact O-N 3.24Å; E34-L38 PolarHBondContact O-N 2.78Å; E34-L38 VanDerWaalsContact O-N 3.08Å
35	M	91.4	Very high	88.2	Confident	84 Å²	84	84 Å²	84	41%	0.414	40%	0.404	S	S	.	.	H	α-helix	trans	-59.6	-39.7	175.4	-80.8	-169.6	179.7	0	0	112.4	I19 V31 L33 A39	I19-M35 HydrophobicContact CD1-SD 4.11Å; V31-M35 HydrophobicContact CG1-CE 4.32Å; V31-M35 WeakPolarHBondContact O-CG 3.37Å; V31-M35 PolarHBondContact O-N 3.18Å; L33-M35 PolarHBondContact O-N 3.41Å; M35-A39 WeakPolarHBondContact O-CB 3.37Å; M35-A39 PolarHBondContact O-N 3.22Å; M35-A39 VanDerWaalsContact O-N 3.09Å
36	N	93.3	Very high	87.2	Confident	32 Å²	32	84.1 Å²	84.1	17%	0.171	40%	0.403	C	S	.	.	H	α-helix	trans	-66.6	-41.5	179	-144.5	-27.7	0	0	0	111.2	T17 G32 L33 E34 A39 F40	T17-N36 PolarHBondContact OG1-ND2 3.45Å; G32-N36 PolarHBondContact O-N 3.08Å; L33-N36 WeakPolarHBondContact O-CB 3.26Å; L33-N36 PolarHBondContact O-N 3.03Å; E34-N36 VanDerWaalsContact C-N 3.29Å; E34-N36 PolarHBondContact O-N 3.44Å; N36-A39 PolarHBondContact O-N 3.48Å; N36-F40 PolarHBondContact O-N 3.43Å; N36-F40 VanDerWaalsContact O-N 3.17Å
37	M	91.3	Very high	86.3	Confident	113 Å²	113	81 Å²	81	56%	0.557	40%	0.396	S	S	*	.	H	α-helix	trans	-60.2	-49.6	176.5	-171	-178.4	77.8	0	0	111.6	L33 E34 A39 F40 I41	L33-M37 PolarHBondContact O-N 2.94Å; E34-M37 PolarHBondContact O-N 3.24Å; M37-A39 VanDerWaalsContact C-N 3.33Å; M37-A39 PolarHBondContact O-N 3.28Å; M37-F40 PolarHBondContact O-N 3.12Å; M37-I41 PolarHBondContact O-N 3.5Å
38	L	89.5	Confident	84.8	Confident	101 Å²	101	84.1 Å²	84.1	53%	0.529	41%	0.414	S	S	.	.	H	α-helix	trans	-63.8	-37.7	-179.5	-68.5	175	0	0	0	112.5	E34 F40 I41 P42	E34-L38 PolarHBondContact O-N 2.78Å; E34-L38 VanDerWaalsContact O-N 3.08Å; L38-F40 VanDerWaalsContact C-N 3.28Å; L38-F40 PolarHBondContact O-N 3.09Å; L38-I41 HydrophobicContact CD2-CD1 3.95Å; L38-I41 PolarHBondContact O-N 3.36Å; L38-P42 VanDerWaalsContact O-CD 3.31Å; L38-P42 WeakPolarHBondContact O-CD 3.11Å
39	A	87.5	Confident	83.5	Confident	10 Å²	10	83.4 Å²	83.4	8%	0.083	42%	0.416	C	S	.	.	H	α-helix	trans	-69.3	-25.5	178.6	0	0	0	0	0	113.1	I9 I13 M35 N36 M37 P42	I9-A39 WeakPolarHBondContact CG2-O 3.1Å; I13-A39 HydrophobicContact CG1-CB 3.6Å; M35-A39 WeakPolarHBondContact O-CB 3.37Å; M35-A39 PolarHBondContact O-N 3.22Å; M35-A39 VanDerWaalsContact O-N 3.09Å; N36-A39 PolarHBondContact O-N 3.48Å; M37-A39 VanDerWaalsContact C-N 3.33Å; M37-A39 PolarHBondContact O-N 3.28Å; A39-P42 WeakPolarHBondContact O-CD 3.48Å; A39-P42 WeakPolarHBondContact O-CG 3.47Å
40	F	86.6	Confident	82.2	Confident	94 Å²	94	87.7 Å²	87.7	41%	0.412	44%	0.444	S	S	.	.	H	α-helix	trans	-78.5	-26.8	177.3	-104	-82.1	0	0	0	114.4	I13 N36 M37 L38 V43 L44	I13-F40 HydrophobicContact CD1-CD2 4.27Å; I13-F40 HydrophobicContact CD1-CE2 4.19Å; I13-F40 HydrophobicContact CG1-CD2 4.42Å; I13-F40 HydrophobicContact CG1-CE2 4.48Å; I13-F40 HydrophobicContact CG2-CE2 4.13Å; N36-F40 PolarHBondContact O-N 3.43Å; N36-F40 VanDerWaalsContact O-N 3.17Å; M37-F40 PolarHBondContact O-N 3.12Å; L38-F40 VanDerWaalsContact C-N 3.28Å; L38-F40 PolarHBondContact O-N 3.09Å; F40-V43 WeakPolarHBondContact O-CB 3.45Å; F40-V43 PolarHBondContact O-N 2.92Å; F40-L44 WeakPolarHBondContact O-CG 3.48Å; F40-L44 PolarHBondContact O-N 3.49Å
41	I	85.5	Confident	80.7	Confident	85 Å²	85	93.1 Å²	93.1	44%	0.436	47%	0.465	S	S	.	.	H	α-helix	trans	-51.5	-52.5	179	-63.8	170.6	0	0	0	113.3	M37 L38 V43 L44 T45	M37-I41 PolarHBondContact O-N 3.5Å; L38-I41 HydrophobicContact CD2-CD1 3.95Å; L38-I41 PolarHBondContact O-N 3.36Å; I41-V43 PolarHBondContact O-N 3.45Å; I41-L44 PolarHBondContact O-N 2.98Å; I41-T45 WeakPolarHBondContact O-CG2 3.39Å; I41-T45 PolarHBondContact O-N 3.23Å; I41-T45 VanDerWaalsContact O-N 3.1Å; I41-T45 PolarHBondContact O-OG1 3.32Å
42	P	78.6	Confident	78.9	Confident	38 Å²	38	93 Å²	93	25%	0.247	47%	0.466	C	S	.	.	H	α-helix	trans	-68.7	-22.7	179.3	26.6	-35.7	0	0	0	113.3	M1 I9 L38 A39 T45	M1-P42 HydrophobicContact CE-CB 4.08Å; I9-P42 HydrophobicContact CD1-CB 3.89Å; I9-P42 HydrophobicContact CD1-CG 3.71Å; I9-P42 HydrophobicContact CG1-CG 4.17Å; I9-P42 HydrophobicContact CG2-CG 4.24Å; L38-P42 VanDerWaalsContact O-CD 3.31Å; L38-P42 WeakPolarHBondContact O-CD 3.11Å; A39-P42 WeakPolarHBondContact O-CD 3.48Å; A39-P42 WeakPolarHBondContact O-CG 3.47Å; P42-T45 WeakPolarHBondContact CA-OG1 3.02Å; P42-T45 PolarHBondContact O-OG1 3.38Å
43	V	83.3	Confident	77	Confident	42 Å²	42	102 Å²	102	26%	0.255	52%	0.521	S	S	.	.	H	α-helix	trans	-74.2	-42	176.1	179.8	0	0	0	0	110.6	I9 I13 F40 I41 K46	I9-V43 HydrophobicContact CG2-CG2 3.68Å; I13-V43 HydrophobicContact CD1-CG2 4.31Å; F40-V43 WeakPolarHBondContact O-CB 3.45Å; F40-V43 PolarHBondContact O-N 2.92Å; I41-V43 PolarHBondContact O-N 3.45Å; V43-K46 VanDerWaalsContact O-CB 3.26Å; V43-K46 WeakPolarHBondContact O-CB 3.45Å; V43-K46 PolarHBondContact O-N 3.16Å
44	L	81.6	Confident	76.2	Confident	119 Å²	119	102.2 Å²	102.2	62%	0.623	52%	0.521	S	S	*	.	H	α-helix	trans	-66.2	-45.8	177.5	-69.9	167.1	0	0	0	111.3	F40 I41 K46 S52	F40-L44 WeakPolarHBondContact O-CG 3.48Å; F40-L44 PolarHBondContact O-N 3.49Å; I41-L44 PolarHBondContact O-N 2.98Å; L44-K46 PolarHBondContact O-N 3.47Å; L44-K46 VanDerWaalsContact O-N 3.1Å; L44-S52 PolarHBondContact O-OG 2.97Å
45	T	79.9	Confident	75.3	Confident	70 Å²	70	103.5 Å²	103.5	43%	0.429	53%	0.53	S	S	.	.	T	Hydrogen-bonded Turn	trans	-72.3	1.4	180	54.5	0	0	0	0	114.7	I41 P42 K47 S52	I41-T45 WeakPolarHBondContact O-CG2 3.39Å; I41-T45 PolarHBondContact O-N 3.23Å; I41-T45 VanDerWaalsContact O-N 3.1Å; I41-T45 PolarHBondContact O-OG1 3.32Å; P42-T45 WeakPolarHBondContact CA-OG1 3.02Å; P42-T45 PolarHBondContact O-OG1 3.38Å; T45-K47 VanDerWaalsContact C-N 3.3Å; T45-K47 PolarHBondContact O-N 3.14Å; T45-S52 WeakPolarHBondContact CA-OG 3.44Å
46	K	67.5	Low	74.4	Confident	125 Å²	125	104.6 Å²	104.6	54%	0.543	54%	0.536	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.1	-33.3	178.5	-173.5	-177	177	-174	0	112.9	M1 V43 L44	M1-K46 HydrophobicContact SD-CG 4.38Å; V43-K46 VanDerWaalsContact O-CB 3.26Å; V43-K46 WeakPolarHBondContact O-CB 3.45Å; V43-K46 PolarHBondContact O-N 3.16Å; L44-K46 PolarHBondContact O-N 3.47Å; L44-K46 VanDerWaalsContact O-N 3.1Å
47	K	67.6	Low	73.3	Confident	160 Å²	160	108.9 Å²	108.9	70%	0.696	56%	0.558	S	S	*	*	S	Bend	trans	-97.4	106	172.8	-74.9	-173.7	178.3	-177.2	0	108.1	T45 N49 S52	T45-K47 VanDerWaalsContact C-N 3.3Å; T45-K47 PolarHBondContact O-N 3.14Å; K47-N49 PolarHBondContact O-N 3.12Å; K47-S52 WeakPolarHBondContact O-CB 3.26Å; K47-S52 PolarHBondContact O-OG 3.01Å
48	M	59.8	Low	72.2	Confident	188 Å²	188	108.6 Å²	108.6	93%	0.926	56%	0.558	S	S	*	*			trans	-73.4	64.3	175.8	-151.1	-171.3	-41	0	0	110.1
49	N	60.2	Low	71	Confident	106 Å²	106	109.1 Å²	109.1	57%	0.567	56%	0.56	S	S	*	*			trans	-98.6	145.1	167.8	-80.2	60.7	0	0	0	107.5	K47 R51 S52	K47-N49 PolarHBondContact O-N 3.12Å; N49-R51 PolarHBondContact O-N 3.49Å; N49-S52 VanDerWaalsContact O-CB 3.28Å; N49-S52 WeakPolarHBondContact O-CB 3.19Å; N49-S52 PolarHBondContact O-N 3.03Å
50	P	61.4	Low	69.9	Low	130 Å²	130	116.2 Å²	116.2	84%	0.844	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.2	1	-177.6	22.3	-32	0	0	0	115.5
51	R	61.4	Low	68.6	Low	245 Å²	245	117.9 Å²	117.9	93%	0.925	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.9	1.6	169.1	-84	-159.5	161.3	171.4	-2.5	114.4	N49 T53	N49-R51 PolarHBondContact O-N 3.49Å; R51-T53 VanDerWaalsContact C-N 3.27Å; R51-T53 PolarHBondContact O-N 3.25Å
52	S	54.5	Low	67.2	Low	36 Å²	36	120.7 Å²	120.7	25%	0.252	62%	0.622	S	S	.	*			trans	-95.4	41.2	179.4	-177.5	0	0	0	0	111.6	L44 T45 K47 N49	L44-S52 PolarHBondContact O-OG 2.97Å; T45-S52 WeakPolarHBondContact CA-OG 3.44Å; K47-S52 WeakPolarHBondContact O-CB 3.26Å; K47-S52 PolarHBondContact O-OG 3.01Å; N49-S52 VanDerWaalsContact O-CB 3.28Å; N49-S52 WeakPolarHBondContact O-CB 3.19Å; N49-S52 PolarHBondContact O-N 3.03Å
53	T	50.3	Low	66.1	Low	189 Å²	189	128.2 Å²	128.2	100%	1.16	66%	0.656	S	S	*	*			trans	-90.9	0	172.2	-34.1	0	0	0	0	109.5	R51	R51-T53 VanDerWaalsContact C-N 3.27Å; R51-T53 PolarHBondContact O-N 3.25Å

Retrieved 53 of 53 residues in 49.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).