A0A075X8I1_HUMAN Loading...

NADH dehydrogenase subunit 4

AlphaFold DB , UniProt , Accession A0A075X8I1, Species HUMAN (Homo sapiens, Human), Gene ND4, Length 103 aa.

						>A0A075X8I1_HUMAN|A0A075X8I1|ND4
FWWLLASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	F	66.1	Low	69	Low	164 Å²	164	67.7 Å²	67.7	72%	0.719	34%	0.335	S	S	*	.				0	-57	0	-169.7	-109.5	0	0	0	112.1	W3 L4 L5	F1-W3 VanDerWaalsContact C-N 3.31Å; F1-W3 PolarHBondContact O-N 3.09Å; F1-L4 WeakPolarHBondContact O-CB 3.47Å; F1-L4 PolarHBondContact O-N 3.16Å; F1-L5 HydrophobicContact CD1-CD1 4.09Å; F1-L5 HydrophobicContact CD2-CD1 4.09Å; F1-L5 HydrophobicContact CE1-CD1 3.59Å; F1-L5 HydrophobicContact CE1-CD2 4.11Å; F1-L5 HydrophobicContact CE1-CG 4.49Å; F1-L5 HydrophobicContact CE2-CD1 3.58Å; F1-L5 HydrophobicContact CG-CD1 4.33Å; F1-L5 HydrophobicContact CZ-CD1 3.31Å; F1-L5 HydrophobicContact CZ-CD2 4.34Å; F1-L5 HydrophobicContact CZ-CG 4.47Å; F1-L5 PolarHBondContact O-N 3.13Å; F1-L5 VanDerWaalsContact O-N 3.1Å
2	W	73.5	Confident	68.1	Low	67 Å²	67	63.1 Å²	63.1	25%	0.254	32%	0.315	S	S	.	.	H	α-helix	trans	-53.5	-43	178.8	-60.3	119.4	0	0	0	114.6	L4 L5 A6 N78 M81 F82 L85	W2-L4 VanDerWaalsContact C-N 3.29Å; W2-L4 PolarHBondContact O-N 3.46Å; W2-L5 PolarHBondContact O-N 3.18Å; W2-A6 WeakPolarHBondContact O-CB 3.29Å; W2-A6 PolarHBondContact O-N 3.28Å; W2-N78 HydrophobicContact CZ2-CB 4.2Å; W2-N78 PolarHBondContact NE1-OD1 3.5Å; W2-M81 HydrophobicContact CB-CB 4.24Å; W2-M81 HydrophobicContact CB-CE 3.96Å; W2-M81 HydrophobicContact CB-CG 4.27Å; W2-M81 HydrophobicContact CD2-CB 3.86Å; W2-M81 HydrophobicContact CE3-CB 3.97Å; W2-M81 HydrophobicContact CG-CB 4Å; W2-M81 HydrophobicContact CG-CG 4.34Å; W2-F82 HydrophobicContact CH2-CB 3.81Å; W2-F82 HydrophobicContact CH2-CD2 4.08Å; W2-F82 HydrophobicContact CH2-CG 4.44Å; W2-F82 HydrophobicContact CZ3-CB 4.21Å; W2-F82 HydrophobicContact CZ3-CD2 4.44Å; W2-L85 HydrophobicContact CE3-CD1 3.57Å; W2-L85 HydrophobicContact CZ3-CD1 3.94Å
3	W	70.1	Confident	66.9	Low	124 Å²	124	63.1 Å²	63.1	47%	0.47	32%	0.316	S	S	.	.	H	α-helix	trans	-62.8	-33.6	176.3	-76.9	103.1	0	0	0	113.8	F1 S7 M54 F55 Q59	F1-W3 VanDerWaalsContact C-N 3.31Å; F1-W3 PolarHBondContact O-N 3.09Å; W3-S7 WeakPolarHBondContact O-CB 3.43Å; W3-S7 PolarHBondContact O-N 3.36Å; W3-S7 PolarHBondContact O-OG 3.23Å; W3-S7 VanDerWaalsContact O-OG 3.08Å; W3-M54 HydrophobicContact CZ3-SD 3.99Å; W3-F55 HydrophobicContact CB-CE2 4.46Å; W3-Q59 HydrophobicContact CB-CG 3.72Å; W3-Q59 HydrophobicContact CG-CG 4.25Å
4	L	74.4	Confident	65	Low	66 Å²	66	65.9 Å²	65.9	35%	0.346	34%	0.341	S	S	.	.	H	α-helix	trans	-71.3	-44.3	176.5	178.9	145.6	0	0	0	110.4	F1 W2 A6 S7 L8 F55	F1-L4 WeakPolarHBondContact O-CB 3.47Å; F1-L4 PolarHBondContact O-N 3.16Å; W2-L4 VanDerWaalsContact C-N 3.29Å; W2-L4 PolarHBondContact O-N 3.46Å; L4-A6 PolarHBondContact O-N 3.44Å; L4-S7 WeakPolarHBondContact CA-OG 3.38Å; L4-S7 PolarHBondContact O-N 3.43Å; L4-S7 PolarHBondContact O-OG 3.21Å; L4-L8 HydrophobicContact CD2-CD1 3.33Å; L4-L8 HydrophobicContact CD2-CG 4.33Å; L4-L8 HydrophobicContact CG-CD1 3.98Å; L4-L8 HydrophobicContact CG-CG 4.5Å; L4-L8 VanDerWaalsContact O-CB 3.3Å; L4-L8 WeakPolarHBondContact O-CB 3.1Å; L4-L8 WeakPolarHBondContact O-CD1 3.39Å; L4-L8 WeakPolarHBondContact O-CG 3.48Å; L4-L8 PolarHBondContact O-N 3.15Å; L4-F55 VanDerWaalsContact CA-CE2 3.47Å; L4-F55 HydrophobicContact CB-CE2 3.62Å; L4-F55 HydrophobicContact CB-CZ 3.89Å; L4-F55 HydrophobicContact CD1-CE2 4.49Å; L4-F55 HydrophobicContact CD1-CZ 3.88Å; L4-F55 HydrophobicContact CG-CE2 4.33Å; L4-F55 HydrophobicContact CG-CZ 4.18Å
5	L	70	Confident	63.9	Low	43 Å²	43	67.9 Å²	67.9	23%	0.225	36%	0.36	C	S	.	.	H	α-helix	trans	-63.9	-41.1	175.1	-96.6	73.5	0	0	0	112.1	F1 W2 L8 A9 L85	F1-L5 HydrophobicContact CD1-CD1 4.09Å; F1-L5 HydrophobicContact CD2-CD1 4.09Å; F1-L5 HydrophobicContact CE1-CD1 3.59Å; F1-L5 HydrophobicContact CE1-CD2 4.11Å; F1-L5 HydrophobicContact CE1-CG 4.49Å; F1-L5 HydrophobicContact CE2-CD1 3.58Å; F1-L5 HydrophobicContact CG-CD1 4.33Å; F1-L5 HydrophobicContact CZ-CD1 3.31Å; F1-L5 HydrophobicContact CZ-CD2 4.34Å; F1-L5 HydrophobicContact CZ-CG 4.47Å; F1-L5 PolarHBondContact O-N 3.13Å; F1-L5 VanDerWaalsContact O-N 3.1Å; W2-L5 PolarHBondContact O-N 3.18Å; L5-L8 PolarHBondContact O-N 3.41Å; L5-A9 WeakPolarHBondContact O-CB 3.5Å; L5-A9 PolarHBondContact O-N 2.65Å; L5-L85 HydrophobicContact CB-CD1 3.93Å; L5-L85 HydrophobicContact CB-CD2 4.39Å; L5-L85 HydrophobicContact CD2-CD1 4.36Å
6	A	73.6	Confident	64.6	Low	29 Å²	29	64.6 Å²	64.6	24%	0.24	34%	0.343	C	S	.	.	H	α-helix	trans	-66.2	-42.3	177.5	0	0	0	0	0	111.8	W2 L4 A9 N10 M81	W2-A6 WeakPolarHBondContact O-CB 3.29Å; W2-A6 PolarHBondContact O-N 3.28Å; L4-A6 PolarHBondContact O-N 3.44Å; A6-A9 PolarHBondContact O-N 3.43Å; A6-N10 VanDerWaalsContact O-CB 3.3Å; A6-N10 WeakPolarHBondContact O-CB 3.34Å; A6-N10 PolarHBondContact O-N 3.49Å; A6-M81 HydrophobicContact CB-CE 4.35Å
7	S	67.1	Low	65.1	Low	20 Å²	20	63.5 Å²	63.5	14%	0.14	34%	0.337	C	S	.	.	H	α-helix	trans	-67.4	-38.9	175.6	65.5	0	0	0	0	111.8	W3 L4 N10 L11 F55	W3-S7 WeakPolarHBondContact O-CB 3.43Å; W3-S7 PolarHBondContact O-N 3.36Å; W3-S7 PolarHBondContact O-OG 3.23Å; W3-S7 VanDerWaalsContact O-OG 3.08Å; L4-S7 WeakPolarHBondContact CA-OG 3.38Å; L4-S7 PolarHBondContact O-N 3.43Å; L4-S7 PolarHBondContact O-OG 3.21Å; S7-N10 PolarHBondContact O-N 2.95Å; S7-L11 WeakPolarHBondContact O-CB 3.49Å; S7-L11 PolarHBondContact O-N 3.48Å; S7-F55 WeakPolarHBondContact OG-CD2 3.35Å
8	L	67.8	Low	65.9	Low	65 Å²	65	63.7 Å²	63.7	34%	0.34	34%	0.338	S	S	.	.	H	α-helix	trans	-65.1	-40.2	175	-72	165.1	0	0	0	112.2	L4 L5 N10 L11 L13	L4-L8 HydrophobicContact CD2-CD1 3.33Å; L4-L8 HydrophobicContact CD2-CG 4.33Å; L4-L8 HydrophobicContact CG-CD1 3.98Å; L4-L8 HydrophobicContact CG-CG 4.5Å; L4-L8 VanDerWaalsContact O-CB 3.3Å; L4-L8 WeakPolarHBondContact O-CB 3.1Å; L4-L8 WeakPolarHBondContact O-CD1 3.39Å; L4-L8 WeakPolarHBondContact O-CG 3.48Å; L4-L8 PolarHBondContact O-N 3.15Å; L5-L8 PolarHBondContact O-N 3.41Å; L8-N10 VanDerWaalsContact C-N 3.32Å; L8-L11 PolarHBondContact O-N 3.13Å; L8-L13 HydrophobicContact CB-CD1 3.77Å; L8-L13 HydrophobicContact CD2-CD1 3.21Å; L8-L13 HydrophobicContact CD2-CD2 4Å; L8-L13 HydrophobicContact CD2-CG 4.23Å; L8-L13 HydrophobicContact CG-CD1 4.03Å; L8-L13 WeakPolarHBondContact O-CD1 3.45Å
9	A	65.7	Low	66.5	Low	21 Å²	21	62.8 Å²	62.8	17%	0.174	33%	0.333	C	S	.	.	H	α-helix	trans	-65.2	-37.3	174.1	0	0	0	0	0	111.6	L5 A6 I88	L5-A9 WeakPolarHBondContact O-CB 3.5Å; L5-A9 PolarHBondContact O-N 2.65Å; A6-A9 PolarHBondContact O-N 3.43Å; A9-I88 HydrophobicContact CB-CG2 4.41Å
10	N	69.3	Low	67.1	Low	89 Å²	89	63.4 Å²	63.4	48%	0.476	34%	0.336	S	S	.	.	H	α-helix	trans	-73.4	-34	176.2	-160.4	22.4	0	0	0	112.4	A6 S7 L8 A12 N18	A6-N10 VanDerWaalsContact O-CB 3.3Å; A6-N10 WeakPolarHBondContact O-CB 3.34Å; A6-N10 PolarHBondContact O-N 3.49Å; S7-N10 PolarHBondContact O-N 2.95Å; L8-N10 VanDerWaalsContact C-N 3.32Å; N10-A12 PolarHBondContact O-N 3.2Å; N10-A12 VanDerWaalsContact O-N 3.09Å; N10-N18 PolarHBondContact O-ND2 3.05Å
11	L	61.6	Low	67.7	Low	57 Å²	57	61.9 Å²	61.9	30%	0.298	34%	0.336	S	S	.	.	T	Hydrogen-bonded Turn	trans	-75.7	12	179	-161.5	86.1	0	0	0	112.9	S7 L8 L13 A48 S51	S7-L11 WeakPolarHBondContact O-CB 3.49Å; S7-L11 PolarHBondContact O-N 3.48Å; L8-L11 PolarHBondContact O-N 3.13Å; L11-L13 VanDerWaalsContact C-N 3.27Å; L11-L13 HydrophobicContact CB-CD1 4.04Å; L11-L13 HydrophobicContact CD2-CD1 3.85Å; L11-L13 HydrophobicContact CG-CD1 4.45Å; L11-L13 PolarHBondContact O-N 2.88Å; L11-L13 VanDerWaalsContact O-N 3.16Å; L11-A48 HydrophobicContact CD1-CB 3.81Å; L11-A48 VanDerWaalsContact CD1-O 3.28Å; L11-A48 WeakPolarHBondContact CD1-O 3.43Å; L11-S51 WeakPolarHBondContact CD1-OG 3.45Å
12	A	58.2	Low	68.4	Low	12 Å²	12	56.9 Å²	56.9	10%	0.099	32%	0.315	C	S	.	.	T	Hydrogen-bonded Turn	trans	51.2	45.1	175.6	0	0	0	0	0	112.1	N10 T16 N18 L19	N10-A12 PolarHBondContact O-N 3.2Å; N10-A12 VanDerWaalsContact O-N 3.09Å; A12-T16 WeakPolarHBondContact CA-OG1 3.49Å; A12-N18 HydrophobicContact CB-CB 4.25Å; A12-L19 HydrophobicContact CB-CB 3.86Å; A12-L19 WeakPolarHBondContact O-CB 3.43Å; A12-L19 WeakPolarHBondContact O-CD1 3Å
13	L	52.3	Low	68.8	Low	63 Å²	63	57.9 Å²	57.9	33%	0.33	33%	0.325	S	S	.	.			trans	-64.1	151.3	175.1	-92	104.9	0	0	0	111.7	L8 L11 T16	L8-L13 HydrophobicContact CB-CD1 3.77Å; L8-L13 HydrophobicContact CD2-CD1 3.21Å; L8-L13 HydrophobicContact CD2-CD2 4Å; L8-L13 HydrophobicContact CD2-CG 4.23Å; L8-L13 HydrophobicContact CG-CD1 4.03Å; L8-L13 WeakPolarHBondContact O-CD1 3.45Å; L11-L13 VanDerWaalsContact C-N 3.27Å; L11-L13 HydrophobicContact CB-CD1 4.04Å; L11-L13 HydrophobicContact CD2-CD1 3.85Å; L11-L13 HydrophobicContact CG-CD1 4.45Å; L11-L13 PolarHBondContact O-N 2.88Å; L11-L13 VanDerWaalsContact O-N 3.16Å; L13-T16 PolarHBondContact N-OG1 3.12Å; L13-T16 WeakPolarHBondContact O-CB 3.44Å; L13-T16 WeakPolarHBondContact O-CG2 3.38Å; L13-T16 PolarHBondContact O-N 3.21Å; L13-T16 PolarHBondContact O-OG1 3.26Å
14	P	40.6	Very low	69.5	Low	102 Å²	102	55.1 Å²	55.1	66%	0.662	32%	0.324	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.8	100.2	178	30	-30.8	0	0	0	106.9
15	P	48.3	Very low	69.9	Low	97 Å²	97	55.5 Å²	55.5	63%	0.63	33%	0.329	S	S	*	.	T	Hydrogen-bonded Turn		-143.2	47.5	58.8	33.7	-9.5	0	0	0	112	S92	P15-S92 WeakPolarHBondContact O-CB 3.34Å
16	T	75.1	Confident	70.7	Confident	15 Å²	15	54.6 Å²	54.6	9%	0.092	32%	0.324	C	S	.	.			trans	-87	153.7	-173.9	57.2	0	0	0	0	113.1	A12 L13 N18 L19 L20	A12-T16 WeakPolarHBondContact CA-OG1 3.49Å; L13-T16 PolarHBondContact N-OG1 3.12Å; L13-T16 WeakPolarHBondContact O-CB 3.44Å; L13-T16 WeakPolarHBondContact O-CG2 3.38Å; L13-T16 PolarHBondContact O-N 3.21Å; L13-T16 PolarHBondContact O-OG1 3.26Å; T16-N18 PolarHBondContact O-N 3.41Å; T16-L19 PolarHBondContact O-N 3.28Å; T16-L20 PolarHBondContact O-N 3.25Å
17	I	73.2	Confident	71.2	Confident	45 Å²	45	58 Å²	58	23%	0.231	34%	0.342	C	S	.	.	H	α-helix	trans	-59.3	-33.9	177.6	-56	144	0	0	0	111.4	L19 L20 G21 I88 L91 I98	I17-L19 VanDerWaalsContact C-N 3.31Å; I17-L19 PolarHBondContact O-N 2.95Å; I17-L20 PolarHBondContact O-N 3.39Å; I17-G21 PolarHBondContact O-N 2.98Å; I17-I88 WeakPolarHBondContact CD1-O 3.46Å; I17-L91 HydrophobicContact CD1-CB 3.19Å; I17-L91 HydrophobicContact CD1-CD1 4.28Å; I17-L91 HydrophobicContact CD1-CG 4.37Å; I17-L91 HydrophobicContact CG1-CB 4.14Å; I17-I98 HydrophobicContact CD1-CD1 4.25Å; I17-I98 HydrophobicContact CG1-CD1 4.32Å; I17-I98 HydrophobicContact CG2-CD1 3.94Å
18	N	79.6	Confident	72.1	Confident	68 Å²	68	61.1 Å²	61.1	36%	0.364	36%	0.36	S	S	.	.	H	α-helix	trans	-61.2	-42.6	-179.5	-152.5	42.6	0	0	0	110.9	N10 A12 T16 G21 E22	N10-N18 PolarHBondContact O-ND2 3.05Å; A12-N18 HydrophobicContact CB-CB 4.25Å; T16-N18 PolarHBondContact O-N 3.41Å; N18-G21 PolarHBondContact O-N 3.12Å; N18-E22 WeakPolarHBondContact O-CG 3.41Å; N18-E22 PolarHBondContact O-N 2.62Å
19	L	77.1	Confident	73	Confident	47 Å²	47	59.6 Å²	59.6	25%	0.246	35%	0.354	C	S	.	.	H	α-helix	trans	-67.2	-40.7	174	-178.5	133.4	0	0	0	112.4	A12 T16 I17 G21 E22 L23	A12-L19 HydrophobicContact CB-CB 3.86Å; A12-L19 WeakPolarHBondContact O-CB 3.43Å; A12-L19 WeakPolarHBondContact O-CD1 3Å; T16-L19 PolarHBondContact O-N 3.28Å; I17-L19 VanDerWaalsContact C-N 3.31Å; I17-L19 PolarHBondContact O-N 2.95Å; L19-G21 VanDerWaalsContact C-N 3.32Å; L19-G21 PolarHBondContact O-N 3.14Å; L19-E22 PolarHBondContact O-N 3.29Å; L19-L23 HydrophobicContact CD2-CD1 3.37Å; L19-L23 HydrophobicContact CD2-CG 4.22Å; L19-L23 HydrophobicContact CG-CD1 3.94Å; L19-L23 HydrophobicContact CG-CG 4.28Å; L19-L23 VanDerWaalsContact O-CB 3.29Å; L19-L23 WeakPolarHBondContact O-CB 3.48Å; L19-L23 WeakPolarHBondContact O-CG 3.38Å; L19-L23 PolarHBondContact O-N 3.17Å
20	L	78.5	Confident	73.9	Confident	73 Å²	73	63.3 Å²	63.3	38%	0.382	37%	0.366	S	S	.	.	H	α-helix	trans	-61.2	-42.8	177.4	-71.6	171.6	0	0	0	111.5	T16 I17 S24 P95	T16-L20 PolarHBondContact O-N 3.25Å; I17-L20 PolarHBondContact O-N 3.39Å; L20-S24 WeakPolarHBondContact O-CB 3.48Å; L20-S24 PolarHBondContact O-N 3.21Å; L20-S24 PolarHBondContact O-OG 3.44Å; L20-P95 HydrophobicContact CD1-CB 3.68Å; L20-P95 HydrophobicContact CD1-CG 4.23Å
21	G	79.1	Confident	74.6	Confident	33 Å²	33	63.9 Å²	63.9	34%	0.34	38%	0.377	S	S	.	.	H	α-helix	trans	-61.5	-53.3	174.2	0	0	0	0	0	111.9	I17 N18 L19 L23 S24 V25	I17-G21 PolarHBondContact O-N 2.98Å; N18-G21 PolarHBondContact O-N 3.12Å; L19-G21 VanDerWaalsContact C-N 3.32Å; L19-G21 PolarHBondContact O-N 3.14Å; G21-L23 PolarHBondContact O-N 2.68Å; G21-S24 PolarHBondContact O-N 3.42Å; G21-S24 PolarHBondContact O-OG 3.05Å; G21-V25 WeakPolarHBondContact O-CG2 3.33Å; G21-V25 PolarHBondContact O-N 3.22Å
22	E	81.4	Confident	75.8	Confident	59 Å²	59	71.1 Å²	71.1	28%	0.276	40%	0.401	S	S	.	.	H	α-helix	trans	-60.1	-44.1	179.3	-73.6	-177.5	174.6	0	0	112.4	N18 L19 S24 V25 L26 M44	N18-E22 WeakPolarHBondContact O-CG 3.41Å; N18-E22 PolarHBondContact O-N 2.62Å; L19-E22 PolarHBondContact O-N 3.29Å; E22-S24 PolarHBondContact O-N 3.15Å; E22-V25 PolarHBondContact O-N 3.21Å; E22-L26 WeakPolarHBondContact O-CG 3.24Å; E22-L26 PolarHBondContact O-N 3.2Å; E22-M44 HydrophobicContact CB-SD 4.32Å
23	L	82.3	Confident	77	Confident	87 Å²	87	72.5 Å²	72.5	46%	0.455	41%	0.409	S	S	.	.	H	α-helix	trans	-61.6	-42	175	-79.2	174.1	0	0	0	112.3	L19 G21 V25 L26 V27	L19-L23 HydrophobicContact CD2-CD1 3.37Å; L19-L23 HydrophobicContact CD2-CG 4.22Å; L19-L23 HydrophobicContact CG-CD1 3.94Å; L19-L23 HydrophobicContact CG-CG 4.28Å; L19-L23 VanDerWaalsContact O-CB 3.29Å; L19-L23 WeakPolarHBondContact O-CB 3.48Å; L19-L23 WeakPolarHBondContact O-CG 3.38Å; L19-L23 PolarHBondContact O-N 3.17Å; G21-L23 PolarHBondContact O-N 2.68Å; L23-V25 VanDerWaalsContact C-N 3.29Å; L23-V25 PolarHBondContact O-N 3.42Å; L23-L26 HydrophobicContact CD2-CD1 4.17Å; L23-L26 WeakPolarHBondContact O-CB 3.31Å; L23-L26 PolarHBondContact O-N 3.46Å; L23-V27 WeakPolarHBondContact O-CG2 3.36Å; L23-V27 PolarHBondContact O-N 3.46Å
24	S	83.3	Confident	78.4	Confident	66 Å²	66	75.1 Å²	75.1	46%	0.462	42%	0.424	S	S	.	.	H	α-helix	trans	-62.7	-38	177.4	75.4	0	0	0	0	112	L20 G21 E22 V27 T28	L20-S24 WeakPolarHBondContact O-CB 3.48Å; L20-S24 PolarHBondContact O-N 3.21Å; L20-S24 PolarHBondContact O-OG 3.44Å; G21-S24 PolarHBondContact O-N 3.42Å; G21-S24 PolarHBondContact O-OG 3.05Å; E22-S24 PolarHBondContact O-N 3.15Å; S24-V27 PolarHBondContact O-N 2.88Å; S24-T28 WeakPolarHBondContact O-CG2 3.16Å; S24-T28 PolarHBondContact O-N 2.9Å; S24-T28 VanDerWaalsContact O-N 3.13Å; S24-T28 PolarHBondContact O-OG1 3.19Å
25	V	84.2	Confident	80.5	Confident	74 Å²	74	77.3 Å²	77.3	45%	0.448	43%	0.428	S	S	.	.	H	α-helix	trans	-68.4	-39.5	174.7	174.2	0	0	0	0	110.8	G21 E22 L23 V27 T28 T29	G21-V25 WeakPolarHBondContact O-CG2 3.33Å; G21-V25 PolarHBondContact O-N 3.22Å; E22-V25 PolarHBondContact O-N 3.21Å; L23-V25 VanDerWaalsContact C-N 3.29Å; L23-V25 PolarHBondContact O-N 3.42Å; V25-V27 PolarHBondContact O-N 3.01Å; V25-T28 WeakPolarHBondContact CA-OG1 3.42Å; V25-T28 PolarHBondContact O-N 3.4Å; V25-T28 PolarHBondContact O-OG1 2.7Å; V25-T29 HydrophobicContact CG1-CG2 4.11Å; V25-T29 WeakPolarHBondContact O-CB 3.42Å; V25-T29 VanDerWaalsContact O-CG2 3.31Å; V25-T29 WeakPolarHBondContact O-CG2 3.34Å; V25-T29 PolarHBondContact O-N 2.9Å; V25-T29 PolarHBondContact O-OG1 3.25Å
26	L	85.7	Confident	82.2	Confident	24 Å²	24	74 Å²	74	13%	0.126	41%	0.407	C	S	.	.	H	α-helix	trans	-60.9	-44.2	174.4	-71.4	170.9	0	0	0	112.2	E22 L23 T28 T29 F30 L37 T40 M44	E22-L26 WeakPolarHBondContact O-CG 3.24Å; E22-L26 PolarHBondContact O-N 3.2Å; L23-L26 HydrophobicContact CD2-CD1 4.17Å; L23-L26 WeakPolarHBondContact O-CB 3.31Å; L23-L26 PolarHBondContact O-N 3.46Å; L26-T28 PolarHBondContact O-N 3.44Å; L26-T29 WeakPolarHBondContact CA-OG1 3.17Å; L26-T29 PolarHBondContact O-OG1 3.2Å; L26-F30 WeakPolarHBondContact O-CB 3.46Å; L26-F30 PolarHBondContact O-N 3Å; L26-L37 HydrophobicContact CD2-CD1 4.47Å; L26-T40 VanDerWaalsContact CD2-CB 3.5Å; L26-T40 HydrophobicContact CD2-CG2 4.44Å; L26-T40 WeakPolarHBondContact CD2-OG1 3.41Å; L26-M44 HydrophobicContact CD1-CE 3.43Å; L26-M44 VanDerWaalsContact CD1-CE 3.43Å; L26-M44 HydrophobicContact CD1-SD 3.65Å; L26-M44 HydrophobicContact CD2-CE 3.76Å; L26-M44 HydrophobicContact CD2-SD 4.39Å; L26-M44 HydrophobicContact CG-CE 4.09Å; L26-M44 HydrophobicContact CG-SD 4.27Å
27	V	85.4	Confident	82.6	Confident	102 Å²	102	77.2 Å²	77.2	62%	0.618	42%	0.423	S	S	*	.	H	α-helix	trans	-63.4	-44.1	-179.7	171.9	0	0	0	0	110.9	L23 S24 V25 S31	L23-V27 WeakPolarHBondContact O-CG2 3.36Å; L23-V27 PolarHBondContact O-N 3.46Å; S24-V27 PolarHBondContact O-N 2.88Å; V25-V27 PolarHBondContact O-N 3.01Å; V27-S31 PolarHBondContact O-N 3.42Å; V27-S31 VanDerWaalsContact O-N 3.12Å
28	T	85.8	Confident	83.2	Confident	84 Å²	84	81.2 Å²	81.2	52%	0.515	44%	0.444	S	S	.	.	H	α-helix	trans	-69.8	-43.7	179.9	53.9	0	0	0	0	112.4	S24 V25 L26 S31 W32	S24-T28 WeakPolarHBondContact O-CG2 3.16Å; S24-T28 PolarHBondContact O-N 2.9Å; S24-T28 VanDerWaalsContact O-N 3.13Å; S24-T28 PolarHBondContact O-OG1 3.19Å; V25-T28 WeakPolarHBondContact CA-OG1 3.42Å; V25-T28 PolarHBondContact O-N 3.4Å; V25-T28 PolarHBondContact O-OG1 2.7Å; L26-T28 PolarHBondContact O-N 3.44Å; T28-S31 PolarHBondContact O-N 3Å; T28-S31 PolarHBondContact O-OG 3.48Å; T28-W32 PolarHBondContact O-N 3.04Å
29	T	86.4	Confident	83.5	Confident	33 Å²	33	83.4 Å²	83.4	20%	0.202	46%	0.455	C	S	.	.	H	α-helix	trans	-67.4	-39	178	52.8	0	0	0	0	112.4	V25 L26 S31 W32 S33 T36	V25-T29 HydrophobicContact CG1-CG2 4.11Å; V25-T29 WeakPolarHBondContact O-CB 3.42Å; V25-T29 VanDerWaalsContact O-CG2 3.31Å; V25-T29 WeakPolarHBondContact O-CG2 3.34Å; V25-T29 PolarHBondContact O-N 2.9Å; V25-T29 PolarHBondContact O-OG1 3.25Å; L26-T29 WeakPolarHBondContact CA-OG1 3.17Å; L26-T29 PolarHBondContact O-OG1 3.2Å; T29-S31 VanDerWaalsContact C-N 3.31Å; T29-S31 PolarHBondContact O-N 2.79Å; T29-W32 WeakPolarHBondContact O-CB 3.26Å; T29-W32 PolarHBondContact O-N 3.48Å; T29-S33 PolarHBondContact O-N 3.47Å; T29-T36 PolarHBondContact O-OG1 3.46Å
30	F	85	Confident	83.9	Confident	99 Å²	99	82.5 Å²	82.5	43%	0.434	45%	0.452	S	S	.	.	H	α-helix	trans	-59.4	-42.1	172.9	-179.2	-106.9	0	0	0	111.9	L26 W32 L37	L26-F30 WeakPolarHBondContact O-CB 3.46Å; L26-F30 PolarHBondContact O-N 3Å; F30-W32 PolarHBondContact O-N 3.24Å; F30-L37 HydrophobicContact CD2-CB 4.2Å; F30-L37 HydrophobicContact CD2-CD1 4.37Å; F30-L37 HydrophobicContact CD2-CD2 4.1Å; F30-L37 HydrophobicContact CD2-CG 4.46Å; F30-L37 HydrophobicContact CE2-CD2 4.16Å
31	S	84.4	Confident	84.1	Confident	101 Å²	101	80.4 Å²	80.4	71%	0.706	45%	0.447	S	S	*	.	H	α-helix	trans	-63	-26.7	176.1	79.4	0	0	0	0	113.3	V27 T28 T29	V27-S31 PolarHBondContact O-N 3.42Å; V27-S31 VanDerWaalsContact O-N 3.12Å; T28-S31 PolarHBondContact O-N 3Å; T28-S31 PolarHBondContact O-OG 3.48Å; T29-S31 VanDerWaalsContact C-N 3.31Å; T29-S31 PolarHBondContact O-N 2.79Å
32	W	85	Confident	84.5	Confident	209 Å²	209	83.2 Å²	83.2	79%	0.792	45%	0.454	S	S	*	.	H	α-helix	trans	-84.3	-45.2	-179.7	-174.4	62.9	0	0	0	112.5	T28 T29 F30 T36	T28-W32 PolarHBondContact O-N 3.04Å; T29-W32 WeakPolarHBondContact O-CB 3.26Å; T29-W32 PolarHBondContact O-N 3.48Å; F30-W32 PolarHBondContact O-N 3.24Å; W32-T36 HydrophobicContact CE3-CG2 4.16Å; W32-T36 HydrophobicContact CZ3-CG2 4.18Å
33	S	84.6	Confident	84.7	Confident	41 Å²	41	85.1 Å²	85.1	29%	0.287	47%	0.466	S	S	.	.			trans	-160.7	136.9	169.5	64.2	0	0	0	0	113.1	T29 I35 T36	T29-S33 PolarHBondContact O-N 3.47Å; S33-I35 PolarHBondContact O-N 3.16Å; S33-I35 VanDerWaalsContact O-N 3.14Å; S33-T36 PolarHBondContact O-N 2.83Å; S33-T36 VanDerWaalsContact O-N 3.12Å; S33-T36 PolarHBondContact O-OG1 2.89Å; S33-T36 WeakPolarHBondContact OG-CG2 3.28Å
34	N	80.5	Confident	84.9	Confident	118 Å²	118	83.7 Å²	83.7	63%	0.631	46%	0.458	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.1	-26.1	-177.7	-67	-5.9	0	0	0	114	T36 L37	N34-T36 VanDerWaalsContact C-N 3.28Å; N34-T36 PolarHBondContact O-N 2.73Å; N34-L37 WeakPolarHBondContact O-CB 3.29Å; N34-L37 PolarHBondContact O-N 2.92Å
35	I	85	Confident	84.9	Confident	148 Å²	148	85.3 Å²	85.3	76%	0.759	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.6	-31.4	179.6	-69	165.3	0	0	0	111.3	S33 L37 L38	S33-I35 PolarHBondContact O-N 3.16Å; S33-I35 VanDerWaalsContact O-N 3.14Å; I35-L37 PolarHBondContact O-N 3.21Å; I35-L38 PolarHBondContact O-N 2.97Å
36	T	84.3	Confident	85	Confident	28 Å²	28	86 Å²	86	17%	0.172	47%	0.465	C	S	.	.	H	α-helix	trans	-67.4	-18.9	-178.9	60.4	0	0	0	0	113.2	T29 W32 S33 N34 L38 L39 T40	T29-T36 PolarHBondContact O-OG1 3.46Å; W32-T36 HydrophobicContact CE3-CG2 4.16Å; W32-T36 HydrophobicContact CZ3-CG2 4.18Å; S33-T36 PolarHBondContact O-N 2.83Å; S33-T36 VanDerWaalsContact O-N 3.12Å; S33-T36 PolarHBondContact O-OG1 2.89Å; S33-T36 WeakPolarHBondContact OG-CG2 3.28Å; N34-T36 VanDerWaalsContact C-N 3.28Å; N34-T36 PolarHBondContact O-N 2.73Å; T36-L38 VanDerWaalsContact C-N 3.34Å; T36-L38 PolarHBondContact O-N 2.89Å; T36-L39 PolarHBondContact O-N 3.14Å; T36-T40 WeakPolarHBondContact O-CB 3.49Å; T36-T40 WeakPolarHBondContact O-CG2 3.42Å; T36-T40 PolarHBondContact O-N 2.71Å; T36-T40 PolarHBondContact O-OG1 3.25Å
37	L	84.4	Confident	85	Confident	82 Å²	82	88.4 Å²	88.4	43%	0.429	48%	0.481	S	S	.	.	H	α-helix	trans	-61.6	-40.8	174.5	-174.2	68.1	0	0	0	112.3	L26 F30 N34 I35 T40 G41	L26-L37 HydrophobicContact CD2-CD1 4.47Å; F30-L37 HydrophobicContact CD2-CB 4.2Å; F30-L37 HydrophobicContact CD2-CD1 4.37Å; F30-L37 HydrophobicContact CD2-CD2 4.1Å; F30-L37 HydrophobicContact CD2-CG 4.46Å; F30-L37 HydrophobicContact CE2-CD2 4.16Å; N34-L37 WeakPolarHBondContact O-CB 3.29Å; N34-L37 PolarHBondContact O-N 2.92Å; I35-L37 PolarHBondContact O-N 3.21Å; L37-T40 WeakPolarHBondContact CA-OG1 3.3Å; L37-T40 PolarHBondContact O-OG1 2.89Å; L37-T40 VanDerWaalsContact O-OG1 3.14Å; L37-G41 PolarHBondContact O-N 3.32Å
38	L	85.5	Confident	84.8	Confident	130 Å²	130	85.3 Å²	85.3	68%	0.681	47%	0.466	S	S	*	.	H	α-helix	trans	-66.8	-43.5	180	-175.1	69.9	0	0	0	110.7	I35 T36 L42	I35-L38 PolarHBondContact O-N 2.97Å; T36-L38 VanDerWaalsContact C-N 3.34Å; T36-L38 PolarHBondContact O-N 2.89Å; L38-L42 HydrophobicContact CG-CD1 4.33Å; L38-L42 WeakPolarHBondContact O-CB 3.32Å; L38-L42 VanDerWaalsContact O-CG 3.29Å; L38-L42 WeakPolarHBondContact O-CG 3.35Å; L38-L42 PolarHBondContact O-N 3.39Å
39	L	86.1	Confident	84.7	Confident	114 Å²	114	86.3 Å²	86.3	60%	0.597	47%	0.468	S	S	*	.	H	α-helix	trans	-69	-42.9	-177.4	-163.2	72	0	0	0	111.8	T36 L42 N43	T36-L39 PolarHBondContact O-N 3.14Å; L39-L42 PolarHBondContact O-N 3.37Å; L39-N43 PolarHBondContact O-N 3.47Å; L39-N43 PolarHBondContact O-ND2 2.89Å
40	T	85.3	Confident	84.7	Confident	28 Å²	28	92 Å²	92	17%	0.172	49%	0.486	C	S	.	.	H	α-helix	trans	-68.5	-40.2	176.1	50.7	0	0	0	0	111.8	L26 T36 L37 L42 N43 M44	L26-T40 VanDerWaalsContact CD2-CB 3.5Å; L26-T40 HydrophobicContact CD2-CG2 4.44Å; L26-T40 WeakPolarHBondContact CD2-OG1 3.41Å; T36-T40 WeakPolarHBondContact O-CB 3.49Å; T36-T40 WeakPolarHBondContact O-CG2 3.42Å; T36-T40 PolarHBondContact O-N 2.71Å; T36-T40 PolarHBondContact O-OG1 3.25Å; L37-T40 WeakPolarHBondContact CA-OG1 3.3Å; L37-T40 PolarHBondContact O-OG1 2.89Å; L37-T40 VanDerWaalsContact O-OG1 3.14Å; T40-L42 PolarHBondContact O-N 3.46Å; T40-N43 PolarHBondContact O-N 3.47Å; T40-M44 WeakPolarHBondContact O-CG 3.19Å; T40-M44 PolarHBondContact O-N 3.41Å
41	G	83.2	Confident	84.6	Confident	28 Å²	28	87.4 Å²	87.4	29%	0.289	47%	0.467	S	S	.	.	H	α-helix	trans	-57.2	-45.1	171.5	0	0	0	0	0	113.2	L37 M44 L45	L37-G41 PolarHBondContact O-N 3.32Å; G41-M44 PolarHBondContact O-N 3.26Å; G41-L45 PolarHBondContact O-N 3.48Å; G41-L45 VanDerWaalsContact O-N 3.07Å
42	L	87.6	Confident	84.5	Confident	92 Å²	92	87 Å²	87	48%	0.482	46%	0.456	S	S	.	.	H	α-helix	trans	-64.9	-41.3	175.5	-75.2	171	0	0	0	112.2	L38 L39 T40 M44 L45 V46	L38-L42 HydrophobicContact CG-CD1 4.33Å; L38-L42 WeakPolarHBondContact O-CB 3.32Å; L38-L42 VanDerWaalsContact O-CG 3.29Å; L38-L42 WeakPolarHBondContact O-CG 3.35Å; L38-L42 PolarHBondContact O-N 3.39Å; L39-L42 PolarHBondContact O-N 3.37Å; T40-L42 PolarHBondContact O-N 3.46Å; L42-M44 PolarHBondContact O-N 3.09Å; L42-L45 PolarHBondContact O-N 3.05Å; L42-V46 WeakPolarHBondContact O-CG2 3.33Å; L42-V46 PolarHBondContact O-N 2.97Å
43	N	85.6	Confident	84.5	Confident	100 Å²	100	84.1 Å²	84.1	54%	0.535	45%	0.446	S	S	.	.	H	α-helix	trans	-58.6	-47.1	176.1	-81.2	-33.6	0	0	0	111.7	L39 T40 L45 V46 T47	L39-N43 PolarHBondContact O-N 3.47Å; L39-N43 PolarHBondContact O-ND2 2.89Å; T40-N43 PolarHBondContact O-N 3.47Å; N43-L45 VanDerWaalsContact C-N 3.31Å; N43-L45 PolarHBondContact O-N 3.31Å; N43-V46 PolarHBondContact O-N 3.44Å; N43-T47 WeakPolarHBondContact O-CG2 3.28Å; N43-T47 PolarHBondContact O-N 3.47Å; N43-T47 PolarHBondContact O-OG1 3.45Å
44	M	84.6	Confident	84.4	Confident	57 Å²	57	85.1 Å²	85.1	28%	0.281	45%	0.447	S	S	.	.	H	α-helix	trans	-62.3	-37.8	176.7	-68.9	-174.2	-62.3	0	0	112.7	E22 L26 T40 G41 L42 T47 A48	E22-M44 HydrophobicContact CB-SD 4.32Å; L26-M44 HydrophobicContact CD1-CE 3.43Å; L26-M44 VanDerWaalsContact CD1-CE 3.43Å; L26-M44 HydrophobicContact CD1-SD 3.65Å; L26-M44 HydrophobicContact CD2-CE 3.76Å; L26-M44 HydrophobicContact CD2-SD 4.39Å; L26-M44 HydrophobicContact CG-CE 4.09Å; L26-M44 HydrophobicContact CG-SD 4.27Å; T40-M44 WeakPolarHBondContact O-CG 3.19Å; T40-M44 PolarHBondContact O-N 3.41Å; G41-M44 PolarHBondContact O-N 3.26Å; L42-M44 PolarHBondContact O-N 3.09Å; M44-T47 WeakPolarHBondContact CA-OG1 3.1Å; M44-T47 PolarHBondContact O-N 2.78Å; M44-T47 PolarHBondContact O-OG1 2.97Å; M44-A48 VanDerWaalsContact O-CB 3.29Å; M44-A48 WeakPolarHBondContact O-CB 3.19Å; M44-A48 PolarHBondContact O-N 2.89Å
45	L	84.1	Confident	84.5	Confident	99 Å²	99	80.6 Å²	80.6	52%	0.518	42%	0.422	S	S	.	.	H	α-helix	trans	-64.8	-43.6	177.4	-160.9	160.3	0	0	0	110.4	G41 L42 N43 A48 L49	G41-L45 PolarHBondContact O-N 3.48Å; G41-L45 VanDerWaalsContact O-N 3.07Å; L42-L45 PolarHBondContact O-N 3.05Å; N43-L45 VanDerWaalsContact C-N 3.31Å; N43-L45 PolarHBondContact O-N 3.31Å; L45-A48 PolarHBondContact O-N 3.35Å; L45-L49 HydrophobicContact CD2-CD1 3.38Å; L45-L49 HydrophobicContact CD2-CG 3.85Å; L45-L49 WeakPolarHBondContact O-CB 3.49Å; L45-L49 WeakPolarHBondContact O-CG 3.37Å; L45-L49 PolarHBondContact O-N 3.03Å
46	V	87.3	Confident	84.3	Confident	90 Å²	90	75.3 Å²	75.3	55%	0.545	40%	0.396	S	S	.	.	H	α-helix	trans	-64.6	-43.3	177.5	173.3	0	0	0	0	111.8	L42 N43 A48 L49 Y50	L42-V46 WeakPolarHBondContact O-CG2 3.33Å; L42-V46 PolarHBondContact O-N 2.97Å; N43-V46 PolarHBondContact O-N 3.44Å; V46-A48 VanDerWaalsContact C-N 3.32Å; V46-A48 PolarHBondContact O-N 3.25Å; V46-L49 PolarHBondContact O-N 3.47Å; V46-Y50 WeakPolarHBondContact O-CB 3.29Å; V46-Y50 PolarHBondContact O-N 3.22Å
47	T	84.1	Confident	84.2	Confident	73 Å²	73	77.6 Å²	77.6	45%	0.448	41%	0.41	S	S	.	.	H	α-helix	trans	-64.6	-38.5	177.4	55.9	0	0	0	0	111.6	N43 M44 S51	N43-T47 WeakPolarHBondContact O-CG2 3.28Å; N43-T47 PolarHBondContact O-N 3.47Å; N43-T47 PolarHBondContact O-OG1 3.45Å; M44-T47 WeakPolarHBondContact CA-OG1 3.1Å; M44-T47 PolarHBondContact O-N 2.78Å; M44-T47 PolarHBondContact O-OG1 2.97Å; T47-S51 WeakPolarHBondContact O-CB 3.37Å; T47-S51 PolarHBondContact O-N 3.07Å; T47-S51 VanDerWaalsContact O-N 3.07Å; T47-S51 PolarHBondContact O-OG 3.18Å
48	A	82.6	Confident	84.1	Confident	37 Å²	37	77 Å²	77	31%	0.306	41%	0.41	S	S	.	.	H	α-helix	trans	-64.5	-46.1	174.9	0	0	0	0	0	112.2	L11 M44 L45 V46 S51 L52	L11-A48 HydrophobicContact CD1-CB 3.81Å; L11-A48 VanDerWaalsContact CD1-O 3.28Å; L11-A48 WeakPolarHBondContact CD1-O 3.43Å; M44-A48 VanDerWaalsContact O-CB 3.29Å; M44-A48 WeakPolarHBondContact O-CB 3.19Å; M44-A48 PolarHBondContact O-N 2.89Å; L45-A48 PolarHBondContact O-N 3.35Å; V46-A48 VanDerWaalsContact C-N 3.32Å; V46-A48 PolarHBondContact O-N 3.25Å; A48-S51 PolarHBondContact O-OG 2.85Å; A48-L52 WeakPolarHBondContact O-CB 3.46Å; A48-L52 PolarHBondContact O-N 3.27Å
49	L	84.1	Confident	83.7	Confident	106 Å²	106	74.7 Å²	74.7	56%	0.555	40%	0.396	S	S	*	.	H	α-helix	trans	-64	-43.1	177.9	-74.5	178.1	0	0	0	112.4	L45 V46 L52 Y53	L45-L49 HydrophobicContact CD2-CD1 3.38Å; L45-L49 HydrophobicContact CD2-CG 3.85Å; L45-L49 WeakPolarHBondContact O-CB 3.49Å; L45-L49 WeakPolarHBondContact O-CG 3.37Å; L45-L49 PolarHBondContact O-N 3.03Å; V46-L49 PolarHBondContact O-N 3.47Å; L49-L52 PolarHBondContact O-N 3.03Å; L49-Y53 VanDerWaalsContact O-CB 3.23Å; L49-Y53 WeakPolarHBondContact O-CB 3.29Å; L49-Y53 PolarHBondContact O-N 3.46Å
50	Y	85.8	Confident	83.1	Confident	151 Å²	151	78.6 Å²	78.6	59%	0.592	40%	0.403	S	S	*	.	H	α-helix	trans	-64.9	-45.1	-180	173.1	-99.7	0	0	0	112	V46 Y53 M54	V46-Y50 WeakPolarHBondContact O-CB 3.29Å; V46-Y50 PolarHBondContact O-N 3.22Å; Y50-Y53 PolarHBondContact O-N 3.23Å; Y50-M54 WeakPolarHBondContact O-CB 3.38Å; Y50-M54 PolarHBondContact O-N 3.26Å
51	S	82.8	Confident	82.4	Confident	4 Å²	4	80.2 Å²	80.2	3%	0.028	43%	0.425	C	S	.	.	H	α-helix	trans	-66.1	-39.6	178.9	55.2	0	0	0	0	112	L11 T47 A48 M54 F55	L11-S51 WeakPolarHBondContact CD1-OG 3.45Å; T47-S51 WeakPolarHBondContact O-CB 3.37Å; T47-S51 PolarHBondContact O-N 3.07Å; T47-S51 VanDerWaalsContact O-N 3.07Å; T47-S51 PolarHBondContact O-OG 3.18Å; A48-S51 PolarHBondContact O-OG 2.85Å; S51-M54 PolarHBondContact O-N 2.96Å; S51-F55 PolarHBondContact O-N 2.96Å
52	L	81.7	Confident	81.6	Confident	91 Å²	91	83.9 Å²	83.9	48%	0.476	45%	0.446	S	S	.	.	H	α-helix	trans	-65	-42.3	173	-170	121.1	0	0	0	111.6	A48 L49 M54 F55 T56	A48-L52 WeakPolarHBondContact O-CB 3.46Å; A48-L52 PolarHBondContact O-N 3.27Å; L49-L52 PolarHBondContact O-N 3.03Å; L52-M54 VanDerWaalsContact C-N 3.35Å; L52-M54 PolarHBondContact O-N 3.34Å; L52-F55 PolarHBondContact O-N 2.89Å; L52-T56 HydrophobicContact CD2-CG2 4.3Å; L52-T56 HydrophobicContact CG-CG2 4.46Å; L52-T56 WeakPolarHBondContact O-CG2 3.45Å; L52-T56 PolarHBondContact O-N 3.13Å; L52-T56 PolarHBondContact O-OG1 3.35Å
53	Y	84.9	Confident	80.9	Confident	150 Å²	150	85.2 Å²	85.2	59%	0.588	45%	0.453	S	S	*	.	H	α-helix	trans	-60.7	-43	175.6	177.6	-99.8	0	0	0	112.1	L49 Y50 F55 T56 T57	L49-Y53 VanDerWaalsContact O-CB 3.23Å; L49-Y53 WeakPolarHBondContact O-CB 3.29Å; L49-Y53 PolarHBondContact O-N 3.46Å; Y50-Y53 PolarHBondContact O-N 3.23Å; Y53-F55 VanDerWaalsContact C-N 3.32Å; Y53-F55 PolarHBondContact O-N 3.5Å; Y53-T56 WeakPolarHBondContact CA-OG1 3.42Å; Y53-T56 PolarHBondContact O-N 3.31Å; Y53-T56 PolarHBondContact O-OG1 2.9Å; Y53-T56 VanDerWaalsContact O-OG1 3.09Å; Y53-T57 HydrophobicContact CD1-CG2 4.25Å; Y53-T57 HydrophobicContact CD2-CG2 4.05Å; Y53-T57 HydrophobicContact CE1-CG2 3.85Å; Y53-T57 HydrophobicContact CE2-CG2 3.63Å; Y53-T57 HydrophobicContact CG-CG2 4.34Å; Y53-T57 WeakPolarHBondContact O-CB 3.38Å; Y53-T57 VanDerWaalsContact O-CG2 3.28Å; Y53-T57 WeakPolarHBondContact O-CG2 2.93Å; Y53-T57 PolarHBondContact O-N 3.39Å; Y53-T57 PolarHBondContact O-OG1 2.9Å
54	M	82.7	Confident	80.5	Confident	61 Å²	61	84.4 Å²	84.4	30%	0.3	45%	0.452	S	S	.	.	H	α-helix	trans	-65	-38	176.8	-166	-100.8	-70.6	0	0	111.4	W3 Y50 S51 L52 T57 T58	W3-M54 HydrophobicContact CZ3-SD 3.99Å; Y50-M54 WeakPolarHBondContact O-CB 3.38Å; Y50-M54 PolarHBondContact O-N 3.26Å; S51-M54 PolarHBondContact O-N 2.96Å; L52-M54 VanDerWaalsContact C-N 3.35Å; L52-M54 PolarHBondContact O-N 3.34Å; M54-T57 PolarHBondContact O-OG1 2.99Å; M54-T58 WeakPolarHBondContact O-CB 3.39Å; M54-T58 VanDerWaalsContact O-CG2 3.23Å; M54-T58 WeakPolarHBondContact O-CG2 3.44Å; M54-T58 PolarHBondContact O-N 3.1Å; M54-T58 PolarHBondContact O-OG1 2.94Å
55	F	83.4	Confident	79.7	Confident	23 Å²	23	89.7 Å²	89.7	10%	0.101	48%	0.476	C	S	.	.	H	α-helix	trans	-65.8	-48.2	173.5	176.9	-101.8	0	0	0	112.5	W3 L4 S7 S51 L52 Y53 T58 Q59 W60	W3-F55 HydrophobicContact CB-CE2 4.46Å; L4-F55 VanDerWaalsContact CA-CE2 3.47Å; L4-F55 HydrophobicContact CB-CE2 3.62Å; L4-F55 HydrophobicContact CB-CZ 3.89Å; L4-F55 HydrophobicContact CD1-CE2 4.49Å; L4-F55 HydrophobicContact CD1-CZ 3.88Å; L4-F55 HydrophobicContact CG-CE2 4.33Å; L4-F55 HydrophobicContact CG-CZ 4.18Å; S7-F55 WeakPolarHBondContact OG-CD2 3.35Å; S51-F55 PolarHBondContact O-N 2.96Å; L52-F55 PolarHBondContact O-N 2.89Å; Y53-F55 VanDerWaalsContact C-N 3.32Å; Y53-F55 PolarHBondContact O-N 3.5Å; F55-T58 PolarHBondContact O-N 3.44Å; F55-T58 PolarHBondContact O-OG1 3.29Å; F55-Q59 HydrophobicContact CD2-CB 4.28Å; F55-Q59 HydrophobicContact CD2-CG 3.95Å; F55-Q59 HydrophobicContact CE2-CB 3.86Å; F55-Q59 HydrophobicContact CE2-CG 3.7Å; F55-Q59 HydrophobicContact CZ-CB 4.09Å; F55-Q59 HydrophobicContact CZ-CG 4.42Å; F55-Q59 WeakPolarHBondContact O-CB 3.37Å; F55-Q59 PolarHBondContact O-N 2.88Å; F55-W60 HydrophobicContact CE1-CD2 4.41Å
56	T	80.6	Confident	79.4	Confident	37 Å²	37	93.9 Å²	93.9	23%	0.227	49%	0.492	C	S	.	.	H	α-helix	trans	-65	-45.2	-177.8	55.2	0	0	0	0	111.1	L52 Y53 T58 W60	L52-T56 HydrophobicContact CD2-CG2 4.3Å; L52-T56 HydrophobicContact CG-CG2 4.46Å; L52-T56 WeakPolarHBondContact O-CG2 3.45Å; L52-T56 PolarHBondContact O-N 3.13Å; L52-T56 PolarHBondContact O-OG1 3.35Å; Y53-T56 WeakPolarHBondContact CA-OG1 3.42Å; Y53-T56 PolarHBondContact O-N 3.31Å; Y53-T56 PolarHBondContact O-OG1 2.9Å; Y53-T56 VanDerWaalsContact O-OG1 3.09Å; T56-T58 VanDerWaalsContact C-N 3.31Å; T56-T58 PolarHBondContact O-N 3.08Å; T56-W60 HydrophobicContact CG2-CE3 4.02Å; T56-W60 CarbonylContact O-C 3.35Å; T56-W60 WeakPolarHBondContact O-CA 3.32Å; T56-W60 WeakPolarHBondContact O-CB 3.36Å; T56-W60 PolarHBondContact O-N 3.43Å
57	T	82.4	Confident	78.7	Confident	76 Å²	76	93.8 Å²	93.8	47%	0.466	49%	0.488	S	S	.	.	H	α-helix	trans	-64.7	-31.7	179.6	52.6	0	0	0	0	114.1	Y53 M54	Y53-T57 HydrophobicContact CD1-CG2 4.25Å; Y53-T57 HydrophobicContact CD2-CG2 4.05Å; Y53-T57 HydrophobicContact CE1-CG2 3.85Å; Y53-T57 HydrophobicContact CE2-CG2 3.63Å; Y53-T57 HydrophobicContact CG-CG2 4.34Å; Y53-T57 WeakPolarHBondContact O-CB 3.38Å; Y53-T57 VanDerWaalsContact O-CG2 3.28Å; Y53-T57 WeakPolarHBondContact O-CG2 2.93Å; Y53-T57 PolarHBondContact O-N 3.39Å; Y53-T57 PolarHBondContact O-OG1 2.9Å; M54-T57 PolarHBondContact O-OG1 2.99Å
58	T	81.4	Confident	78	Confident	70 Å²	70	97.6 Å²	97.6	43%	0.429	51%	0.505	S	S	.	.	H	α-helix	trans	-91.1	-30.6	-177.6	58	0	0	0	0	114	M54 F55 T56	M54-T58 WeakPolarHBondContact O-CB 3.39Å; M54-T58 VanDerWaalsContact O-CG2 3.23Å; M54-T58 WeakPolarHBondContact O-CG2 3.44Å; M54-T58 PolarHBondContact O-N 3.1Å; M54-T58 PolarHBondContact O-OG1 2.94Å; F55-T58 PolarHBondContact O-N 3.44Å; F55-T58 PolarHBondContact O-OG1 3.29Å; T56-T58 VanDerWaalsContact C-N 3.31Å; T56-T58 PolarHBondContact O-N 3.08Å
59	Q	78.6	Confident	77.5	Confident	82 Å²	82	102.7 Å²	102.7	38%	0.383	53%	0.528	S	S	.	.	H	α-helix	trans	-116.3	-29.1	-174	-59.8	-63.1	-71.2	0	0	113.5	W3 F55	W3-Q59 HydrophobicContact CB-CG 3.72Å; W3-Q59 HydrophobicContact CG-CG 4.25Å; F55-Q59 HydrophobicContact CD2-CB 4.28Å; F55-Q59 HydrophobicContact CD2-CG 3.95Å; F55-Q59 HydrophobicContact CE2-CB 3.86Å; F55-Q59 HydrophobicContact CE2-CG 3.7Å; F55-Q59 HydrophobicContact CZ-CB 4.09Å; F55-Q59 HydrophobicContact CZ-CG 4.42Å; F55-Q59 WeakPolarHBondContact O-CB 3.37Å; F55-Q59 PolarHBondContact O-N 2.88Å
60	W	73.1	Confident	77	Confident	195 Å²	195	104 Å²	104	74%	0.739	53%	0.533	S	S	*	.	S	Bend	trans	-110.3	82.6	179.8	-78.7	1.5	0	0	0	111	F55 T56	F55-W60 HydrophobicContact CE1-CD2 4.41Å; T56-W60 HydrophobicContact CG2-CE3 4.02Å; T56-W60 CarbonylContact O-C 3.35Å; T56-W60 WeakPolarHBondContact O-CA 3.32Å; T56-W60 WeakPolarHBondContact O-CB 3.36Å; T56-W60 PolarHBondContact O-N 3.43Å
61	G	70.4	Confident	76.6	Confident	62 Å²	62	104.4 Å²	104.4	64%	0.639	54%	0.538	S	S	*	.	S	Bend	trans	-169.5	166.8	173.2	0	0	0	0	0	110.5	L63	G61-L63 PolarHBondContact O-N 3.01Å
62	S	67	Low	76.4	Confident	105 Å²	105	109.5 Å²	109.5	73%	0.734	57%	0.571	S	S	*	*	P	Polyproline II helix	trans	-66.6	131.1	166.7	47.9	0	0	0	0	108.9	T64	S62-T64 PolarHBondContact O-N 2.98Å
63	L	72.3	Confident	76.4	Confident	120 Å²	120	108.8 Å²	108.8	63%	0.628	57%	0.573	S	S	*	*	P	Polyproline II helix	trans	-58.5	133.4	166.8	-80.9	127.7	0	0	0	108.3	G61 H65 M70	G61-L63 PolarHBondContact O-N 3.01Å; L63-H65 PolarHBondContact O-N 3Å; L63-H65 VanDerWaalsContact O-N 3.14Å; L63-M70 HydrophobicContact CD2-CE 4.3Å; L63-M70 HydrophobicContact CD2-CG 4.08Å
64	T	76.1	Confident	76.5	Confident	83 Å²	83	106.9 Å²	106.9	51%	0.509	57%	0.568	S	S	.	*	P	Polyproline II helix	trans	-55.7	121.3	176.1	50	0	0	0	0	109.4	S62 H66 I67	S62-T64 PolarHBondContact O-N 2.98Å; T64-H66 PolarHBondContact O-N 3.42Å; T64-I67 PolarHBondContact O-N 2.87Å; T64-I67 WeakPolarHBondContact OG1-CD1 3.4Å; T64-I67 WeakPolarHBondContact OG1-CG1 3.3Å
65	H	67.6	Low	76.7	Confident	169 Å²	169	109.6 Å²	109.6	78%	0.782	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59	-13.5	-173	-66.9	-73.6	0	0	0	115.1	L63	L63-H65 PolarHBondContact O-N 3Å; L63-H65 VanDerWaalsContact O-N 3.14Å
66	H	79.1	Confident	76.9	Confident	186 Å²	186	117.4 Å²	117.4	86%	0.861	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.3	-10.6	178.6	-54.9	-22.8	0	0	0	113.5	T64 N68	T64-H66 PolarHBondContact O-N 3.42Å; H66-N68 PolarHBondContact O-N 3.07Å
67	I	72.4	Confident	77.3	Confident	88 Å²	88	119.8 Å²	119.8	45%	0.451	63%	0.625	S	S	.	*			trans	-92.8	95.7	177	-60.7	-178.5	0	0	0	108.5	T64 M70	T64-I67 PolarHBondContact O-N 2.87Å; T64-I67 WeakPolarHBondContact OG1-CD1 3.4Å; T64-I67 WeakPolarHBondContact OG1-CG1 3.3Å; I67-M70 HydrophobicContact CG2-CE 4.32Å; I67-M70 HydrophobicContact CG2-CG 3.99Å
68	N	68.4	Low	77.4	Confident	153 Å²	153	118.4 Å²	118.4	82%	0.818	62%	0.615	S	S	*	*			trans	-99.4	-2.9	178.4	-127.6	15.7	0	0	0	113.6	H66	H66-N68 PolarHBondContact O-N 3.07Å
69	N	73.1	Confident	77.6	Confident	145 Å²	145	118.7 Å²	118.7	78%	0.775	62%	0.617	S	S	*	*			trans	-104.9	26.2	-172.5	-80.5	34.4	0	0	0	114.1	K71	N69-K71 PolarHBondContact O-N 3.47Å
70	M	73.6	Confident	78.1	Confident	134 Å²	134	119.1 Å²	119.1	66%	0.66	62%	0.622	S	S	*	*			trans	-69.1	103	172.7	-80.8	-75.2	-178.3	0	0	109.8	L63 I67	L63-M70 HydrophobicContact CD2-CE 4.3Å; L63-M70 HydrophobicContact CD2-CG 4.08Å; I67-M70 HydrophobicContact CG2-CE 4.32Å; I67-M70 HydrophobicContact CG2-CG 3.99Å
71	K	76.2	Confident	78.7	Confident	159 Å²	159	112.2 Å²	112.2	69%	0.691	60%	0.598	S	S	*	*	P	Polyproline II helix	trans	-73.5	147	172.6	-66.4	-179.4	-177.9	176.8	0	109.6	N69 F74	N69-K71 PolarHBondContact O-N 3.47Å; K71-F74 HydrophobicContact CB-CE2 4.41Å; K71-F74 HydrophobicContact CD-CE2 4.34Å; K71-F74 HydrophobicContact CD-CZ 4.16Å
72	P	80	Confident	79.4	Confident	111 Å²	111	115 Å²	115	72%	0.721	59%	0.593	S	S	*	*	P	Polyproline II helix	trans	-61.2	153	171.2	28	-34.6	0	0	0	110.4	F74	P72-F74 PolarHBondContact O-N 3.38Å
73	S	81.4	Confident	80.4	Confident	76 Å²	76	116.5 Å²	116.5	53%	0.531	59%	0.59	S	S	.	*	P	Polyproline II helix	trans	-62.1	132.9	179.7	49.4	0	0	0	0	111.4
74	F	87.4	Confident	80.9	Confident	110 Å²	110	116.4 Å²	116.4	48%	0.482	59%	0.586	S	S	.	*	P	Polyproline II helix	trans	-79.5	155.1	179.2	-67.5	-80	0	0	0	111.2	K71 P72 R76 E77 N78	K71-F74 HydrophobicContact CB-CE2 4.41Å; K71-F74 HydrophobicContact CD-CE2 4.34Å; K71-F74 HydrophobicContact CD-CZ 4.16Å; P72-F74 PolarHBondContact O-N 3.38Å; F74-R76 PolarHBondContact O-N 3.41Å; F74-E77 HydrophobicContact CB-CG 4.36Å; F74-E77 PolarHBondContact N-OE2 3.32Å; F74-E77 VanDerWaalsContact N-OE2 3.12Å; F74-E77 PolarHBondContact O-N 3.22Å; F74-N78 PolarHBondContact O-N 2.85Å; F74-N78 VanDerWaalsContact O-N 3.1Å
75	T	85.4	Confident	81.3	Confident	117 Å²	117	113 Å²	113	72%	0.718	57%	0.565	S	S	*	*	H	α-helix	trans	-56.9	-35.9	175.6	52.9	0	0	0	0	112.4	E77 N78 T79	T75-E77 PolarHBondContact O-N 2.97Å; T75-N78 PolarHBondContact O-N 3.25Å; T75-T79 WeakPolarHBondContact O-CB 3.41Å; T75-T79 WeakPolarHBondContact O-CG2 3.4Å; T75-T79 PolarHBondContact O-N 3.03Å; T75-T79 PolarHBondContact O-OG1 2.92Å
76	R	89.2	Confident	82	Confident	187 Å²	187	106.5 Å²	106.5	71%	0.706	54%	0.538	S	S	*	.	H	α-helix	trans	-61.4	-40.5	174.2	-171.5	-177.7	68.1	136.2	2.3	112.8	F74 T79 L80	F74-R76 PolarHBondContact O-N 3.41Å; R76-T79 WeakPolarHBondContact CA-OG1 3.32Å; R76-T79 PolarHBondContact O-OG1 2.84Å; R76-L80 WeakPolarHBondContact O-CB 3.5Å; R76-L80 PolarHBondContact O-N 3.36Å
77	E	87.3	Confident	82.2	Confident	87 Å²	87	100.2 Å²	100.2	41%	0.407	51%	0.514	S	S	.	.	H	α-helix	trans	-71.7	-40.9	-179.3	-66.4	167	177.3	0	0	110.6	F74 T75 L80 M81	F74-E77 HydrophobicContact CB-CG 4.36Å; F74-E77 PolarHBondContact N-OE2 3.32Å; F74-E77 VanDerWaalsContact N-OE2 3.12Å; F74-E77 PolarHBondContact O-N 3.22Å; T75-E77 PolarHBondContact O-N 2.97Å; E77-L80 PolarHBondContact O-N 2.92Å; E77-M81 WeakPolarHBondContact O-CG 3.45Å; E77-M81 PolarHBondContact O-N 3.32Å
78	N	85.5	Confident	82.7	Confident	48 Å²	48	99.5 Å²	99.5	26%	0.257	51%	0.51	S	S	.	.	H	α-helix	trans	-64.9	-42.3	176.4	-69.6	-19.3	0	0	0	112.2	W2 F74 T75 M81 F82	W2-N78 HydrophobicContact CZ2-CB 4.2Å; W2-N78 PolarHBondContact NE1-OD1 3.5Å; F74-N78 PolarHBondContact O-N 2.85Å; F74-N78 VanDerWaalsContact O-N 3.1Å; T75-N78 PolarHBondContact O-N 3.25Å; N78-M81 PolarHBondContact O-N 3.47Å; N78-F82 WeakPolarHBondContact O-CB 3.23Å; N78-F82 PolarHBondContact O-N 2.94Å
79	T	85	Confident	83.3	Confident	75 Å²	75	96.7 Å²	96.7	46%	0.46	49%	0.494	S	S	.	.	H	α-helix	trans	-67.3	-38.3	177.8	47	0	0	0	0	112.2	T75 R76 F82 M83	T75-T79 WeakPolarHBondContact O-CB 3.41Å; T75-T79 WeakPolarHBondContact O-CG2 3.4Å; T75-T79 PolarHBondContact O-N 3.03Å; T75-T79 PolarHBondContact O-OG1 2.92Å; R76-T79 WeakPolarHBondContact CA-OG1 3.32Å; R76-T79 PolarHBondContact O-OG1 2.84Å; T79-F82 PolarHBondContact O-N 3.38Å; T79-M83 WeakPolarHBondContact O-CG 3.34Å; T79-M83 PolarHBondContact O-N 3.44Å
80	L	89.1	Confident	83.7	Confident	92 Å²	92	95.2 Å²	95.2	48%	0.482	49%	0.486	S	S	.	.	H	α-helix	trans	-60.5	-49.3	173.6	-174.7	151.3	0	0	0	111.1	R76 E77 F82 M83 H84	R76-L80 WeakPolarHBondContact O-CB 3.5Å; R76-L80 PolarHBondContact O-N 3.36Å; E77-L80 PolarHBondContact O-N 2.92Å; L80-F82 VanDerWaalsContact C-N 3.29Å; L80-F82 PolarHBondContact O-N 3.05Å; L80-M83 PolarHBondContact O-N 2.97Å; L80-H84 PolarHBondContact O-CD2 3.27Å; L80-H84 VanDerWaalsContact O-CD2 3.27Å; L80-H84 PolarHBondContact O-N 2.86Å; L80-H84 VanDerWaalsContact O-N 3.13Å
81	M	86.7	Confident	84	Confident	50 Å²	50	91.6 Å²	91.6	25%	0.246	47%	0.469	C	S	.	.	H	α-helix	trans	-62	-38.4	177.4	-69.8	-60.5	-70.2	0	0	112	W2 A6 E77 N78 H84 L85	W2-M81 HydrophobicContact CB-CB 4.24Å; W2-M81 HydrophobicContact CB-CE 3.96Å; W2-M81 HydrophobicContact CB-CG 4.27Å; W2-M81 HydrophobicContact CD2-CB 3.86Å; W2-M81 HydrophobicContact CE3-CB 3.97Å; W2-M81 HydrophobicContact CG-CB 4Å; W2-M81 HydrophobicContact CG-CG 4.34Å; A6-M81 HydrophobicContact CB-CE 4.35Å; E77-M81 WeakPolarHBondContact O-CG 3.45Å; E77-M81 PolarHBondContact O-N 3.32Å; N78-M81 PolarHBondContact O-N 3.47Å; M81-H84 PolarHBondContact O-N 2.96Å; M81-L85 WeakPolarHBondContact O-CG 3.37Å; M81-L85 PolarHBondContact O-N 3.03Å
82	F	85.4	Confident	84.2	Confident	120 Å²	120	85.1 Å²	85.1	53%	0.526	44%	0.444	S	S	.	.	H	α-helix	trans	-62.7	-45	174.9	179.9	-101.1	0	0	0	112.3	W2 N78 T79 L80 H84 L85 S86	W2-F82 HydrophobicContact CH2-CB 3.81Å; W2-F82 HydrophobicContact CH2-CD2 4.08Å; W2-F82 HydrophobicContact CH2-CG 4.44Å; W2-F82 HydrophobicContact CZ3-CB 4.21Å; W2-F82 HydrophobicContact CZ3-CD2 4.44Å; N78-F82 WeakPolarHBondContact O-CB 3.23Å; N78-F82 PolarHBondContact O-N 2.94Å; T79-F82 PolarHBondContact O-N 3.38Å; L80-F82 VanDerWaalsContact C-N 3.29Å; L80-F82 PolarHBondContact O-N 3.05Å; F82-H84 PolarHBondContact O-N 3.44Å; F82-L85 PolarHBondContact O-N 2.94Å; F82-S86 VanDerWaalsContact O-CB 3.29Å; F82-S86 WeakPolarHBondContact O-CB 3.49Å; F82-S86 PolarHBondContact O-N 3.31Å; F82-S86 PolarHBondContact O-OG 3.47Å
83	M	87.4	Confident	84.1	Confident	136 Å²	136	85.9 Å²	85.9	67%	0.67	44%	0.441	S	S	*	.	H	α-helix	trans	-64.8	-26.8	178.1	-75.3	-179	175.7	0	0	113.3	T79 L80 P87	T79-M83 WeakPolarHBondContact O-CG 3.34Å; T79-M83 PolarHBondContact O-N 3.44Å; L80-M83 PolarHBondContact O-N 2.97Å; M83-P87 WeakPolarHBondContact O-CD 3.23Å; M83-P87 WeakPolarHBondContact O-CG 3.49Å
84	H	83.5	Confident	83.9	Confident	118 Å²	118	87 Å²	87	55%	0.546	44%	0.441	S	S	.	.	H	α-helix	trans	-79.5	-38.9	173	-80.3	-69.5	0	0	0	112.8	L80 M81 F82 P87 I88	L80-H84 PolarHBondContact O-CD2 3.27Å; L80-H84 VanDerWaalsContact O-CD2 3.27Å; L80-H84 PolarHBondContact O-N 2.86Å; L80-H84 VanDerWaalsContact O-N 3.13Å; M81-H84 PolarHBondContact O-N 2.96Å; F82-H84 PolarHBondContact O-N 3.44Å; H84-P87 WeakPolarHBondContact O-CD 3.4Å; H84-P87 WeakPolarHBondContact O-CG 3.38Å; H84-I88 WeakPolarHBondContact O-CD1 3.39Å; H84-I88 WeakPolarHBondContact O-CG1 3.42Å
85	L	82.8	Confident	83.2	Confident	12 Å²	12	83.5 Å²	83.5	6%	0.063	43%	0.429	C	S	.	.	H	α-helix	trans	-80	-31.9	-177.7	-72.7	166.7	0	0	0	113.1	W2 L5 M81 F82 I88 L89	W2-L85 HydrophobicContact CE3-CD1 3.57Å; W2-L85 HydrophobicContact CZ3-CD1 3.94Å; L5-L85 HydrophobicContact CB-CD1 3.93Å; L5-L85 HydrophobicContact CB-CD2 4.39Å; L5-L85 HydrophobicContact CD2-CD1 4.36Å; M81-L85 WeakPolarHBondContact O-CG 3.37Å; M81-L85 PolarHBondContact O-N 3.03Å; F82-L85 PolarHBondContact O-N 2.94Å; L85-I88 PolarHBondContact O-N 3.1Å; L85-L89 WeakPolarHBondContact O-CG 3.33Å; L85-L89 PolarHBondContact O-N 3.23Å
86	S	83.5	Confident	82.7	Confident	32 Å²	32	82.6 Å²	82.6	22%	0.224	42%	0.42	C	S	.	.	H	α-helix	trans	-59.6	-46	-179.6	66.2	0	0	0	0	114.1	F82 I88 L89 L90	F82-S86 VanDerWaalsContact O-CB 3.29Å; F82-S86 WeakPolarHBondContact O-CB 3.49Å; F82-S86 PolarHBondContact O-N 3.31Å; F82-S86 PolarHBondContact O-OG 3.47Å; S86-I88 VanDerWaalsContact C-N 3.34Å; S86-I88 PolarHBondContact O-N 2.72Å; S86-L89 PolarHBondContact O-N 3.2Å; S86-L90 WeakPolarHBondContact O-CB 3.41Å; S86-L90 WeakPolarHBondContact O-CD1 3.5Å; S86-L90 VanDerWaalsContact O-CG 3.24Å; S86-L90 WeakPolarHBondContact O-CG 3.42Å; S86-L90 PolarHBondContact O-N 2.94Å
87	P	83.8	Confident	82.2	Confident	55 Å²	55	79.7 Å²	79.7	36%	0.357	42%	0.418	S	S	.	.	H	α-helix	trans	-66.3	-37.5	177.1	26.1	-35.4	0	0	0	111.8	M83 H84 L89 L90 L91	M83-P87 WeakPolarHBondContact O-CD 3.23Å; M83-P87 WeakPolarHBondContact O-CG 3.49Å; H84-P87 WeakPolarHBondContact O-CD 3.4Å; H84-P87 WeakPolarHBondContact O-CG 3.38Å; P87-L89 VanDerWaalsContact C-N 3.33Å; P87-L89 PolarHBondContact O-N 3.23Å; P87-L90 PolarHBondContact O-N 3.09Å; P87-L91 VanDerWaalsContact O-CB 3.28Å; P87-L91 WeakPolarHBondContact O-CB 3.28Å; P87-L91 VanDerWaalsContact O-CG 3.26Å; P87-L91 WeakPolarHBondContact O-CG 3.39Å; P87-L91 PolarHBondContact O-N 3.4Å
88	I	82.6	Confident	81.8	Confident	73 Å²	73	80 Å²	80	37%	0.374	42%	0.421	S	S	.	.	H	α-helix	trans	-62.8	-43.5	178.8	-62.1	170.8	0	0	0	110.2	A9 I17 H84 L85 S86 S92	A9-I88 HydrophobicContact CB-CG2 4.41Å; I17-I88 WeakPolarHBondContact CD1-O 3.46Å; H84-I88 WeakPolarHBondContact O-CD1 3.39Å; H84-I88 WeakPolarHBondContact O-CG1 3.42Å; L85-I88 PolarHBondContact O-N 3.1Å; S86-I88 VanDerWaalsContact C-N 3.34Å; S86-I88 PolarHBondContact O-N 2.72Å; I88-S92 PolarHBondContact O-N 2.89Å; I88-S92 VanDerWaalsContact O-N 3.15Å
89	L	81.3	Confident	81	Confident	93 Å²	93	81 Å²	81	49%	0.487	43%	0.429	S	S	.	.	H	α-helix	trans	-67.9	-43.6	175.7	-71.7	170.3	0	0	0	112	L85 S86 P87 L91 S92 L93	L85-L89 WeakPolarHBondContact O-CG 3.33Å; L85-L89 PolarHBondContact O-N 3.23Å; S86-L89 PolarHBondContact O-N 3.2Å; P87-L89 VanDerWaalsContact C-N 3.33Å; P87-L89 PolarHBondContact O-N 3.23Å; L89-L91 PolarHBondContact O-N 2.81Å; L89-S92 WeakPolarHBondContact O-CB 3.2Å; L89-S92 PolarHBondContact O-N 2.93Å; L89-S92 VanDerWaalsContact O-N 3.17Å; L89-S92 PolarHBondContact O-OG 3.33Å; L89-L93 PolarHBondContact O-N 3.4Å
90	L	81.2	Confident	79.9	Confident	114 Å²	114	80.2 Å²	80.2	60%	0.597	44%	0.436	S	S	*	.	H	α-helix	trans	-61.9	-43.4	179	-76.8	164.6	0	0	0	112.3	S86 P87 S92 L93 N94	S86-L90 WeakPolarHBondContact O-CB 3.41Å; S86-L90 WeakPolarHBondContact O-CD1 3.5Å; S86-L90 VanDerWaalsContact O-CG 3.24Å; S86-L90 WeakPolarHBondContact O-CG 3.42Å; S86-L90 PolarHBondContact O-N 2.94Å; P87-L90 PolarHBondContact O-N 3.09Å; L90-S92 VanDerWaalsContact C-N 3.27Å; L90-S92 PolarHBondContact O-N 2.76Å; L90-L93 WeakPolarHBondContact O-CB 2.98Å; L90-L93 PolarHBondContact O-N 3.3Å; L90-N94 PolarHBondContact O-N 3.23Å
91	L	80.3	Confident	78.5	Confident	59 Å²	59	84 Å²	84	31%	0.309	45%	0.448	S	S	.	.	H	α-helix	trans	-69.2	-25.7	177.5	-72.6	169.3	0	0	0	112.2	I17 P87 L89 L93 N94 I98	I17-L91 HydrophobicContact CD1-CB 3.19Å; I17-L91 HydrophobicContact CD1-CD1 4.28Å; I17-L91 HydrophobicContact CD1-CG 4.37Å; I17-L91 HydrophobicContact CG1-CB 4.14Å; P87-L91 VanDerWaalsContact O-CB 3.28Å; P87-L91 WeakPolarHBondContact O-CB 3.28Å; P87-L91 VanDerWaalsContact O-CG 3.26Å; P87-L91 WeakPolarHBondContact O-CG 3.39Å; P87-L91 PolarHBondContact O-N 3.4Å; L89-L91 PolarHBondContact O-N 2.81Å; L91-L93 VanDerWaalsContact C-N 3.3Å; L91-N94 CarbonylContact O-C 3.1Å; L91-I98 HydrophobicContact CB-CD1 4.1Å; L91-I98 HydrophobicContact CD1-CD1 4.15Å; L91-I98 HydrophobicContact CD2-CD1 3.94Å; L91-I98 HydrophobicContact CD2-CG1 4.02Å; L91-I98 HydrophobicContact CG-CD1 4.28Å
92	S	80.1	Confident	76.6	Confident	22 Å²	22	86.4 Å²	86.4	15%	0.154	47%	0.47	C	S	.	.	H	α-helix	trans	-70.9	-25.9	173.3	76	0	0	0	0	113.3	P15 I88 L89 L90	P15-S92 WeakPolarHBondContact O-CB 3.34Å; I88-S92 PolarHBondContact O-N 2.89Å; I88-S92 VanDerWaalsContact O-N 3.15Å; L89-S92 WeakPolarHBondContact O-CB 3.2Å; L89-S92 PolarHBondContact O-N 2.93Å; L89-S92 VanDerWaalsContact O-N 3.17Å; L89-S92 PolarHBondContact O-OG 3.33Å; L90-S92 VanDerWaalsContact C-N 3.27Å; L90-S92 PolarHBondContact O-N 2.76Å
93	L	78	Confident	74.6	Confident	128 Å²	128	89.5 Å²	89.5	67%	0.67	51%	0.507	S	S	*	.	H	α-helix	trans	-76.4	-35.5	176.8	-67.6	168.7	0	0	0	112.1	L89 L90 L91	L89-L93 PolarHBondContact O-N 3.4Å; L90-L93 WeakPolarHBondContact O-CB 2.98Å; L90-L93 PolarHBondContact O-N 3.3Å; L91-L93 VanDerWaalsContact C-N 3.3Å
94	N	75.9	Confident	74	Confident	98 Å²	98	87.2 Å²	87.2	52%	0.524	50%	0.499	S	S	.	.			trans	-126.7	74.9	179.8	-68.9	-21.9	0	0	0	110.7	L90 L91 D96 I97	L90-N94 PolarHBondContact O-N 3.23Å; L91-N94 CarbonylContact O-C 3.1Å; N94-D96 PolarHBondContact O-N 3.49Å; N94-I97 HydrophobicContact CB-CD1 3.81Å; N94-I97 HydrophobicContact CB-CG1 4.25Å; N94-I97 PolarHBondContact O-N 3.12Å
95	P	73.2	Confident	73.5	Confident	37 Å²	37	85.6 Å²	85.6	24%	0.24	50%	0.496	C	S	.	.	T	Hydrogen-bonded Turn	trans	-65.3	-20.8	-178.6	27.7	-35	0	0	0	113.1	L20 I97 I98 T99	L20-P95 HydrophobicContact CD1-CB 3.68Å; L20-P95 HydrophobicContact CD1-CG 4.23Å; P95-I97 PolarHBondContact O-N 3.45Å; P95-I97 VanDerWaalsContact O-N 3.13Å; P95-I98 PolarHBondContact O-N 3.35Å; P95-T99 PolarHBondContact O-N 3.45Å; P95-T99 PolarHBondContact O-OG1 3.04Å
96	D	75	Confident	72.9	Confident	99 Å²	99	89.7 Å²	89.7	53%	0.529	52%	0.52	S	S	.	.	H	α-helix	trans	-58	-27.4	-179.1	-61.2	-23.9	0	0	0	113.5	N94 I98 T99 G100	N94-D96 PolarHBondContact O-N 3.49Å; D96-I98 VanDerWaalsContact C-N 3.26Å; D96-I98 PolarHBondContact O-N 3.02Å; D96-T99 WeakPolarHBondContact CA-OG1 3.09Å; D96-G100 PolarHBondContact O-N 3.42Å
97	I	78.2	Confident	72.3	Confident	126 Å²	126	93.1 Å²	93.1	65%	0.646	54%	0.538	S	S	*	.	H	α-helix	trans	-64.7	-32	179	-58.8	170.2	0	0	0	111.2	N94 P95	N94-I97 HydrophobicContact CB-CD1 3.81Å; N94-I97 HydrophobicContact CB-CG1 4.25Å; N94-I97 PolarHBondContact O-N 3.12Å; P95-I97 PolarHBondContact O-N 3.45Å; P95-I97 VanDerWaalsContact O-N 3.13Å
98	I	78.9	Confident	71.6	Confident	94 Å²	94	95.4 Å²	95.4	48%	0.482	55%	0.549	S	S	.	.	H	α-helix	trans	-93.3	-39.5	-177.4	-57.9	171.5	0	0	0	110.8	I17 L91 P95 D96 G100	I17-I98 HydrophobicContact CD1-CD1 4.25Å; I17-I98 HydrophobicContact CG1-CD1 4.32Å; I17-I98 HydrophobicContact CG2-CD1 3.94Å; L91-I98 HydrophobicContact CB-CD1 4.1Å; L91-I98 HydrophobicContact CD1-CD1 4.15Å; L91-I98 HydrophobicContact CD2-CD1 3.94Å; L91-I98 HydrophobicContact CD2-CG1 4.02Å; L91-I98 HydrophobicContact CG-CD1 4.28Å; P95-I98 PolarHBondContact O-N 3.35Å; D96-I98 VanDerWaalsContact C-N 3.26Å; D96-I98 PolarHBondContact O-N 3.02Å; I98-G100 VanDerWaalsContact C-N 3.26Å; I98-G100 PolarHBondContact O-N 2.95Å
99	T	69.4	Low	70.9	Confident	69 Å²	69	96.9 Å²	96.9	42%	0.423	56%	0.561	S	S	.	*	H	α-helix	trans	-79.8	-10.2	-172.8	59.1	0	0	0	0	112.9	P95 D96 F101	P95-T99 PolarHBondContact O-N 3.45Å; P95-T99 PolarHBondContact O-OG1 3.04Å; D96-T99 WeakPolarHBondContact CA-OG1 3.09Å; T99-F101 PolarHBondContact O-N 2.92Å
100	G	62.6	Low	70.1	Confident	58 Å²	58	97.2 Å²	97.2	60%	0.598	57%	0.566	S	S	*	*			trans	67.7	13.3	174.8	0	0	0	0	0	113.9	D96 I98 S102	D96-G100 PolarHBondContact O-N 3.42Å; I98-G100 VanDerWaalsContact C-N 3.26Å; I98-G100 PolarHBondContact O-N 2.95Å; G100-S102 PolarHBondContact O-N 3.14Å; G100-S102 VanDerWaalsContact O-N 3.16Å
101	F	58.3	Low	69.3	Low	171 Å²	171	95.9 Å²	95.9	75%	0.75	56%	0.564	S	S	*	*			trans	-79.3	19.5	178.6	-75.9	-69.3	0	0	0	113.7	T99 S103	T99-F101 PolarHBondContact O-N 2.92Å; F101-S103 PolarHBondContact O-N 3.41Å; F101-S103 VanDerWaalsContact O-N 3.09Å
102	S	47.4	Very low	68.4	Low	100 Å²	100	99 Å²	99	70%	0.699	59%	0.585	S	S	*	*			trans	-75	98.7	170.6	62.4	0	0	0	0	110	G100	G100-S102 PolarHBondContact O-N 3.14Å; G100-S102 VanDerWaalsContact O-N 3.16Å
103	S	43.4	Very low	67.3	Low	186 Å²	186	106 Å²	106	100%	1.301	62%	0.624	S	S	*	*			trans	-71.6	0	152.6	60.6	0	0	0	0	110.6	F101	F101-S103 PolarHBondContact O-N 3.41Å; F101-S103 VanDerWaalsContact O-N 3.09Å

Retrieved 103 of 103 residues in 135.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).