A0A075X8C1_HUMAN Loading...

Cytochrome c oxidase subunit 2

AlphaFold DB , UniProt , Accession A0A075X8C1, Species HUMAN (Homo sapiens, Human), Gene COX2, Length 41 aa.

>A0A075X8C1_HUMAN|A0A075X8C1|COX2
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYA
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1M90.4Very high95Very high188 Ų188106.7 Ų106.793%0.92665%0.651SS**  0141.50-66.9-57173.500107
2A92.2Very high95.1Very high70 Ų70101.6 Ų101.658%0.57963%0.628SS**PPolyproline II helixtrans-68.4138.4178.700000111.2
3H95.2Very high95.3Very high132 Ų132104.5 Ų104.561%0.61165%0.645SS**PPolyproline II helixtrans-100.2155.2173.9-59.9-71000111A5 Q6H3-A5 PolarHBondContact O-N 3.24Å; H3-Q6 VanDerWaalsContact O-CB 3.29Å; H3-Q6 WeakPolarHBondContact O-CB 3.28Å; H3-Q6 PolarHBondContact O-N 3.41Å
4A96Very high95.5Very high105 Ų105100.9 Ų100.987%0.86863%0.627SS**THydrogen-bonded Turntrans-59.5136.6173.800000110.1Q6A4-Q6 VanDerWaalsContact C-N 3.28Å; A4-Q6 PolarHBondContact O-N 3.02Å
5A95.9Very high95.5Very high102 Ų102101.2 Ų101.284%0.84363%0.63SS**THydrogen-bonded Turntrans64.318.7-175.800000116.2H3 V7H3-A5 PolarHBondContact O-N 3.24Å; A5-V7 PolarHBondContact O-N 3.36Å
6Q96.3Very high95.7Very high69 Ų69102.8 Ų102.832%0.32263%0.631SS.*  trans-71.3121.9171.3-177170-4.800111.2H3 A4 L9H3-Q6 VanDerWaalsContact O-CB 3.29Å; H3-Q6 WeakPolarHBondContact O-CB 3.28Å; H3-Q6 PolarHBondContact O-N 3.41Å; A4-Q6 VanDerWaalsContact C-N 3.28Å; A4-Q6 PolarHBondContact O-N 3.02Å; Q6-L9 PolarHBondContact NE2-O 2.94Å
7V95.5Very high95.8Very high149 Ų14999.4 Ų99.490%0.90361%0.608SS**  trans-98.7-29.5-179.5-1800000112.4A5A5-V7 PolarHBondContact O-N 3.36Å
8G94.9Very high96Very high53 Ų53100.7 Ų100.755%0.54661%0.605SS.*SBendtrans-91.1-175.8179.200000114.1
9L96.4Very high96.1Very high80 Ų80102.4 Ų102.442%0.41961%0.606SS.*PPolyproline II helixtrans-66.8159.1173.7-66.1169.8000111.4Q6 M17 I21 H24Q6-L9 PolarHBondContact NE2-O 2.94Å; L9-M17 HydrophobicContact CB-CE 3.86Å; L9-M17 HydrophobicContact CD1-CE 3.95Å; L9-M17 HydrophobicContact CD2-CE 4.19Å; L9-M17 HydrophobicContact CG-CE 4.21Å; L9-I21 HydrophobicContact CB-CG1 4.15Å; L9-I21 HydrophobicContact CD1-CG1 3.81Å; L9-H24 HydrophobicContact CD1-CB 4.12Å
10Q96.9Very high96.2Very high91 Ų91101.8 Ų101.843%0.42560%0.6SS.*PPolyproline II helixtrans-70.3155.3171.4-65.9-174.53300110.8A12Q10-A12 PolarHBondContact O-N 3.48Å
11D95.1Very high96.3Very high135 Ų13598.9 Ų98.972%0.72258%0.581SS**PPolyproline II helixtrans-52.3139.1174.5-59.4-34.3000111.1T13D11-T13 PolarHBondContact O-N 2.86Å
12A96.6Very high96.7Very high45 Ų4594.1 Ų94.137%0.37256%0.563SS.*PPolyproline II helixtrans-65.5126.6-179.500000111Q10 M17 E18 I21Q10-A12 PolarHBondContact O-N 3.48Å; A12-M17 HydrophobicContact CB-CB 3.97Å; A12-M17 HydrophobicContact CB-CG 4.05Å; A12-E18 HydrophobicContact CB-CB 4.11Å; A12-I21 HydrophobicContact CB-CD1 4.09Å
13T97.3Very high97Very high139 Ų13997.5 Ų97.585%0.85357%0.565SS**SBendtrans-109.42.6172.259.30000112.5D11D11-T13 PolarHBondContact O-N 2.86Å
14S97.6Very high97.1Very high55 Ų5594.4 Ų94.439%0.38555%0.55SS.*SBendtrans-148.2154.417670.10000110.7I16 M17 E18S14-I16 PolarHBondContact O-N 2.95Å; S14-M17 WeakPolarHBondContact O-CB 3.32Å; S14-M17 PolarHBondContact O-N 3.38Å; S14-M17 PolarHBondContact OG-N 3.36Å; S14-E18 PolarHBondContact O-N 3.23Å
15P96.6Very high97.2Very high105 Ų10594 Ų9468%0.68253%0.533SS*.Hα-helixtrans-58-34.3178.6-25.734.8000113.5M17 E18 E19P15-M17 VanDerWaalsContact C-N 3.3Å; P15-M17 PolarHBondContact O-N 3.34Å; P15-E18 WeakPolarHBondContact O-CB 3.49Å; P15-E18 PolarHBondContact O-N 3.46Å; P15-E19 PolarHBondContact O-N 3.45Å
16I98.3Very high97.4Very high126 Ų12694.1 Ų94.165%0.64652%0.516SS*.Hα-helixtrans-65.6-37.3177.8-63.1174.7000110.7S14 E18 E19 L20S14-I16 PolarHBondContact O-N 2.95Å; I16-E18 VanDerWaalsContact C-N 3.3Å; I16-E18 PolarHBondContact O-N 2.86Å; I16-E19 PolarHBondContact O-N 3.29Å; I16-L20 HydrophobicContact CG2-CD1 4.05Å; I16-L20 HydrophobicContact CG2-CG 4.31Å; I16-L20 VanDerWaalsContact O-CG 3.28Å; I16-L20 WeakPolarHBondContact O-CG 3.47Å; I16-L20 PolarHBondContact O-N 3.34Å
17M97.9Very high97.5Very high46 Ų4692.3 Ų92.323%0.22751%0.514CS..Hα-helixtrans-67.5-33.2179.2-170.362.9-163.800111.7L9 A12 S14 P15 L20 I21L9-M17 HydrophobicContact CB-CE 3.86Å; L9-M17 HydrophobicContact CD1-CE 3.95Å; L9-M17 HydrophobicContact CD2-CE 4.19Å; L9-M17 HydrophobicContact CG-CE 4.21Å; A12-M17 HydrophobicContact CB-CB 3.97Å; A12-M17 HydrophobicContact CB-CG 4.05Å; S14-M17 WeakPolarHBondContact O-CB 3.32Å; S14-M17 PolarHBondContact O-N 3.38Å; S14-M17 PolarHBondContact OG-N 3.36Å; P15-M17 VanDerWaalsContact C-N 3.3Å; P15-M17 PolarHBondContact O-N 3.34Å; M17-L20 PolarHBondContact O-N 3.48Å; M17-L20 HydrophobicContact SD-CD1 4.39Å; M17-I21 HydrophobicContact CE-CD1 4.14Å; M17-I21 HydrophobicContact CE-CG1 3.91Å; M17-I21 HydrophobicContact CG-CD1 4.24Å; M17-I21 VanDerWaalsContact O-CG1 3.25Å; M17-I21 WeakPolarHBondContact O-CG1 3.21Å; M17-I21 PolarHBondContact O-N 3.46Å
18E98.3Very high97.6Very high122 Ų12288.2 Ų88.257%0.5749%0.486SS*.Hα-helixtrans-64.9-43.9174.5-172.1174176.500111.8A12 S14 P15 I16 L20 I21 T22A12-E18 HydrophobicContact CB-CB 4.11Å; S14-E18 PolarHBondContact O-N 3.23Å; P15-E18 WeakPolarHBondContact O-CB 3.49Å; P15-E18 PolarHBondContact O-N 3.46Å; I16-E18 VanDerWaalsContact C-N 3.3Å; I16-E18 PolarHBondContact O-N 2.86Å; E18-L20 VanDerWaalsContact C-N 3.33Å; E18-L20 PolarHBondContact O-N 3Å; E18-I21 PolarHBondContact O-N 2.87Å; E18-T22 PolarHBondContact O-N 2.97Å; E18-T22 PolarHBondContact O-OG1 3.31Å; E18-T22 VanDerWaalsContact O-OG1 3.04Å
19E98.4Very high97.8Very high133 Ų13390.3 Ų90.362%0.62148%0.483SS*.Hα-helixtrans-62.2-40.6173.3-67.2-61.2144.900111.8P15 I16 T22 F23P15-E19 PolarHBondContact O-N 3.45Å; I16-E19 PolarHBondContact O-N 3.29Å; E19-T22 PolarHBondContact O-N 3.43Å; E19-F23 VanDerWaalsContact O-CB 3.32Å; E19-F23 WeakPolarHBondContact O-CB 3.36Å; E19-F23 PolarHBondContact O-N 3.35Å
20L98.2Very high97.9Very high90 Ų9089.9 Ų89.947%0.47148%0.48SS..Hα-helixtrans-66.7-38.4177.9-72.6174000112.7I16 M17 E18 F23 H24I16-L20 HydrophobicContact CG2-CD1 4.05Å; I16-L20 HydrophobicContact CG2-CG 4.31Å; I16-L20 VanDerWaalsContact O-CG 3.28Å; I16-L20 WeakPolarHBondContact O-CG 3.47Å; I16-L20 PolarHBondContact O-N 3.34Å; M17-L20 PolarHBondContact O-N 3.48Å; M17-L20 HydrophobicContact SD-CD1 4.39Å; E18-L20 VanDerWaalsContact C-N 3.33Å; E18-L20 PolarHBondContact O-N 3Å; L20-F23 PolarHBondContact O-N 3.21Å; L20-H24 WeakPolarHBondContact O-CB 3.25Å; L20-H24 PolarHBondContact O-N 3.47Å
21I98.4Very high98Very high42 Ų4289.9 Ų89.922%0.21548%0.482CS..Hα-helixtrans-64.2-46.5174.7-69.3166.1000109.7L9 A12 M17 E18 F23 H24 D25L9-I21 HydrophobicContact CB-CG1 4.15Å; L9-I21 HydrophobicContact CD1-CG1 3.81Å; A12-I21 HydrophobicContact CB-CD1 4.09Å; M17-I21 HydrophobicContact CE-CD1 4.14Å; M17-I21 HydrophobicContact CE-CG1 3.91Å; M17-I21 HydrophobicContact CG-CD1 4.24Å; M17-I21 VanDerWaalsContact O-CG1 3.25Å; M17-I21 WeakPolarHBondContact O-CG1 3.21Å; M17-I21 PolarHBondContact O-N 3.46Å; E18-I21 PolarHBondContact O-N 2.87Å; I21-F23 VanDerWaalsContact C-N 3.33Å; I21-F23 PolarHBondContact O-N 3.43Å; I21-H24 WeakPolarHBondContact O-CB 3.13Å; I21-H24 PolarHBondContact O-N 3.47Å; I21-D25 PolarHBondContact O-N 3.45Å
22T98.3Very high98.1Very high88 Ų8889 Ų8954%0.5447%0.472SS..Hα-helixtrans-61.2-42.8177.7-57.90000111.8E18 E19 D25 H26E18-T22 PolarHBondContact O-N 2.97Å; E18-T22 PolarHBondContact O-OG1 3.31Å; E18-T22 VanDerWaalsContact O-OG1 3.04Å; E19-T22 PolarHBondContact O-N 3.43Å; T22-D25 PolarHBondContact O-N 3.21Å; T22-H26 PolarHBondContact O-N 2.94Å; T22-H26 VanDerWaalsContact O-N 3.14Å
23F98.6Very high98.2Very high140 Ų14092 Ų9261%0.61448%0.481SS*.Hα-helixtrans-63.1-44.8175.3174.8-103.5000112.1E19 L20 I21 D25 H26 A27E19-F23 VanDerWaalsContact O-CB 3.32Å; E19-F23 WeakPolarHBondContact O-CB 3.36Å; E19-F23 PolarHBondContact O-N 3.35Å; L20-F23 PolarHBondContact O-N 3.21Å; I21-F23 VanDerWaalsContact C-N 3.33Å; I21-F23 PolarHBondContact O-N 3.43Å; F23-D25 VanDerWaalsContact C-N 3.34Å; F23-D25 PolarHBondContact O-N 3.14Å; F23-H26 PolarHBondContact O-N 3.21Å; F23-A27 PolarHBondContact O-N 3.03Å
24H98.4Very high98.3Very high68 Ų6889.9 Ų89.932%0.31546%0.464SS..Hα-helixtrans-58.4-45.7177167.1-88.4000111.7L9 L20 I21 H26 A27 L28L9-H24 HydrophobicContact CD1-CB 4.12Å; L20-H24 WeakPolarHBondContact O-CB 3.25Å; L20-H24 PolarHBondContact O-N 3.47Å; I21-H24 WeakPolarHBondContact O-CB 3.13Å; I21-H24 PolarHBondContact O-N 3.47Å; H24-H26 VanDerWaalsContact C-N 3.33Å; H24-H26 PolarHBondContact O-N 3.41Å; H24-A27 PolarHBondContact O-N 3.04Å; H24-L28 WeakPolarHBondContact CE1-CD1 3.29Å; H24-L28 PolarHBondContact O-N 3.21Å
25D97.9Very high98.3Very high95 Ų9590.6 Ų90.651%0.50847%0.468SS..Hα-helixtrans-64.2-39.3-180-69-7.1000111.6I21 T22 F23 L28 M29I21-D25 PolarHBondContact O-N 3.45Å; T22-D25 PolarHBondContact O-N 3.21Å; F23-D25 VanDerWaalsContact C-N 3.34Å; F23-D25 PolarHBondContact O-N 3.14Å; D25-L28 PolarHBondContact O-N 3.39Å; D25-M29 PolarHBondContact O-N 2.9Å
26H98.5Very high98.4Very high105 Ų10592 Ų9249%0.48646%0.464SS..Hα-helixtrans-63.7-43.1173.8-171.769.2000112.4T22 F23 H24 M29 I30T22-H26 PolarHBondContact O-N 2.94Å; T22-H26 VanDerWaalsContact O-N 3.14Å; F23-H26 PolarHBondContact O-N 3.21Å; H24-H26 VanDerWaalsContact C-N 3.33Å; H24-H26 PolarHBondContact O-N 3.41Å; H26-M29 PolarHBondContact O-N 3.27Å; H26-I30 WeakPolarHBondContact O-CG1 3.33Å; H26-I30 PolarHBondContact O-N 2.97Å
27A98.6Very high98.4Very high32 Ų3291.7 Ų91.726%0.26446%0.463SS..Hα-helixtrans-64.2-44177.200000111.9F23 H24 M29 I30 I31F23-A27 PolarHBondContact O-N 3.03Å; H24-A27 PolarHBondContact O-N 3.04Å; A27-M29 VanDerWaalsContact C-N 3.35Å; A27-M29 PolarHBondContact O-N 3.4Å; A27-I30 PolarHBondContact O-N 2.88Å; A27-I31 WeakPolarHBondContact O-CG1 3.49Å; A27-I31 PolarHBondContact O-N 3.43Å
28L98.4Very high98.4Very high63 Ų6394.2 Ų94.233%0.3348%0.481SS..Hα-helixtrans-62.4-40.6177-79.2-170000112.2H24 D25 I30 I31 F32H24-L28 WeakPolarHBondContact CE1-CD1 3.29Å; H24-L28 PolarHBondContact O-N 3.21Å; D25-L28 PolarHBondContact O-N 3.39Å; L28-I30 VanDerWaalsContact C-N 3.3Å; L28-I30 PolarHBondContact O-N 3.45Å; L28-I31 HydrophobicContact CD2-CD1 4.41Å; L28-I31 PolarHBondContact O-N 3.27Å; L28-F32 HydrophobicContact CB-CD2 4.48Å; L28-F32 WeakPolarHBondContact O-CD2 3.44Å; L28-F32 PolarHBondContact O-N 3.27Å
29M98.4Very high98.4Very high96 Ų9695.4 Ų95.447%0.47349%0.49SS..Hα-helixtrans-54.8-47.8173.7-179.4-165.968.800111.1D25 H26 A27 F32 L33D25-M29 PolarHBondContact O-N 2.9Å; H26-M29 PolarHBondContact O-N 3.27Å; A27-M29 VanDerWaalsContact C-N 3.35Å; A27-M29 PolarHBondContact O-N 3.4Å; M29-F32 PolarHBondContact O-N 3.44Å; M29-L33 HydrophobicContact CG-CD1 4.08Å; M29-L33 VanDerWaalsContact O-CG 3.23Å; M29-L33 WeakPolarHBondContact O-CG 3.48Å; M29-L33 PolarHBondContact O-N 3.44Å
30I98.7Very high98.2Very high71 Ų7199 Ų9936%0.36450%0.5SS..Hα-helixtrans-63.3-45179.4-65.5168.5000111.2H26 A27 L28 F32 L33 I34H26-I30 WeakPolarHBondContact O-CG1 3.33Å; H26-I30 PolarHBondContact O-N 2.97Å; A27-I30 PolarHBondContact O-N 2.88Å; L28-I30 VanDerWaalsContact C-N 3.3Å; L28-I30 PolarHBondContact O-N 3.45Å; I30-F32 PolarHBondContact O-N 3.46Å; I30-L33 PolarHBondContact O-N 3.23Å; I30-I34 HydrophobicContact CG2-CD1 3.86Å; I30-I34 HydrophobicContact CG2-CG1 4.48Å; I30-I34 WeakPolarHBondContact O-CG1 3.5Å; I30-I34 PolarHBondContact O-N 2.92Å
31I98.6Very high97.3Very high92 Ų92101 Ų10147%0.47253%0.529SS..Hα-helixtrans-59.8-47.7179.1-68.2165000110.3A27 L28 L33 I34 C35A27-I31 WeakPolarHBondContact O-CG1 3.49Å; A27-I31 PolarHBondContact O-N 3.43Å; L28-I31 HydrophobicContact CD2-CD1 4.41Å; L28-I31 PolarHBondContact O-N 3.27Å; I31-L33 VanDerWaalsContact C-N 3.35Å; I31-L33 PolarHBondContact O-N 2.86Å; I31-I34 PolarHBondContact O-N 3.26Å; I31-C35 WeakPolarHBondContact O-CB 3.18Å; I31-C35 PolarHBondContact O-N 3.42Å; I31-C35 PolarHBondContact O-SG 3.08Å
32F98.4Very high97.2Very high116 Ų116104 Ų10451%0.50954%0.544SS..Hα-helixtrans-62.3-41.1177.9-81.4-63000112.4L28 M29 I30 I34 C35 F36L28-F32 HydrophobicContact CB-CD2 4.48Å; L28-F32 WeakPolarHBondContact O-CD2 3.44Å; L28-F32 PolarHBondContact O-N 3.27Å; M29-F32 PolarHBondContact O-N 3.44Å; I30-F32 PolarHBondContact O-N 3.46Å; F32-I34 VanDerWaalsContact C-N 3.33Å; F32-I34 PolarHBondContact O-N 3.27Å; F32-C35 PolarHBondContact O-N 3.01Å; F32-F36 HydrophobicContact CB-CD2 4.42Å; F32-F36 HydrophobicContact CB-CE2 4.22Å; F32-F36 HydrophobicContact CD1-CE2 4.45Å; F32-F36 WeakPolarHBondContact O-CD2 3.37Å; F32-F36 WeakPolarHBondContact O-CG 3.36Å; F32-F36 PolarHBondContact O-N 3.49Å
33L98.4Very high97.2Very high108 Ų108104.8 Ų104.857%0.56555%0.545SS*.Hα-helixtrans-59.6-43.9175.4-72.5169.8000111.8M29 I30 I31 F36 L37M29-L33 HydrophobicContact CG-CD1 4.08Å; M29-L33 VanDerWaalsContact O-CG 3.23Å; M29-L33 WeakPolarHBondContact O-CG 3.48Å; M29-L33 PolarHBondContact O-N 3.44Å; I30-L33 PolarHBondContact O-N 3.23Å; I31-L33 VanDerWaalsContact C-N 3.35Å; I31-L33 PolarHBondContact O-N 2.86Å; L33-F36 PolarHBondContact O-N 3.42Å; L33-L37 WeakPolarHBondContact O-CB 3.33Å; L33-L37 PolarHBondContact O-N 3.42Å
34I98.5Very high97.1Very high94 Ų94102.8 Ų102.848%0.48254%0.541SS..Hα-helixtrans-65.1-45.1176.1-66.4168.6000110.5I30 I31 F32 F36 L37 V38I30-I34 HydrophobicContact CG2-CD1 3.86Å; I30-I34 HydrophobicContact CG2-CG1 4.48Å; I30-I34 WeakPolarHBondContact O-CG1 3.5Å; I30-I34 PolarHBondContact O-N 2.92Å; I31-I34 PolarHBondContact O-N 3.26Å; F32-I34 VanDerWaalsContact C-N 3.33Å; F32-I34 PolarHBondContact O-N 3.27Å; I34-F36 PolarHBondContact O-N 3.39Å; I34-L37 PolarHBondContact O-N 3.25Å; I34-V38 HydrophobicContact CG2-CG2 4.28Å; I34-V38 WeakPolarHBondContact O-CB 3.23Å; I34-V38 WeakPolarHBondContact O-CG2 3.24Å; I34-V38 PolarHBondContact O-N 2.98Å
35C98.5Very high97Very high70 Ų70104.9 Ų104.947%0.47355%0.554SS.*Hα-helixtrans-58.9-45.7177.6-710000111.8I31 F32 V38 L39I31-C35 WeakPolarHBondContact O-CB 3.18Å; I31-C35 PolarHBondContact O-N 3.42Å; I31-C35 PolarHBondContact O-SG 3.08Å; F32-C35 PolarHBondContact O-N 3.01Å; C35-V38 PolarHBondContact O-N 3.45Å; C35-L39 VanDerWaalsContact O-CB 3.24Å; C35-L39 WeakPolarHBondContact O-CB 3.47Å; C35-L39 PolarHBondContact O-N 2.88Å
36F98.4Very high97Very high134 Ų134105.5 Ų105.559%0.58856%0.557SS**Hα-helixtrans-66.5-39.5177.3-72.1-52.5000112.4F32 L33 I34 L39 Y40F32-F36 HydrophobicContact CB-CD2 4.42Å; F32-F36 HydrophobicContact CB-CE2 4.22Å; F32-F36 HydrophobicContact CD1-CE2 4.45Å; F32-F36 WeakPolarHBondContact O-CD2 3.37Å; F32-F36 WeakPolarHBondContact O-CG 3.36Å; F32-F36 PolarHBondContact O-N 3.49Å; L33-F36 PolarHBondContact O-N 3.42Å; I34-F36 PolarHBondContact O-N 3.39Å; F36-L39 PolarHBondContact O-N 2.87Å; F36-Y40 VanDerWaalsContact O-CB 3.28Å; F36-Y40 WeakPolarHBondContact O-CB 3.08Å; F36-Y40 PolarHBondContact O-N 3.01Å
37L98.1Very high96.9Very high120 Ų120105.5 Ų105.563%0.62856%0.562SS**Hα-helixtrans-59.4-48174.6178.666.9000111.2L33 I34 Y40 A41L33-L37 WeakPolarHBondContact O-CB 3.33Å; L33-L37 PolarHBondContact O-N 3.42Å; I34-L37 PolarHBondContact O-N 3.25Å; L37-Y40 PolarHBondContact O-N 2.94Å; L37-A41 WeakPolarHBondContact O-CB 3.28Å; L37-A41 PolarHBondContact O-N 3.49Å; L37-A41 VanDerWaalsContact O-N 3.08Å
38V98.3Very high96.7Very high100 Ų100110.8 Ų110.861%0.60658%0.583SS**Hα-helixtrans-68.5-38-179.81720000111.9I34 C35 Y40I34-V38 HydrophobicContact CG2-CG2 4.28Å; I34-V38 WeakPolarHBondContact O-CB 3.23Å; I34-V38 WeakPolarHBondContact O-CG2 3.24Å; I34-V38 PolarHBondContact O-N 2.98Å; C35-V38 PolarHBondContact O-N 3.45Å; V38-Y40 VanDerWaalsContact C-N 3.34Å
39L98.1Very high96.6Very high146 Ų146114.5 Ų114.576%0.76460%0.602SS**Hα-helixtrans-69-33.9178.9-172.378.2000112.2C35 F36C35-L39 VanDerWaalsContact O-CB 3.24Å; C35-L39 WeakPolarHBondContact O-CB 3.47Å; C35-L39 PolarHBondContact O-N 2.88Å; F36-L39 PolarHBondContact O-N 2.87Å
40Y93.9Very high96.5Very high210 Ų210116 Ų11682%0.82461%0.613SS**Hα-helixtrans-80.8-33.1-179.6179.7-98000113.4F36 L37 V38F36-Y40 VanDerWaalsContact O-CB 3.28Å; F36-Y40 WeakPolarHBondContact O-CB 3.08Å; F36-Y40 PolarHBondContact O-N 3.01Å; L37-Y40 PolarHBondContact O-N 2.94Å; V38-Y40 VanDerWaalsContact C-N 3.34Å
41A79.8Confident96.3Very high131 Ų131120.1 Ų120.1100%1.08364%0.636SS**  trans-65.60178.400000112.3L37L37-A41 WeakPolarHBondContact O-CB 3.28Å; L37-A41 PolarHBondContact O-N 3.49Å; L37-A41 VanDerWaalsContact O-N 3.08Å

Retrieved 41 of 41 residues in 43.5 ms (Link to these results)