A0A077YVE8_TRITR Loading...

Prefoldin subunit 1

AlphaFold DB , UniProt , Accession A0A077YVE8, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 145 aa.

						>A0A077YVE8_TRITR|A0A077YVE8
MDTNAGEDLKKSFQHLQAKRLQTQQSVQQADALIQAQEKKLKKLSIIRGEVLCPIPKSNLFLGIGRMYIDTSEKEICRVLDDATELATNTLELLKVRLTNVTCCIVMKSYVKRNRKSFQANEKFFVKPEKKLFLSNIGLLEDAVT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50	Low	76.6	Confident	222 Å²	222	115.6 Å²	115.6	100%	1.094	62%	0.624	S	S	*	*				0	38.8	0	-79.7	-170	176.9	0	0	109.5
2	D	60.4	Low	77.5	Confident	137 Å²	137	112.3 Å²	112.3	73%	0.733	62%	0.616	S	S	*	*			trans	-109.6	-7.5	-159.2	-54	-72.7	0	0	0	114.3	N4	D2-N4 PolarHBondContact O-N 3.35Å
3	T	64.2	Low	78.5	Confident	107 Å²	107	113.9 Å²	113.9	66%	0.656	61%	0.614	S	S	*	*	H	α-helix	trans	-65	-38.3	-178.7	41.3	0	0	0	0	112.8	E7	T3-E7 PolarHBondContact O-N 3.46Å
4	N	72.4	Confident	79.4	Confident	108 Å²	108	113.2 Å²	113.2	58%	0.578	60%	0.604	S	S	*	*	H	α-helix	trans	-68.3	-41.1	-177.6	-64.3	-6.2	0	0	0	112.1	D2 G6 E7 D8	D2-N4 PolarHBondContact O-N 3.35Å; N4-G6 VanDerWaalsContact C-N 3.32Å; N4-G6 PolarHBondContact O-N 2.93Å; N4-E7 PolarHBondContact O-N 3.01Å; N4-D8 WeakPolarHBondContact O-CB 3.31Å; N4-D8 VanDerWaalsContact O-CG 3.28Å; N4-D8 PolarHBondContact O-N 3.36Å
5	A	77.7	Confident	80	Confident	68 Å²	68	114.5 Å²	114.5	56%	0.562	61%	0.605	S	S	*	*	H	α-helix	trans	-63.4	-37.9	-178.6	0	0	0	0	0	112.3	L9	A5-L9 VanDerWaalsContact O-CB 3.31Å; A5-L9 WeakPolarHBondContact O-CB 3.47Å; A5-L9 PolarHBondContact O-N 3.24Å
6	G	83.3	Confident	80.5	Confident	44 Å²	44	114.4 Å²	114.4	45%	0.454	60%	0.604	S	S	.	*	H	α-helix	trans	-65.7	-41.7	176	0	0	0	0	0	112.9	N4 K10	N4-G6 VanDerWaalsContact C-N 3.32Å; N4-G6 PolarHBondContact O-N 2.93Å; G6-K10 WeakPolarHBondContact O-CB 3.15Å; G6-K10 PolarHBondContact O-N 3.44Å
7	E	87.7	Confident	80.9	Confident	109 Å²	109	114.7 Å²	114.7	51%	0.509	60%	0.601	S	S	.	*	H	α-helix	trans	-67.5	-42.8	176.4	-71.5	-172.9	179.5	0	0	112.4	T3 N4 L9 K10 K11	T3-E7 PolarHBondContact O-N 3.46Å; N4-E7 PolarHBondContact O-N 3.01Å; E7-L9 VanDerWaalsContact C-N 3.33Å; E7-L9 PolarHBondContact O-N 2.59Å; E7-K10 PolarHBondContact O-N 3.3Å; E7-K11 WeakPolarHBondContact O-CG 3.5Å; E7-K11 PolarHBondContact O-N 3.26Å
8	D	85.9	Confident	81.4	Confident	89 Å²	89	111.6 Å²	111.6	48%	0.476	60%	0.595	S	S	.	*	H	α-helix	trans	-64.6	-39.4	178.4	-70.2	-24	0	0	0	111.6	N4 K11 S12	N4-D8 WeakPolarHBondContact O-CB 3.31Å; N4-D8 VanDerWaalsContact O-CG 3.28Å; N4-D8 PolarHBondContact O-N 3.36Å; D8-K11 PolarHBondContact O-N 3.08Å; D8-S12 VanDerWaalsContact O-CB 3.29Å; D8-S12 WeakPolarHBondContact O-CB 3.42Å; D8-S12 PolarHBondContact O-N 3.44Å; D8-S12 PolarHBondContact O-OG 3.05Å
9	L	85.7	Confident	81.8	Confident	130 Å²	130	112.1 Å²	112.1	68%	0.681	59%	0.591	S	S	*	*	H	α-helix	trans	-63.5	-43.6	174.1	-171.7	70.4	0	0	0	111.3	A5 E7 S12 F13	A5-L9 VanDerWaalsContact O-CB 3.31Å; A5-L9 WeakPolarHBondContact O-CB 3.47Å; A5-L9 PolarHBondContact O-N 3.24Å; E7-L9 VanDerWaalsContact C-N 3.33Å; E7-L9 PolarHBondContact O-N 2.59Å; L9-S12 PolarHBondContact O-N 3.04Å; L9-F13 WeakPolarHBondContact O-CB 3.31Å; L9-F13 PolarHBondContact O-N 3.01Å
10	K	86.9	Confident	82.1	Confident	140 Å²	140	116 Å²	116	61%	0.609	60%	0.597	S	S	*	*	H	α-helix	trans	-63.1	-45.8	177.7	-174.7	178.5	178.9	-178.7	0	111.6	G6 E7 S12 F13 Q14	G6-K10 WeakPolarHBondContact O-CB 3.15Å; G6-K10 PolarHBondContact O-N 3.44Å; E7-K10 PolarHBondContact O-N 3.3Å; K10-S12 VanDerWaalsContact C-N 3.34Å; K10-F13 PolarHBondContact O-N 3.22Å; K10-Q14 WeakPolarHBondContact O-CG 3.43Å; K10-Q14 PolarHBondContact O-N 3.42Å
11	K	88.8	Confident	82.4	Confident	118 Å²	118	114.9 Å²	114.9	51%	0.513	59%	0.592	S	S	.	*	H	α-helix	trans	-61	-43.8	175.8	-72.7	171.9	-173	163.8	0	111.2	E7 D8 F13 Q14 H15	E7-K11 WeakPolarHBondContact O-CG 3.5Å; E7-K11 PolarHBondContact O-N 3.26Å; D8-K11 PolarHBondContact O-N 3.08Å; K11-F13 PolarHBondContact O-N 3.44Å; K11-Q14 PolarHBondContact O-N 3.07Å; K11-H15 WeakPolarHBondContact O-CB 3.36Å; K11-H15 PolarHBondContact O-N 2.89Å
12	S	87.3	Confident	84.2	Confident	75 Å²	75	110.7 Å²	110.7	52%	0.524	57%	0.57	S	S	.	*	H	α-helix	trans	-62.5	-41.2	177.3	-61.3	0	0	0	0	112.1	D8 L9 K10 H15 L16	D8-S12 VanDerWaalsContact O-CB 3.29Å; D8-S12 WeakPolarHBondContact O-CB 3.42Å; D8-S12 PolarHBondContact O-N 3.44Å; D8-S12 PolarHBondContact O-OG 3.05Å; L9-S12 PolarHBondContact O-N 3.04Å; K10-S12 VanDerWaalsContact C-N 3.34Å; S12-H15 PolarHBondContact O-N 3.23Å; S12-L16 WeakPolarHBondContact O-CB 3.38Å; S12-L16 PolarHBondContact O-N 2.89Å
13	F	90	Very high	85.4	Confident	134 Å²	134	107.1 Å²	107.1	59%	0.588	55%	0.553	S	S	*	*	H	α-helix	trans	-66.3	-43	176.9	-174	-97.1	0	0	0	112.2	L9 K10 K11 L16 Q17	L9-F13 WeakPolarHBondContact O-CB 3.31Å; L9-F13 PolarHBondContact O-N 3.01Å; K10-F13 PolarHBondContact O-N 3.22Å; K11-F13 PolarHBondContact O-N 3.44Å; F13-L16 PolarHBondContact O-N 2.77Å; F13-Q17 WeakPolarHBondContact O-CB 3.48Å; F13-Q17 PolarHBondContact O-N 3.41Å
14	Q	91.2	Very high	86.5	Confident	104 Å²	104	107 Å²	107	49%	0.486	55%	0.545	S	S	.	.	H	α-helix	trans	-61.8	-44.5	175.5	-73.8	176.7	-23	0	0	111.7	K10 K11 L16 Q17 A18	K10-Q14 WeakPolarHBondContact O-CG 3.43Å; K10-Q14 PolarHBondContact O-N 3.42Å; K11-Q14 PolarHBondContact O-N 3.07Å; Q14-L16 VanDerWaalsContact C-N 3.33Å; Q14-L16 PolarHBondContact O-N 2.9Å; Q14-Q17 PolarHBondContact O-N 3.35Å; Q14-A18 PolarHBondContact O-N 3.47Å
15	H	89	Confident	87.3	Confident	132 Å²	132	106.4 Å²	106.4	61%	0.611	54%	0.539	S	S	*	.	H	α-helix	trans	-60.2	-43.9	175.3	-176.3	73.5	0	0	0	111.6	K11 S12 Q17 A18 K19	K11-H15 WeakPolarHBondContact O-CB 3.36Å; K11-H15 PolarHBondContact O-N 2.89Å; S12-H15 PolarHBondContact O-N 3.23Å; H15-Q17 PolarHBondContact O-N 3.07Å; H15-A18 PolarHBondContact O-N 3.48Å; H15-K19 WeakPolarHBondContact O-CB 3.46Å; H15-K19 PolarHBondContact O-N 3.36Å
16	L	88.1	Confident	87.7	Confident	113 Å²	113	106.6 Å²	106.6	59%	0.592	54%	0.536	S	S	*	.	H	α-helix	trans	-64.3	-40	176.9	-172.5	69.5	0	0	0	112.3	S12 F13 Q14 K19 R20	S12-L16 WeakPolarHBondContact O-CB 3.38Å; S12-L16 PolarHBondContact O-N 2.89Å; F13-L16 PolarHBondContact O-N 2.77Å; Q14-L16 VanDerWaalsContact C-N 3.33Å; Q14-L16 PolarHBondContact O-N 2.9Å; L16-K19 PolarHBondContact O-N 2.61Å; L16-R20 WeakPolarHBondContact O-CB 3.44Å; L16-R20 PolarHBondContact O-N 2.8Å
17	Q	87.1	Confident	88	Confident	120 Å²	120	106.1 Å²	106.1	56%	0.561	52%	0.524	S	S	*	.	H	α-helix	trans	-64	-44	177	-171.9	177.3	20.9	0	0	111.2	F13 Q14 H15 R20 L21	F13-Q17 WeakPolarHBondContact O-CB 3.48Å; F13-Q17 PolarHBondContact O-N 3.41Å; Q14-Q17 PolarHBondContact O-N 3.35Å; H15-Q17 PolarHBondContact O-N 3.07Å; Q17-R20 PolarHBondContact O-N 3.18Å; Q17-L21 PolarHBondContact O-N 2.87Å
18	A	90.4	Very high	88.1	Confident	58 Å²	58	106.3 Å²	106.3	48%	0.479	53%	0.525	S	S	.	.	H	α-helix	trans	-61.1	-46.6	174.5	0	0	0	0	0	111.4	Q14 H15 R20 L21 Q22	Q14-A18 PolarHBondContact O-N 3.47Å; H15-A18 PolarHBondContact O-N 3.48Å; A18-R20 PolarHBondContact O-N 3.31Å; A18-L21 PolarHBondContact O-N 3.22Å; A18-Q22 WeakPolarHBondContact O-CB 3.29Å; A18-Q22 PolarHBondContact O-N 2.73Å
19	K	88.6	Confident	88.3	Confident	121 Å²	121	108 Å²	108	53%	0.526	53%	0.53	S	S	.	.	H	α-helix	trans	-61.4	-42.4	177.8	-169.4	170.3	-174.5	172.7	0	112	H15 L16 Q22 T23	H15-K19 WeakPolarHBondContact O-CB 3.46Å; H15-K19 PolarHBondContact O-N 3.36Å; L16-K19 PolarHBondContact O-N 2.61Å; K19-Q22 PolarHBondContact O-N 3.05Å; K19-T23 PolarHBondContact O-N 3.34Å; K19-T23 PolarHBondContact O-OG1 3.27Å
20	R	86.7	Confident	88.5	Confident	190 Å²	190	102.8 Å²	102.8	72%	0.717	51%	0.505	S	S	*	.	H	α-helix	trans	-58.1	-49.7	174.2	174.2	-169.3	-87.1	-166.2	-6.5	111	L16 Q17 A18 Q22 T23 Q24	L16-R20 WeakPolarHBondContact O-CB 3.44Å; L16-R20 PolarHBondContact O-N 2.8Å; Q17-R20 PolarHBondContact O-N 3.18Å; A18-R20 PolarHBondContact O-N 3.31Å; R20-Q22 VanDerWaalsContact C-N 3.34Å; R20-T23 PolarHBondContact O-N 3.11Å; R20-Q24 WeakPolarHBondContact O-CB 3.34Å; R20-Q24 PolarHBondContact O-N 2.91Å
21	L	89.8	Confident	88.8	Confident	94 Å²	94	99 Å²	99	49%	0.492	49%	0.492	S	S	.	.	H	α-helix	trans	-62.9	-43.5	-177.7	-175.7	64.2	0	0	0	111.1	Q17 A18 T23 Q24 Q25	Q17-L21 PolarHBondContact O-N 2.87Å; A18-L21 PolarHBondContact O-N 3.22Å; L21-T23 PolarHBondContact O-N 2.95Å; L21-Q24 PolarHBondContact O-N 3.29Å; L21-Q25 WeakPolarHBondContact O-CG 3.23Å; L21-Q25 PolarHBondContact O-N 2.87Å
22	Q	87.7	Confident	88.9	Confident	134 Å²	134	96.1 Å²	96.1	63%	0.626	49%	0.49	S	S	*	.	H	α-helix	trans	-59.6	-45.2	175.8	-172.2	-175.4	13.2	0	0	111.8	A18 K19 R20 Q25 S26	A18-Q22 WeakPolarHBondContact O-CB 3.29Å; A18-Q22 PolarHBondContact O-N 2.73Å; K19-Q22 PolarHBondContact O-N 3.05Å; R20-Q22 VanDerWaalsContact C-N 3.34Å; Q22-Q25 PolarHBondContact O-N 3.13Å; Q22-S26 WeakPolarHBondContact O-CB 3.34Å; Q22-S26 PolarHBondContact O-N 3.18Å
23	T	85.8	Confident	89.2	Confident	61 Å²	61	96.8 Å²	96.8	37%	0.374	49%	0.487	S	S	.	.	H	α-helix	trans	-62.4	-43.1	175.7	-56.3	0	0	0	0	111.5	K19 R20 L21 Q25 S26 V27 V101	K19-T23 PolarHBondContact O-N 3.34Å; K19-T23 PolarHBondContact O-OG1 3.27Å; R20-T23 PolarHBondContact O-N 3.11Å; L21-T23 PolarHBondContact O-N 2.95Å; T23-Q25 PolarHBondContact O-N 3.46Å; T23-S26 PolarHBondContact O-N 3.44Å; T23-V27 WeakPolarHBondContact O-CG2 3.33Å; T23-V27 PolarHBondContact O-N 3.02Å; T23-V101 HydrophobicContact CG2-CG1 4.46Å
24	Q	86.1	Confident	89.4	Confident	105 Å²	105	91.1 Å²	91.1	49%	0.491	46%	0.463	S	S	.	.	H	α-helix	trans	-62.3	-44.4	178.8	-176.1	175.6	-1.1	0	0	111.9	R20 L21 V27 Q28	R20-Q24 WeakPolarHBondContact O-CB 3.34Å; R20-Q24 PolarHBondContact O-N 2.91Å; L21-Q24 PolarHBondContact O-N 3.29Å; Q24-V27 PolarHBondContact O-N 3.15Å; Q24-Q28 WeakPolarHBondContact O-CG 3.43Å; Q24-Q28 PolarHBondContact O-N 3.08Å
25	Q	89.1	Confident	89.5	Confident	96 Å²	96	92.6 Å²	92.6	45%	0.449	47%	0.47	S	S	.	.	H	α-helix	trans	-63	-42.6	175.2	-72.3	176	-17.1	0	0	111.6	L21 Q22 T23 V27 Q28 Q29	L21-Q25 WeakPolarHBondContact O-CG 3.23Å; L21-Q25 PolarHBondContact O-N 2.87Å; Q22-Q25 PolarHBondContact O-N 3.13Å; T23-Q25 PolarHBondContact O-N 3.46Å; Q25-V27 VanDerWaalsContact C-N 3.31Å; Q25-V27 PolarHBondContact O-N 3.01Å; Q25-Q28 PolarHBondContact O-N 3.24Å; Q25-Q29 WeakPolarHBondContact O-CB 3.29Å; Q25-Q29 VanDerWaalsContact O-CG 3.29Å; Q25-Q29 WeakPolarHBondContact O-CG 3.5Å; Q25-Q29 PolarHBondContact O-N 2.92Å
26	S	87.2	Confident	89.7	Confident	71 Å²	71	88.9 Å²	88.9	50%	0.497	46%	0.462	S	S	.	.	H	α-helix	trans	-62.1	-37.9	177.3	-177.8	0	0	0	0	112.5	Q22 T23 A30	Q22-S26 WeakPolarHBondContact O-CB 3.34Å; Q22-S26 PolarHBondContact O-N 3.18Å; T23-S26 PolarHBondContact O-N 3.44Å; S26-A30 WeakPolarHBondContact O-CB 3.39Å; S26-A30 PolarHBondContact O-N 3.32Å
27	V	88.8	Confident	90	Very high	35 Å²	35	85.2 Å²	85.2	21%	0.212	44%	0.442	C	S	.	.	H	α-helix	trans	-65.7	-47.9	175	168.4	0	0	0	0	110.5	T23 Q24 Q25 Q29 A30 D31 L98 V101	T23-V27 WeakPolarHBondContact O-CG2 3.33Å; T23-V27 PolarHBondContact O-N 3.02Å; Q24-V27 PolarHBondContact O-N 3.15Å; Q25-V27 VanDerWaalsContact C-N 3.31Å; Q25-V27 PolarHBondContact O-N 3.01Å; V27-Q29 VanDerWaalsContact C-N 3.3Å; V27-Q29 PolarHBondContact O-N 2.96Å; V27-A30 WeakPolarHBondContact O-CB 3.44Å; V27-A30 PolarHBondContact O-N 2.98Å; V27-A30 VanDerWaalsContact O-N 3.11Å; V27-D31 PolarHBondContact O-N 2.93Å; V27-L98 HydrophobicContact CG1-CD1 3.94Å; V27-V101 HydrophobicContact CG2-CG1 3.86Å
28	Q	90.3	Very high	90.3	Very high	113 Å²	113	83.5 Å²	83.5	53%	0.528	43%	0.434	S	S	.	.	H	α-helix	trans	-60.4	-39.6	177.8	-71.8	175.4	-15.2	0	0	112.5	Q24 Q25 D31 A32	Q24-Q28 WeakPolarHBondContact O-CG 3.43Å; Q24-Q28 PolarHBondContact O-N 3.08Å; Q25-Q28 PolarHBondContact O-N 3.24Å; Q28-D31 PolarHBondContact O-N 3.26Å; Q28-A32 WeakPolarHBondContact O-CB 3.43Å; Q28-A32 PolarHBondContact O-N 3.28Å
29	Q	90.7	Very high	90.5	Very high	125 Å²	125	87.3 Å²	87.3	58%	0.584	44%	0.44	S	S	*	.	H	α-helix	trans	-64.8	-42.9	174.4	-73.5	173.3	-7.3	0	0	111.6	Q25 V27 A32 L33	Q25-Q29 WeakPolarHBondContact O-CB 3.29Å; Q25-Q29 VanDerWaalsContact O-CG 3.29Å; Q25-Q29 WeakPolarHBondContact O-CG 3.5Å; Q25-Q29 PolarHBondContact O-N 2.92Å; V27-Q29 VanDerWaalsContact C-N 3.3Å; V27-Q29 PolarHBondContact O-N 2.96Å; Q29-A32 PolarHBondContact O-N 2.95Å; Q29-L33 WeakPolarHBondContact O-CB 3.44Å; Q29-L33 VanDerWaalsContact O-CG 3.29Å; Q29-L33 WeakPolarHBondContact O-CG 3.37Å; Q29-L33 PolarHBondContact O-N 2.89Å
30	A	89.4	Confident	90.7	Very high	19 Å²	19	85.5 Å²	85.5	16%	0.157	43%	0.432	C	S	.	.	H	α-helix	trans	-61.8	-43.6	176.3	0	0	0	0	0	111.7	S26 V27 A32 L33 I34	S26-A30 WeakPolarHBondContact O-CB 3.39Å; S26-A30 PolarHBondContact O-N 3.32Å; V27-A30 WeakPolarHBondContact O-CB 3.44Å; V27-A30 PolarHBondContact O-N 2.98Å; V27-A30 VanDerWaalsContact O-N 3.11Å; A30-A32 PolarHBondContact O-N 3.38Å; A30-L33 PolarHBondContact O-N 3.49Å; A30-I34 VanDerWaalsContact O-CG1 3.31Å; A30-I34 WeakPolarHBondContact O-CG1 3.46Å; A30-I34 PolarHBondContact O-N 2.94Å
31	D	92.1	Very high	91.1	Very high	62 Å²	62	78.1 Å²	78.1	33%	0.332	41%	0.406	S	S	.	.	H	α-helix	trans	-61.7	-44.3	176.5	-73.7	-28.9	0	0	0	112	V27 Q28 L33 I34 Q35 L98	V27-D31 PolarHBondContact O-N 2.93Å; Q28-D31 PolarHBondContact O-N 3.26Å; D31-L33 VanDerWaalsContact C-N 3.32Å; D31-L33 PolarHBondContact O-N 2.92Å; D31-I34 PolarHBondContact O-N 3.26Å; D31-Q35 WeakPolarHBondContact O-CG 3.23Å; D31-Q35 PolarHBondContact O-N 3.45Å; D31-L98 VanDerWaalsContact OD1-CD2 3.25Å; D31-L98 WeakPolarHBondContact OD1-CD2 3.41Å
32	A	92.8	Very high	91.2	Very high	56 Å²	56	80.5 Å²	80.5	46%	0.463	41%	0.413	S	S	.	.	H	α-helix	trans	-62	-40.4	176.1	0	0	0	0	0	111.8	Q28 Q29 A30 Q35 A36	Q28-A32 WeakPolarHBondContact O-CB 3.43Å; Q28-A32 PolarHBondContact O-N 3.28Å; Q29-A32 PolarHBondContact O-N 2.95Å; A30-A32 PolarHBondContact O-N 3.38Å; A32-Q35 PolarHBondContact O-N 2.86Å; A32-A36 WeakPolarHBondContact O-CB 3.39Å; A32-A36 PolarHBondContact O-N 3.41Å
33	L	92.6	Very high	91.3	Very high	90 Å²	90	80 Å²	80	47%	0.471	41%	0.408	S	S	.	.	H	α-helix	trans	-65.9	-40.7	175.5	-72	173	0	0	0	111.9	Q29 A30 D31 A36 Q37 L94	Q29-L33 WeakPolarHBondContact O-CB 3.44Å; Q29-L33 VanDerWaalsContact O-CG 3.29Å; Q29-L33 WeakPolarHBondContact O-CG 3.37Å; Q29-L33 PolarHBondContact O-N 2.89Å; A30-L33 PolarHBondContact O-N 3.49Å; D31-L33 VanDerWaalsContact C-N 3.32Å; D31-L33 PolarHBondContact O-N 2.92Å; L33-A36 PolarHBondContact O-N 3.46Å; L33-Q37 WeakPolarHBondContact O-CG 3.34Å; L33-Q37 PolarHBondContact O-N 2.93Å; L33-L94 HydrophobicContact CB-CD1 3.8Å
34	I	93.8	Very high	91.5	Very high	15 Å²	15	77.9 Å²	77.9	8%	0.077	40%	0.395	C	S	.	.	H	α-helix	trans	-58.2	-51.5	174.7	-74.4	167.8	0	0	0	110.1	A30 D31 A36 Q37 E38 L91 L94 K95 L98	A30-I34 VanDerWaalsContact O-CG1 3.31Å; A30-I34 WeakPolarHBondContact O-CG1 3.46Å; A30-I34 PolarHBondContact O-N 2.94Å; D31-I34 PolarHBondContact O-N 3.26Å; I34-A36 VanDerWaalsContact C-N 3.29Å; I34-A36 PolarHBondContact O-N 2.97Å; I34-Q37 PolarHBondContact O-N 3.47Å; I34-Q37 VanDerWaalsContact O-N 3.15Å; I34-E38 WeakPolarHBondContact O-CG 3.44Å; I34-E38 PolarHBondContact O-N 3.34Å; I34-L91 HydrophobicContact CB-CD1 4.24Å; I34-L91 HydrophobicContact CG1-CD1 4.27Å; I34-L91 HydrophobicContact CG2-CD1 3.8Å; I34-L94 HydrophobicContact CD1-CB 4.19Å; I34-L94 HydrophobicContact CG1-CB 3.74Å; I34-L94 HydrophobicContact CG1-CD1 4.25Å; I34-K95 HydrophobicContact CD1-CG 4.3Å; I34-L98 HydrophobicContact CD1-CD2 3.89Å
35	Q	94.5	Very high	91.6	Very high	134 Å²	134	76.3 Å²	76.3	63%	0.626	40%	0.396	S	S	*	.	H	α-helix	trans	-60.4	-39.1	178.2	-69.5	177.2	14.5	0	0	112.2	D31 A32 E38 K39	D31-Q35 WeakPolarHBondContact O-CG 3.23Å; D31-Q35 PolarHBondContact O-N 3.45Å; A32-Q35 PolarHBondContact O-N 2.86Å; Q35-E38 PolarHBondContact O-N 3.46Å; Q35-K39 WeakPolarHBondContact O-CB 3.42Å; Q35-K39 PolarHBondContact O-N 3.3Å
36	A	93.4	Very high	91.5	Very high	54 Å²	54	76 Å²	76	45%	0.446	40%	0.396	S	S	.	.	H	α-helix	trans	-63.7	-42.6	176.5	0	0	0	0	0	111.9	A32 L33 I34 K39 K40	A32-A36 WeakPolarHBondContact O-CB 3.39Å; A32-A36 PolarHBondContact O-N 3.41Å; L33-A36 PolarHBondContact O-N 3.46Å; I34-A36 VanDerWaalsContact C-N 3.29Å; I34-A36 PolarHBondContact O-N 2.97Å; A36-K39 PolarHBondContact O-N 3.46Å; A36-K40 WeakPolarHBondContact O-CB 3.24Å; A36-K40 PolarHBondContact O-N 3.38Å
37	Q	93.4	Very high	91.3	Very high	37 Å²	37	75.1 Å²	75.1	17%	0.173	39%	0.385	C	S	.	.	H	α-helix	trans	-68.4	-40.8	176.7	-66.9	-57.2	-22.3	0	0	112.1	L33 I34 K39 K40 L41 T90 L91	L33-Q37 WeakPolarHBondContact O-CG 3.34Å; L33-Q37 PolarHBondContact O-N 2.93Å; I34-Q37 PolarHBondContact O-N 3.47Å; I34-Q37 VanDerWaalsContact O-N 3.15Å; Q37-K39 VanDerWaalsContact C-N 3.31Å; Q37-K39 PolarHBondContact O-N 3.13Å; Q37-K40 WeakPolarHBondContact O-CA 3.37Å; Q37-K40 WeakPolarHBondContact O-CB 3.32Å; Q37-K40 PolarHBondContact O-N 3.46Å; Q37-K40 VanDerWaalsContact O-N 3.09Å; Q37-L41 WeakPolarHBondContact O-CG 3.34Å; Q37-L41 PolarHBondContact O-N 2.99Å; Q37-T90 HydrophobicContact CG-CG2 4.28Å; Q37-L91 HydrophobicContact CB-CB 4.34Å; Q37-L91 HydrophobicContact CB-CD1 4.24Å
38	E	93.9	Very high	91	Very high	84 Å²	84	77.7 Å²	77.7	39%	0.393	39%	0.391	S	S	.	.	H	α-helix	trans	-61.7	-41.3	175.1	-71.6	178.7	165.1	0	0	111.4	I34 Q35 K40 L41 K42 L91 K95	I34-E38 WeakPolarHBondContact O-CG 3.44Å; I34-E38 PolarHBondContact O-N 3.34Å; Q35-E38 PolarHBondContact O-N 3.46Å; E38-K40 VanDerWaalsContact C-N 3.33Å; E38-K40 PolarHBondContact O-N 3.37Å; E38-L41 PolarHBondContact O-N 3.44Å; E38-K42 PolarHBondContact O-N 2.91Å; E38-L91 HydrophobicContact CG-CD1 3.92Å; E38-L91 HydrophobicContact CG-CD2 3.86Å; E38-K95 WeakPolarHBondContact OE1-CE 3.49Å; E38-K95 IonicContact OE1-NZ 2.88Å; E38-K95 PolarHBondContact OE1-NZ 2.87Å
39	K	94.8	Very high	90.6	Very high	138 Å²	138	74.4 Å²	74.4	60%	0.6	39%	0.387	S	S	*	.	H	α-helix	trans	-64	-38.6	172.8	-171.7	176.4	-175.8	176.1	0	111.9	Q35 A36 Q37 K42 K43	Q35-K39 WeakPolarHBondContact O-CB 3.42Å; Q35-K39 PolarHBondContact O-N 3.3Å; A36-K39 PolarHBondContact O-N 3.46Å; Q37-K39 VanDerWaalsContact C-N 3.31Å; Q37-K39 PolarHBondContact O-N 3.13Å; K39-K42 PolarHBondContact O-N 3.35Å; K39-K43 WeakPolarHBondContact O-CG 3.44Å; K39-K43 PolarHBondContact O-N 3.04Å; K39-K43 VanDerWaalsContact O-N 3.08Å
40	K	92.9	Very high	90	Very high	82 Å²	82	71 Å²	71	36%	0.357	37%	0.371	S	S	.	.	H	α-helix	trans	-63.8	-47.2	176.2	-175	-176.4	175.2	-170.9	0	111	A36 Q37 E38 K42 K43 L44 A87	A36-K40 WeakPolarHBondContact O-CB 3.24Å; A36-K40 PolarHBondContact O-N 3.38Å; Q37-K40 WeakPolarHBondContact O-CA 3.37Å; Q37-K40 WeakPolarHBondContact O-CB 3.32Å; Q37-K40 PolarHBondContact O-N 3.46Å; Q37-K40 VanDerWaalsContact O-N 3.09Å; E38-K40 VanDerWaalsContact C-N 3.33Å; E38-K40 PolarHBondContact O-N 3.37Å; K40-K42 VanDerWaalsContact C-N 3.32Å; K40-K42 PolarHBondContact O-N 3.28Å; K40-K43 WeakPolarHBondContact O-CB 3.06Å; K40-K43 PolarHBondContact O-N 3.34Å; K40-K43 VanDerWaalsContact O-N 3.08Å; K40-L44 HydrophobicContact CG-CD1 4.26Å; K40-L44 WeakPolarHBondContact O-CG 3.45Å; K40-L44 PolarHBondContact O-N 3.39Å; K40-A87 HydrophobicContact CD-CB 4.2Å
41	L	93.3	Very high	89.3	Confident	36 Å²	36	71.5 Å²	71.5	19%	0.188	37%	0.372	C	S	.	.	H	α-helix	trans	-58.4	-44	176.6	-74.3	171.5	0	0	0	111.7	Q37 E38 K43 L44 S45 T84 A87 L91	Q37-L41 WeakPolarHBondContact O-CG 3.34Å; Q37-L41 PolarHBondContact O-N 2.99Å; E38-L41 PolarHBondContact O-N 3.44Å; L41-K43 VanDerWaalsContact C-N 3.3Å; L41-K43 PolarHBondContact O-N 2.92Å; L41-L44 PolarHBondContact O-N 2.96Å; L41-S45 PolarHBondContact O-N 2.89Å; L41-T84 HydrophobicContact CD2-CG2 3.96Å; L41-A87 HydrophobicContact CD2-CB 3.69Å; L41-A87 HydrophobicContact CG-CB 4.05Å; L41-L91 HydrophobicContact CD1-CD2 3.72Å
42	K	92.8	Very high	88.5	Confident	144 Å²	144	72.5 Å²	72.5	63%	0.626	38%	0.378	S	S	*	.	H	α-helix	trans	-61	-37.8	175	-173.2	175.8	-177.9	176.6	0	112.8	E38 K39 K40 S45 I46	E38-K42 PolarHBondContact O-N 2.91Å; K39-K42 PolarHBondContact O-N 3.35Å; K40-K42 VanDerWaalsContact C-N 3.32Å; K40-K42 PolarHBondContact O-N 3.28Å; K42-S45 PolarHBondContact O-OG 2.91Å; K42-I46 HydrophobicContact CG-CD1 4.28Å; K42-I46 WeakPolarHBondContact O-CD1 3.31Å; K42-I46 VanDerWaalsContact O-CG1 3.26Å; K42-I46 WeakPolarHBondContact O-CG1 3.36Å; K42-I46 PolarHBondContact O-N 3.25Å
43	K	90.6	Very high	87.4	Confident	122 Å²	122	72.1 Å²	72.1	53%	0.53	37%	0.371	S	S	.	.	H	α-helix	trans	-66.7	-45.2	175	-73	178.2	177.7	-170.9	0	111.3	K39 K40 L41 S45 I46 I47	K39-K43 WeakPolarHBondContact O-CG 3.44Å; K39-K43 PolarHBondContact O-N 3.04Å; K39-K43 VanDerWaalsContact O-N 3.08Å; K40-K43 WeakPolarHBondContact O-CB 3.06Å; K40-K43 PolarHBondContact O-N 3.34Å; K40-K43 VanDerWaalsContact O-N 3.08Å; L41-K43 VanDerWaalsContact C-N 3.3Å; L41-K43 PolarHBondContact O-N 2.92Å; K43-S45 VanDerWaalsContact C-N 3.32Å; K43-S45 PolarHBondContact O-N 3.22Å; K43-I46 PolarHBondContact O-N 3.44Å; K43-I47 VanDerWaalsContact O-CG1 3.3Å; K43-I47 WeakPolarHBondContact O-CG1 3.45Å; K43-I47 PolarHBondContact O-N 3.02Å
44	L	89.4	Confident	86	Confident	18 Å²	18	73.6 Å²	73.6	9%	0.094	39%	0.386	C	S	.	.	H	α-helix	trans	-61	-41.3	178.7	-69.3	172.8	0	0	0	111.5	K40 L41 I46 I47 R48 L80 A83	K40-L44 HydrophobicContact CG-CD1 4.26Å; K40-L44 WeakPolarHBondContact O-CG 3.45Å; K40-L44 PolarHBondContact O-N 3.39Å; L41-L44 PolarHBondContact O-N 2.96Å; L44-I46 VanDerWaalsContact C-N 3.34Å; L44-I46 PolarHBondContact O-N 3.44Å; L44-I47 PolarHBondContact O-N 3Å; L44-R48 WeakPolarHBondContact O-CB 3.45Å; L44-R48 PolarHBondContact O-N 3.39Å; L44-L80 HydrophobicContact CD2-CD2 4.03Å; L44-A83 HydrophobicContact CD1-CB 4.09Å; L44-A83 HydrophobicContact CD2-CB 4.11Å
45	S	88.2	Confident	84.4	Confident	72 Å²	72	79.6 Å²	79.6	50%	0.503	42%	0.417	S	S	.	.	H	α-helix	trans	-63.8	-38.9	176.8	68	0	0	0	0	112.6	L41 K42 K43 G49	L41-S45 PolarHBondContact O-N 2.89Å; K42-S45 PolarHBondContact O-OG 2.91Å; K43-S45 VanDerWaalsContact C-N 3.32Å; K43-S45 PolarHBondContact O-N 3.22Å; S45-G49 PolarHBondContact O-N 3.21Å
46	I	85.8	Confident	82.6	Confident	90 Å²	90	76.4 Å²	76.4	46%	0.462	41%	0.407	S	S	.	.	H	α-helix	trans	-65	-51.1	175.4	-67.4	163.7	0	0	0	109.8	K42 K43 L44 R48 G49 E50	K42-I46 HydrophobicContact CG-CD1 4.28Å; K42-I46 WeakPolarHBondContact O-CD1 3.31Å; K42-I46 VanDerWaalsContact O-CG1 3.26Å; K42-I46 WeakPolarHBondContact O-CG1 3.36Å; K42-I46 PolarHBondContact O-N 3.25Å; K43-I46 PolarHBondContact O-N 3.44Å; L44-I46 VanDerWaalsContact C-N 3.34Å; L44-I46 PolarHBondContact O-N 3.44Å; I46-R48 VanDerWaalsContact C-N 3.26Å; I46-R48 PolarHBondContact O-N 3.17Å; I46-G49 PolarHBondContact O-N 2.88Å; I46-E50 HydrophobicContact CG2-CG 4.22Å; I46-E50 VanDerWaalsContact O-CG 3.28Å; I46-E50 WeakPolarHBondContact O-CG 3.23Å; I46-E50 PolarHBondContact O-N 3.43Å
47	I	83.5	Confident	80.9	Confident	51 Å²	51	84.3 Å²	84.3	26%	0.262	43%	0.432	S	S	.	.	H	α-helix	trans	-57	-43.3	179.5	-64.5	163.6	0	0	0	110.4	K43 L44 G49 E50 V51 L80	K43-I47 VanDerWaalsContact O-CG1 3.3Å; K43-I47 WeakPolarHBondContact O-CG1 3.45Å; K43-I47 PolarHBondContact O-N 3.02Å; L44-I47 PolarHBondContact O-N 3Å; I47-G49 PolarHBondContact O-N 2.97Å; I47-E50 PolarHBondContact O-N 3.38Å; I47-V51 HydrophobicContact CG2-CG2 4.21Å; I47-V51 VanDerWaalsContact O-CG2 3.27Å; I47-V51 WeakPolarHBondContact O-CG2 3.37Å; I47-V51 PolarHBondContact O-N 2.89Å; I47-L80 HydrophobicContact CB-CD2 4.39Å; I47-L80 HydrophobicContact CG2-CD1 4.09Å; I47-L80 HydrophobicContact CG2-CD2 3.85Å
48	R	83.3	Confident	79.2	Confident	89 Å²	89	84.7 Å²	84.7	34%	0.336	44%	0.438	S	S	.	.	H	α-helix	trans	-60.1	-45.9	176	-172.9	-180	-168.4	141	15.9	112.3	L44 I46 E50 V51 L52 L80 D81	L44-R48 WeakPolarHBondContact O-CB 3.45Å; L44-R48 PolarHBondContact O-N 3.39Å; I46-R48 VanDerWaalsContact C-N 3.26Å; I46-R48 PolarHBondContact O-N 3.17Å; R48-E50 VanDerWaalsContact C-N 3.29Å; R48-E50 PolarHBondContact O-N 3.21Å; R48-V51 PolarHBondContact O-N 3.19Å; R48-L52 HydrophobicContact CG-CD1 4.04Å; R48-L52 WeakPolarHBondContact O-CG 3.37Å; R48-L52 PolarHBondContact O-N 2.85Å; R48-L52 VanDerWaalsContact O-N 3.14Å; R48-L80 HydrophobicContact CB-CD1 4.19Å; R48-D81 IonicContact CZ-OD1 3.04Å; R48-D81 IonicContact NH1-OD1 2.6Å; R48-D81 PolarHBondContact NH1-OD1 2.99Å; R48-D81 IonicContact NH2-OD1 2.83Å; R48-D81 PolarHBondContact NH2-OD1 3.11Å; R48-D81 IonicContact NH2-OD2 3.48Å; R48-D81 PolarHBondContact NH2-OD2 3.35Å
49	G	81.6	Confident	77.5	Confident	44 Å²	44	87.5 Å²	87.5	45%	0.454	46%	0.456	S	S	.	.	H	α-helix	trans	-61	-39.2	177.2	0	0	0	0	0	112.5	S45 I46 I47 C53	S45-G49 PolarHBondContact O-N 3.21Å; I46-G49 PolarHBondContact O-N 2.88Å; I47-G49 PolarHBondContact O-N 2.97Å; G49-C53 WeakPolarHBondContact O-CB 2.98Å; G49-C53 PolarHBondContact O-N 3.03Å
50	E	77.1	Confident	75.8	Confident	53 Å²	53	86.6 Å²	86.6	25%	0.248	46%	0.457	C	S	.	.	H	α-helix	trans	-71.7	-40.2	178.3	-62.9	-73.5	149.7	0	0	112.5	I46 I47 R48 L52 C53 F61 I64	I46-E50 HydrophobicContact CG2-CG 4.22Å; I46-E50 VanDerWaalsContact O-CG 3.28Å; I46-E50 WeakPolarHBondContact O-CG 3.23Å; I46-E50 PolarHBondContact O-N 3.43Å; I47-E50 PolarHBondContact O-N 3.38Å; R48-E50 VanDerWaalsContact C-N 3.29Å; R48-E50 PolarHBondContact O-N 3.21Å; E50-L52 VanDerWaalsContact C-N 3.3Å; E50-L52 PolarHBondContact O-N 3.16Å; E50-C53 PolarHBondContact O-N 3.32Å; E50-F61 HydrophobicContact CB-CE1 4.18Å; E50-F61 WeakPolarHBondContact O-CE1 3.35Å; E50-F61 WeakPolarHBondContact OE2-CE1 3.48Å; E50-F61 WeakPolarHBondContact OE2-CZ 3.48Å; E50-I64 HydrophobicContact CB-CD1 3.39Å; E50-I64 HydrophobicContact CG-CD1 3.73Å
51	V	76	Confident	74.1	Confident	30 Å²	30	84.2 Å²	84.2	18%	0.182	45%	0.447	C	S	.	.	H	α-helix	trans	-62.4	-37.7	176.6	168	0	0	0	0	111.5	I47 R48 C53 I64 Y68 I76 L80	I47-V51 HydrophobicContact CG2-CG2 4.21Å; I47-V51 VanDerWaalsContact O-CG2 3.27Å; I47-V51 WeakPolarHBondContact O-CG2 3.37Å; I47-V51 PolarHBondContact O-N 2.89Å; R48-V51 PolarHBondContact O-N 3.19Å; V51-C53 VanDerWaalsContact C-N 3.35Å; V51-I64 HydrophobicContact CG2-CG2 3.9Å; V51-Y68 HydrophobicContact CG2-CE2 4.47Å; V51-I76 HydrophobicContact CG1-CB 4.37Å; V51-I76 HydrophobicContact CG1-CD1 4.47Å; V51-I76 HydrophobicContact CG1-CG2 3.87Å; V51-I76 HydrophobicContact CG2-CG2 3.89Å; V51-L80 HydrophobicContact CG2-CD1 4.33Å
52	L	74.1	Confident	72.5	Confident	84 Å²	84	87.2 Å²	87.2	44%	0.44	46%	0.463	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.1	-4.6	-179.7	-63.4	174.9	0	0	0	113.5	R48 E50 P54 E73	R48-L52 HydrophobicContact CG-CD1 4.04Å; R48-L52 WeakPolarHBondContact O-CG 3.37Å; R48-L52 PolarHBondContact O-N 2.85Å; R48-L52 VanDerWaalsContact O-N 3.14Å; E50-L52 VanDerWaalsContact C-N 3.3Å; E50-L52 PolarHBondContact O-N 3.16Å; L52-P54 WeakPolarHBondContact O-CD 3.48Å; L52-E73 WeakPolarHBondContact CD2-OE1 3.42Å
53	C	69.9	Low	71.2	Confident	48 Å²	48	82.2 Å²	82.2	32%	0.324	45%	0.452	S	S	.	.	S	Bend	trans	-79	124.2	-176.3	-164.9	0	0	0	0	110.7	G49 E50 V51 I55 F61	G49-C53 WeakPolarHBondContact O-CB 2.98Å; G49-C53 PolarHBondContact O-N 3.03Å; E50-C53 PolarHBondContact O-N 3.32Å; V51-C53 VanDerWaalsContact C-N 3.35Å; C53-I55 PolarHBondContact O-N 2.91Å; C53-F61 HydrophobicContact CB-CE1 3.62Å; C53-F61 HydrophobicContact CB-CZ 3.94Å
54	P	64	Low	69.9	Low	120 Å²	120	77.8 Å²	77.8	78%	0.779	43%	0.434	S	S	*	.			trans	-67.9	98.3	169.4	25.9	-30.5	0	0	0	109.5	L52 P56	L52-P54 WeakPolarHBondContact O-CD 3.48Å; P54-P56 VanDerWaalsContact O-CD 3.29Å; P54-P56 WeakPolarHBondContact O-CD 3.39Å
55	I	60.4	Low	68.7	Low	142 Å²	142	79 Å²	79	73%	0.728	45%	0.45	S	S	*	.			trans	-7.1	97.8	176.7	-48.9	169.1	0	0	0	115.1	C53	C53-I55 PolarHBondContact O-N 2.91Å
56	P	56	Low	67.6	Low	66 Å²	66	83.8 Å²	83.8	43%	0.429	46%	0.457	S	S	.	.			trans	-79.6	149.6	144.5	11.1	4.9	0	0	0	109.1	P54 S58 F61	P54-P56 VanDerWaalsContact O-CD 3.29Å; P54-P56 WeakPolarHBondContact O-CD 3.39Å; P56-S58 PolarHBondContact O-N 3.18Å; P56-F61 VanDerWaalsContact CD-CE2 3.48Å; P56-F61 HydrophobicContact CG-CE2 3.87Å; P56-F61 HydrophobicContact CG-CZ 4.17Å; P56-F61 VanDerWaalsContact O-CD2 3.31Å; P56-F61 WeakPolarHBondContact O-CD2 3.39Å
57	K	57.4	Low	66.8	Low	220 Å²	220	86.3 Å²	86.3	96%	0.957	47%	0.469	S	S	*	.	S	Bend	trans	-63.9	42.2	-174	-60.3	176.1	178.2	174.1	0	115.6
58	S	57.1	Low	66.2	Low	45 Å²	45	86.2 Å²	86.2	32%	0.315	47%	0.465	S	S	.	.			trans	-93.5	139.3	179.6	116.8	0	0	0	0	110.8	P56 L60 F61	P56-S58 PolarHBondContact O-N 3.18Å; S58-L60 PolarHBondContact O-N 3.09Å; S58-L60 WeakPolarHBondContact OG-CB 3.36Å; S58-L60 PolarHBondContact OG-N 3.26Å; S58-F61 PolarHBondContact O-N 2.87Å; S58-F61 WeakPolarHBondContact OG-CD2 3.39Å; S58-F61 WeakPolarHBondContact OG-CE2 3.5Å
59	N	59.6	Low	65.5	Low	143 Å²	143	87 Å²	87	77%	0.765	48%	0.476	S	S	*	.	H	α-helix	trans	-63.3	-18.3	177.7	-75.9	-25.6	0	0	0	113.4	L62	N59-L62 WeakPolarHBondContact O-CB 3.31Å; N59-L62 PolarHBondContact O-N 3.22Å
60	L	58.6	Low	65.2	Low	119 Å²	119	92.9 Å²	92.9	62%	0.623	50%	0.496	S	S	*	.	H	α-helix	trans	-65.2	-39.5	178.1	-103	145.7	0	0	0	111.8	S58 L62 G63 I64	S58-L60 PolarHBondContact O-N 3.09Å; S58-L60 WeakPolarHBondContact OG-CB 3.36Å; S58-L60 PolarHBondContact OG-N 3.26Å; L60-L62 VanDerWaalsContact C-N 3.28Å; L60-L62 PolarHBondContact O-N 3Å; L60-G63 PolarHBondContact O-N 3.48Å; L60-I64 PolarHBondContact O-N 2.93Å
61	F	57.7	Low	65.2	Low	33 Å²	33	92.8 Å²	92.8	15%	0.145	50%	0.5	C	S	.	.	H	α-helix	trans	-64.6	-33.3	177.3	-65.2	-74.1	0	0	0	112.4	E50 C53 P56 S58 G63 I64 G65	E50-F61 HydrophobicContact CB-CE1 4.18Å; E50-F61 WeakPolarHBondContact O-CE1 3.35Å; E50-F61 WeakPolarHBondContact OE2-CE1 3.48Å; E50-F61 WeakPolarHBondContact OE2-CZ 3.48Å; C53-F61 HydrophobicContact CB-CE1 3.62Å; C53-F61 HydrophobicContact CB-CZ 3.94Å; P56-F61 VanDerWaalsContact CD-CE2 3.48Å; P56-F61 HydrophobicContact CG-CE2 3.87Å; P56-F61 HydrophobicContact CG-CZ 4.17Å; P56-F61 VanDerWaalsContact O-CD2 3.31Å; P56-F61 WeakPolarHBondContact O-CD2 3.39Å; S58-F61 PolarHBondContact O-N 2.87Å; S58-F61 WeakPolarHBondContact OG-CD2 3.39Å; S58-F61 WeakPolarHBondContact OG-CE2 3.5Å; F61-G63 PolarHBondContact O-N 3.15Å; F61-I64 PolarHBondContact O-N 3.47Å; F61-G65 PolarHBondContact O-N 3.31Å
62	L	60.2	Low	65.4	Low	99 Å²	99	94.5 Å²	94.5	52%	0.518	51%	0.513	S	S	.	.	H	α-helix	trans	-60.8	-34.5	173.1	-103.7	122.4	0	0	0	111.8	N59 L60 R66	N59-L62 WeakPolarHBondContact O-CB 3.31Å; N59-L62 PolarHBondContact O-N 3.22Å; L60-L62 VanDerWaalsContact C-N 3.28Å; L60-L62 PolarHBondContact O-N 3Å; L62-R66 WeakPolarHBondContact O-CB 3.45Å; L62-R66 VanDerWaalsContact O-CD 3.26Å; L62-R66 WeakPolarHBondContact O-CD 3.4Å; L62-R66 WeakPolarHBondContact O-CG 3.28Å; L62-R66 PolarHBondContact O-N 3.44Å
63	G	63.8	Low	65.8	Low	39 Å²	39	96.3 Å²	96.3	40%	0.402	52%	0.519	S	S	.	.	H	α-helix	trans	-72	-46.3	177.3	0	0	0	0	0	113	L60 F61 R66 M67	L60-G63 PolarHBondContact O-N 3.48Å; F61-G63 PolarHBondContact O-N 3.15Å; G63-R66 WeakPolarHBondContact O-CB 3.48Å; G63-R66 PolarHBondContact O-N 2.93Å; G63-M67 PolarHBondContact O-N 3.27Å
64	I	63.2	Low	66.5	Low	29 Å²	29	102.5 Å²	102.5	15%	0.149	54%	0.54	C	S	.	.	H	α-helix	trans	-69.6	-44.5	179.5	-65.9	174	0	0	0	110.7	E50 V51 L60 F61 R66 M67 Y68	E50-I64 HydrophobicContact CB-CD1 3.39Å; E50-I64 HydrophobicContact CG-CD1 3.73Å; V51-I64 HydrophobicContact CG2-CG2 3.9Å; L60-I64 PolarHBondContact O-N 2.93Å; F61-I64 PolarHBondContact O-N 3.47Å; I64-R66 PolarHBondContact O-N 2.92Å; I64-M67 WeakPolarHBondContact O-CB 3.29Å; I64-M67 PolarHBondContact O-N 2.95Å; I64-Y68 HydrophobicContact CG2-CD2 4.1Å; I64-Y68 HydrophobicContact CG2-CE2 4.14Å; I64-Y68 WeakPolarHBondContact O-CD2 3.42Å; I64-Y68 PolarHBondContact O-N 3.42Å
65	G	64.2	Low	67.5	Low	42 Å²	42	102 Å²	102	43%	0.433	53%	0.528	S	S	.	.	H	α-helix	trans	-57.1	-33.8	174.4	0	0	0	0	0	112.4	F61 Y68 I69	F61-G65 PolarHBondContact O-N 3.31Å; G65-Y68 CarbonylContact O-C 3.41Å; G65-Y68 PolarHBondContact O-N 3.35Å; G65-I69 VanDerWaalsContact O-CG1 3.26Å; G65-I69 WeakPolarHBondContact O-CG1 3.47Å; G65-I69 PolarHBondContact O-N 3.34Å; G65-I69 VanDerWaalsContact O-N 3.17Å
66	R	65.3	Low	68.7	Low	174 Å²	174	95.9 Å²	95.9	66%	0.657	50%	0.496	S	S	*	.	H	α-helix	trans	-66.7	-32.9	173.6	-79.9	169	-170.7	-134.2	3.4	114.1	L62 G63 I64 Y68 I69	L62-R66 WeakPolarHBondContact O-CB 3.45Å; L62-R66 VanDerWaalsContact O-CD 3.26Å; L62-R66 WeakPolarHBondContact O-CD 3.4Å; L62-R66 WeakPolarHBondContact O-CG 3.28Å; L62-R66 PolarHBondContact O-N 3.44Å; G63-R66 WeakPolarHBondContact O-CB 3.48Å; G63-R66 PolarHBondContact O-N 2.93Å; I64-R66 PolarHBondContact O-N 2.92Å; R66-Y68 VanDerWaalsContact C-N 3.25Å; R66-Y68 PolarHBondContact O-N 2.9Å; R66-I69 HydrophobicContact CB-CD1 4.44Å; R66-I69 HydrophobicContact CG-CD1 4.33Å; R66-I69 WeakPolarHBondContact O-CG1 3.32Å
67	M	69.9	Low	70.1	Confident	142 Å²	142	93.7 Å²	93.7	70%	0.7	48%	0.482	S	S	*	.	H	α-helix	trans	-71.3	-24	179.3	-71.9	-176.2	61.7	0	0	112.7	G63 I64	G63-M67 PolarHBondContact O-N 3.27Å; I64-M67 WeakPolarHBondContact O-CB 3.29Å; I64-M67 PolarHBondContact O-N 2.95Å
68	Y	70.1	Confident	71.7	Confident	49 Å²	49	91.3 Å²	91.3	19%	0.192	47%	0.467	C	S	.	.	T	Hydrogen-bonded Turn	trans	-123.6	27.2	-174.2	-57.9	-74.4	0	0	0	112.8	V51 I64 G65 R66 D70 T71 I76	V51-Y68 HydrophobicContact CG2-CE2 4.47Å; I64-Y68 HydrophobicContact CG2-CD2 4.1Å; I64-Y68 HydrophobicContact CG2-CE2 4.14Å; I64-Y68 WeakPolarHBondContact O-CD2 3.42Å; I64-Y68 PolarHBondContact O-N 3.42Å; G65-Y68 CarbonylContact O-C 3.41Å; G65-Y68 PolarHBondContact O-N 3.35Å; R66-Y68 VanDerWaalsContact C-N 3.25Å; R66-Y68 PolarHBondContact O-N 2.9Å; Y68-D70 PolarHBondContact O-N 3.03Å; Y68-T71 WeakPolarHBondContact O-CB 3.38Å; Y68-T71 PolarHBondContact O-N 3.22Å; Y68-T71 PolarHBondContact O-OG1 2.83Å; Y68-I76 HydrophobicContact CD1-CB 4.37Å; Y68-I76 HydrophobicContact CD1-CD1 4.1Å; Y68-I76 HydrophobicContact CD1-CG1 3.67Å; Y68-I76 HydrophobicContact CD1-CG2 3.98Å; Y68-I76 HydrophobicContact CD2-CD1 4.26Å; Y68-I76 HydrophobicContact CD2-CG2 4.19Å; Y68-I76 HydrophobicContact CE1-CG1 4.31Å; Y68-I76 HydrophobicContact CE1-CG2 3.85Å; Y68-I76 HydrophobicContact CE2-CG2 4.07Å; Y68-I76 HydrophobicContact CG-CD1 3.69Å; Y68-I76 HydrophobicContact CG-CG1 3.81Å; Y68-I76 HydrophobicContact CG-CG2 4.14Å
69	I	69.8	Low	73.2	Confident	107 Å²	107	93 Å²	93	55%	0.549	48%	0.475	S	S	.	.	T	Hydrogen-bonded Turn	trans	-52.4	135	172	-62	175.8	0	0	0	108	G65 R66 T71	G65-I69 VanDerWaalsContact O-CG1 3.26Å; G65-I69 WeakPolarHBondContact O-CG1 3.47Å; G65-I69 PolarHBondContact O-N 3.34Å; G65-I69 VanDerWaalsContact O-N 3.17Å; R66-I69 HydrophobicContact CB-CD1 4.44Å; R66-I69 HydrophobicContact CG-CD1 4.33Å; R66-I69 WeakPolarHBondContact O-CG1 3.32Å; I69-T71 PolarHBondContact O-N 2.97Å
70	D	74.1	Confident	74.6	Confident	167 Å²	167	86.4 Å²	86.4	89%	0.893	44%	0.44	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.4	7.5	-177.8	-53.8	-34	0	0	0	116.2	Y68	Y68-D70 PolarHBondContact O-N 3.03Å
71	T	77.8	Confident	76.2	Confident	51 Å²	51	83.5 Å²	83.5	31%	0.313	43%	0.425	S	S	.	.			trans	-94.4	131.1	174.3	-45.6	0	0	0	0	109.6	Y68 I69 E75 I76	Y68-T71 WeakPolarHBondContact O-CB 3.38Å; Y68-T71 PolarHBondContact O-N 3.22Å; Y68-T71 PolarHBondContact O-OG1 2.83Å; I69-T71 PolarHBondContact O-N 2.97Å; T71-E75 HydrophobicContact CG2-CB 3.97Å; T71-E75 HydrophobicContact CG2-CG 3.9Å; T71-I76 HydrophobicContact CG2-CG1 3.67Å
72	S	81.2	Confident	78	Confident	65 Å²	65	86 Å²	86	46%	0.455	44%	0.44	S	S	.	.			trans	-66.7	143.9	177.7	71.3	0	0	0	0	111.3	K74 E75 I76	S72-K74 PolarHBondContact O-N 3.17Å; S72-K74 VanDerWaalsContact O-N 3.14Å; S72-E75 WeakPolarHBondContact O-CB 3.46Å; S72-E75 PolarHBondContact O-N 3.32Å; S72-E75 VanDerWaalsContact OG-CB 3.3Å; S72-E75 WeakPolarHBondContact OG-CB 3.25Å; S72-E75 PolarHBondContact OG-N 3.07Å; S72-I76 WeakPolarHBondContact O-CG1 3.48Å; S72-I76 PolarHBondContact O-N 3.33Å
73	E	80.6	Confident	79.5	Confident	123 Å²	123	82.5 Å²	82.5	58%	0.575	43%	0.425	S	S	*	.	H	α-helix	trans	-49.1	-44	176.6	-176.8	-170.5	153.5	0	0	111.8	L52 E75 I76 C77	L52-E73 WeakPolarHBondContact CD2-OE1 3.42Å; E73-E75 VanDerWaalsContact C-N 3.31Å; E73-E75 PolarHBondContact O-N 3.43Å; E73-I76 PolarHBondContact O-N 3.11Å; E73-C77 WeakPolarHBondContact O-CB 3.5Å; E73-C77 PolarHBondContact O-N 3.04Å; E73-C77 PolarHBondContact O-SG 3.44Å
74	K	84.8	Confident	80.9	Confident	178 Å²	178	82.5 Å²	82.5	77%	0.774	42%	0.417	S	S	*	.	H	α-helix	trans	-59.6	-39.9	178.5	-173.5	177.3	-179.7	179.9	0	112.8	S72 R78	S72-K74 PolarHBondContact O-N 3.17Å; S72-K74 VanDerWaalsContact O-N 3.14Å; K74-R78 WeakPolarHBondContact O-CB 3.47Å; K74-R78 PolarHBondContact O-N 3.49Å
75	E	86.5	Confident	82.4	Confident	109 Å²	109	86.6 Å²	86.6	51%	0.509	44%	0.436	S	S	.	.	H	α-helix	trans	-71.8	-40.9	178.8	-176.7	168.8	-162	0	0	111.5	T71 S72 E73 C77 R78 V79	T71-E75 HydrophobicContact CG2-CB 3.97Å; T71-E75 HydrophobicContact CG2-CG 3.9Å; S72-E75 WeakPolarHBondContact O-CB 3.46Å; S72-E75 PolarHBondContact O-N 3.32Å; S72-E75 VanDerWaalsContact OG-CB 3.3Å; S72-E75 WeakPolarHBondContact OG-CB 3.25Å; S72-E75 PolarHBondContact OG-N 3.07Å; E73-E75 VanDerWaalsContact C-N 3.31Å; E73-E75 PolarHBondContact O-N 3.43Å; E75-C77 PolarHBondContact O-N 3.48Å; E75-R78 PolarHBondContact O-N 2.81Å; E75-V79 WeakPolarHBondContact O-CG2 3.41Å; E75-V79 PolarHBondContact O-N 2.83Å
76	I	84.1	Confident	83.8	Confident	14 Å²	14	89.7 Å²	89.7	7%	0.072	44%	0.442	C	S	.	.	H	α-helix	trans	-59.2	-48.9	172.9	-55.6	167.6	0	0	0	110	V51 Y68 T71 S72 E73 R78 V79 L80	V51-I76 HydrophobicContact CG1-CB 4.37Å; V51-I76 HydrophobicContact CG1-CD1 4.47Å; V51-I76 HydrophobicContact CG1-CG2 3.87Å; V51-I76 HydrophobicContact CG2-CG2 3.89Å; Y68-I76 HydrophobicContact CD1-CB 4.37Å; Y68-I76 HydrophobicContact CD1-CD1 4.1Å; Y68-I76 HydrophobicContact CD1-CG1 3.67Å; Y68-I76 HydrophobicContact CD1-CG2 3.98Å; Y68-I76 HydrophobicContact CD2-CD1 4.26Å; Y68-I76 HydrophobicContact CD2-CG2 4.19Å; Y68-I76 HydrophobicContact CE1-CG1 4.31Å; Y68-I76 HydrophobicContact CE1-CG2 3.85Å; Y68-I76 HydrophobicContact CE2-CG2 4.07Å; Y68-I76 HydrophobicContact CG-CD1 3.69Å; Y68-I76 HydrophobicContact CG-CG1 3.81Å; Y68-I76 HydrophobicContact CG-CG2 4.14Å; T71-I76 HydrophobicContact CG2-CG1 3.67Å; S72-I76 WeakPolarHBondContact O-CG1 3.48Å; S72-I76 PolarHBondContact O-N 3.33Å; E73-I76 PolarHBondContact O-N 3.11Å; I76-R78 VanDerWaalsContact C-N 3.31Å; I76-R78 PolarHBondContact O-N 3.38Å; I76-V79 PolarHBondContact O-N 3.41Å; I76-L80 HydrophobicContact CG2-CD1 4Å; I76-L80 HydrophobicContact CG2-CG 4.39Å; I76-L80 VanDerWaalsContact O-CG 3.31Å; I76-L80 WeakPolarHBondContact O-CG 3.3Å; I76-L80 PolarHBondContact O-N 3.4Å
77	C	86.2	Confident	85.1	Confident	19 Å²	19	81.4 Å²	81.4	13%	0.128	41%	0.411	C	S	.	.	H	α-helix	trans	-58.1	-44	177.8	-71.1	0	0	0	0	111.6	E73 E75 V79 L80 D81	E73-C77 WeakPolarHBondContact O-CB 3.5Å; E73-C77 PolarHBondContact O-N 3.04Å; E73-C77 PolarHBondContact O-SG 3.44Å; E75-C77 PolarHBondContact O-N 3.48Å; C77-V79 PolarHBondContact O-N 2.9Å; C77-L80 PolarHBondContact O-N 3.28Å; C77-D81 WeakPolarHBondContact O-CB 3.48Å; C77-D81 PolarHBondContact O-N 3.35Å
78	R	90.3	Very high	86.2	Confident	171 Å²	171	76.8 Å²	76.8	65%	0.645	39%	0.39	S	S	*	.	H	α-helix	trans	-60.2	-47.1	176.7	-175.5	-178.1	177	-178.1	2.1	112.2	K74 E75 I76 L80 D81 D82	K74-R78 WeakPolarHBondContact O-CB 3.47Å; K74-R78 PolarHBondContact O-N 3.49Å; E75-R78 PolarHBondContact O-N 2.81Å; I76-R78 VanDerWaalsContact C-N 3.31Å; I76-R78 PolarHBondContact O-N 3.38Å; R78-L80 VanDerWaalsContact C-N 3.28Å; R78-L80 PolarHBondContact O-N 3.41Å; R78-D81 PolarHBondContact O-N 3.49Å; R78-D82 WeakPolarHBondContact O-CB 3.3Å; R78-D82 VanDerWaalsContact O-CG 3.25Å; R78-D82 PolarHBondContact O-N 3.32Å
79	V	89.2	Confident	87.4	Confident	79 Å²	79	77.9 Å²	77.9	48%	0.479	40%	0.4	S	S	.	.	H	α-helix	trans	-61	-40.1	177.8	171.5	0	0	0	0	111.2	E75 I76 C77 A83	E75-V79 WeakPolarHBondContact O-CG2 3.41Å; E75-V79 PolarHBondContact O-N 2.83Å; I76-V79 PolarHBondContact O-N 3.41Å; C77-V79 PolarHBondContact O-N 2.9Å; V79-A83 VanDerWaalsContact O-CB 3.25Å; V79-A83 WeakPolarHBondContact O-CB 3.32Å; V79-A83 PolarHBondContact O-N 2.75Å
80	L	89.4	Confident	88.5	Confident	5 Å²	5	75 Å²	75	3%	0.026	39%	0.387	C	S	.	.	H	α-helix	trans	-68.3	-38.7	176.3	-68.1	175	0	0	0	112.2	L44 I47 R48 V51 I76 C77 R78 T84	L44-L80 HydrophobicContact CD2-CD2 4.03Å; I47-L80 HydrophobicContact CB-CD2 4.39Å; I47-L80 HydrophobicContact CG2-CD1 4.09Å; I47-L80 HydrophobicContact CG2-CD2 3.85Å; R48-L80 HydrophobicContact CB-CD1 4.19Å; V51-L80 HydrophobicContact CG2-CD1 4.33Å; I76-L80 HydrophobicContact CG2-CD1 4Å; I76-L80 HydrophobicContact CG2-CG 4.39Å; I76-L80 VanDerWaalsContact O-CG 3.31Å; I76-L80 WeakPolarHBondContact O-CG 3.3Å; I76-L80 PolarHBondContact O-N 3.4Å; C77-L80 PolarHBondContact O-N 3.28Å; R78-L80 VanDerWaalsContact C-N 3.28Å; R78-L80 PolarHBondContact O-N 3.41Å; L80-T84 VanDerWaalsContact O-CB 3.27Å; L80-T84 WeakPolarHBondContact O-CB 3.37Å; L80-T84 PolarHBondContact O-N 3.49Å; L80-T84 PolarHBondContact O-OG1 3.04Å
81	D	92.7	Very high	89.3	Confident	59 Å²	59	67.7 Å²	67.7	32%	0.316	35%	0.348	S	S	.	.	H	α-helix	trans	-63	-52.5	176	-75.2	-31.7	0	0	0	110.5	R48 C77 R78 A83 T84 E85	R48-D81 IonicContact CZ-OD1 3.04Å; R48-D81 IonicContact NH1-OD1 2.6Å; R48-D81 PolarHBondContact NH1-OD1 2.99Å; R48-D81 IonicContact NH2-OD1 2.83Å; R48-D81 PolarHBondContact NH2-OD1 3.11Å; R48-D81 IonicContact NH2-OD2 3.48Å; R48-D81 PolarHBondContact NH2-OD2 3.35Å; C77-D81 WeakPolarHBondContact O-CB 3.48Å; C77-D81 PolarHBondContact O-N 3.35Å; R78-D81 PolarHBondContact O-N 3.49Å; D81-A83 VanDerWaalsContact C-N 3.29Å; D81-A83 PolarHBondContact O-N 3.06Å; D81-T84 WeakPolarHBondContact O-CB 3.29Å; D81-T84 PolarHBondContact O-N 2.9Å; D81-E85 WeakPolarHBondContact O-CB 3.47Å; D81-E85 PolarHBondContact O-N 3.18Å
82	D	94.8	Very high	90.1	Very high	86 Å²	86	70.8 Å²	70.8	46%	0.46	36%	0.359	S	S	.	.	H	α-helix	trans	-57.6	-42.7	177.8	-66.5	-13.4	0	0	0	111.1	R78 T84 L86	R78-D82 WeakPolarHBondContact O-CB 3.3Å; R78-D82 VanDerWaalsContact O-CG 3.25Å; R78-D82 PolarHBondContact O-N 3.32Å; D82-T84 VanDerWaalsContact C-N 3.35Å; D82-T84 PolarHBondContact O-N 2.9Å; D82-L86 WeakPolarHBondContact O-CB 3.36Å; D82-L86 PolarHBondContact O-N 2.78Å
83	A	92.5	Very high	90.6	Very high	25 Å²	25	73.1 Å²	73.1	21%	0.207	37%	0.366	C	S	.	.	H	α-helix	trans	-67.4	-34.8	177.5	0	0	0	0	0	113	L44 V79 D81 A87	L44-A83 HydrophobicContact CD1-CB 4.09Å; L44-A83 HydrophobicContact CD2-CB 4.11Å; V79-A83 VanDerWaalsContact O-CB 3.25Å; V79-A83 WeakPolarHBondContact O-CB 3.32Å; V79-A83 PolarHBondContact O-N 2.75Å; D81-A83 VanDerWaalsContact C-N 3.29Å; D81-A83 PolarHBondContact O-N 3.06Å; A83-A87 WeakPolarHBondContact O-CB 3.5Å; A83-A87 PolarHBondContact O-N 3.35Å; A83-A87 VanDerWaalsContact O-N 3.15Å
84	T	92.9	Very high	91.1	Very high	38 Å²	38	68.5 Å²	68.5	23%	0.233	35%	0.345	C	S	.	.	H	α-helix	trans	-72.3	-45.2	178.4	-60.5	0	0	0	0	110.3	L41 L80 D81 D82 A87 T88	L41-T84 HydrophobicContact CD2-CG2 3.96Å; L80-T84 VanDerWaalsContact O-CB 3.27Å; L80-T84 WeakPolarHBondContact O-CB 3.37Å; L80-T84 PolarHBondContact O-N 3.49Å; L80-T84 PolarHBondContact O-OG1 3.04Å; D81-T84 WeakPolarHBondContact O-CB 3.29Å; D81-T84 PolarHBondContact O-N 2.9Å; D82-T84 VanDerWaalsContact C-N 3.35Å; D82-T84 PolarHBondContact O-N 2.9Å; T84-A87 PolarHBondContact O-N 2.87Å; T84-T88 WeakPolarHBondContact O-CB 3.37Å; T84-T88 PolarHBondContact O-N 3.47Å; T84-T88 PolarHBondContact O-OG1 2.93Å
85	E	94.6	Very high	91.3	Very high	116 Å²	116	64.1 Å²	64.1	54%	0.542	33%	0.326	S	S	.	.	H	α-helix	trans	-59.4	-50.1	176.6	-174.6	-178.8	166.1	0	0	110.7	D81 A87 T88 N89	D81-E85 WeakPolarHBondContact O-CB 3.47Å; D81-E85 PolarHBondContact O-N 3.18Å; E85-A87 VanDerWaalsContact C-N 3.32Å; E85-A87 PolarHBondContact O-N 3.19Å; E85-T88 PolarHBondContact O-N 2.95Å; E85-T88 VanDerWaalsContact O-N 3.16Å; E85-N89 WeakPolarHBondContact O-CB 3.41Å; E85-N89 VanDerWaalsContact O-CG 3.31Å; E85-N89 PolarHBondContact O-N 3.35Å; E85-N89 PolarHBondContact O-ND2 3.05Å
86	L	93.7	Very high	91.5	Very high	106 Å²	106	62.8 Å²	62.8	56%	0.555	33%	0.325	S	S	*	.	H	α-helix	trans	-58.7	-43.2	178.2	-179.2	63.9	0	0	0	112.4	D82 T90	D82-L86 WeakPolarHBondContact O-CB 3.36Å; D82-L86 PolarHBondContact O-N 2.78Å; L86-T90 WeakPolarHBondContact O-CB 3.37Å; L86-T90 PolarHBondContact O-N 3.38Å; L86-T90 PolarHBondContact O-OG1 2.96Å
87	A	92.5	Very high	91.7	Very high	0 Å²	0	70.7 Å²	70.7	0%	0	35%	0.354	C	S	.	.	H	α-helix	trans	-66.5	-39.3	178.2	0	0	0	0	0	112	K40 L41 A83 T84 E85 T90 L91	K40-A87 HydrophobicContact CD-CB 4.2Å; L41-A87 HydrophobicContact CD2-CB 3.69Å; L41-A87 HydrophobicContact CG-CB 4.05Å; A83-A87 WeakPolarHBondContact O-CB 3.5Å; A83-A87 PolarHBondContact O-N 3.35Å; A83-A87 VanDerWaalsContact O-N 3.15Å; T84-A87 PolarHBondContact O-N 2.87Å; E85-A87 VanDerWaalsContact C-N 3.32Å; E85-A87 PolarHBondContact O-N 3.19Å; A87-T90 PolarHBondContact O-N 3.19Å; A87-L91 WeakPolarHBondContact O-CB 3.42Å; A87-L91 PolarHBondContact O-N 3.48Å
88	T	93.4	Very high	91.7	Very high	45 Å²	45	71.5 Å²	71.5	28%	0.276	36%	0.357	S	S	.	.	H	α-helix	trans	-66.8	-49	178.8	-51.8	0	0	0	0	110.9	T84 E85 T90 L91 E92	T84-T88 WeakPolarHBondContact O-CB 3.37Å; T84-T88 PolarHBondContact O-N 3.47Å; T84-T88 PolarHBondContact O-OG1 2.93Å; E85-T88 PolarHBondContact O-N 2.95Å; E85-T88 VanDerWaalsContact O-N 3.16Å; T88-T90 VanDerWaalsContact C-N 3.28Å; T88-T90 PolarHBondContact O-N 3.02Å; T88-L91 WeakPolarHBondContact O-CB 3.39Å; T88-L91 PolarHBondContact O-N 2.93Å; T88-L91 VanDerWaalsContact O-N 3.08Å; T88-E92 WeakPolarHBondContact O-CG 3.31Å; T88-E92 PolarHBondContact O-N 3.31Å
89	N	94.4	Very high	91.5	Very high	72 Å²	72	67.3 Å²	67.3	39%	0.385	35%	0.35	S	S	.	.	H	α-helix	trans	-58.4	-41.9	176.4	-69.1	-17.7	0	0	0	111.6	E85 E92 L93	E85-N89 WeakPolarHBondContact O-CB 3.41Å; E85-N89 VanDerWaalsContact O-CG 3.31Å; E85-N89 PolarHBondContact O-N 3.35Å; E85-N89 PolarHBondContact O-ND2 3.05Å; N89-E92 PolarHBondContact O-N 3.07Å; N89-L93 WeakPolarHBondContact O-CB 3.47Å; N89-L93 VanDerWaalsContact O-CG 3.3Å; N89-L93 WeakPolarHBondContact O-CG 3.39Å; N89-L93 PolarHBondContact O-N 3.48Å
90	T	92.7	Very high	91.3	Very high	47 Å²	47	68 Å²	68	29%	0.288	35%	0.352	S	S	.	.	H	α-helix	trans	-63.9	-42.6	176.4	-56.7	0	0	0	0	111.6	Q37 L86 A87 T88 L94	Q37-T90 HydrophobicContact CG-CG2 4.28Å; L86-T90 WeakPolarHBondContact O-CB 3.37Å; L86-T90 PolarHBondContact O-N 3.38Å; L86-T90 PolarHBondContact O-OG1 2.96Å; A87-T90 PolarHBondContact O-N 3.19Å; T88-T90 VanDerWaalsContact C-N 3.28Å; T88-T90 PolarHBondContact O-N 3.02Å; T90-L94 HydrophobicContact CG2-CD1 4.19Å; T90-L94 VanDerWaalsContact O-CG 3.3Å; T90-L94 WeakPolarHBondContact O-CG 3.5Å; T90-L94 PolarHBondContact O-N 3.5Å
91	L	91.9	Very high	91	Very high	14 Å²	14	70.3 Å²	70.3	7%	0.073	37%	0.365	C	S	.	.	H	α-helix	trans	-63.6	-44.3	178.6	-179.9	62.8	0	0	0	111.7	I34 Q37 E38 L41 A87 T88 L94 K95	I34-L91 HydrophobicContact CB-CD1 4.24Å; I34-L91 HydrophobicContact CG1-CD1 4.27Å; I34-L91 HydrophobicContact CG2-CD1 3.8Å; Q37-L91 HydrophobicContact CB-CB 4.34Å; Q37-L91 HydrophobicContact CB-CD1 4.24Å; E38-L91 HydrophobicContact CG-CD1 3.92Å; E38-L91 HydrophobicContact CG-CD2 3.86Å; L41-L91 HydrophobicContact CD1-CD2 3.72Å; A87-L91 WeakPolarHBondContact O-CB 3.42Å; A87-L91 PolarHBondContact O-N 3.48Å; T88-L91 WeakPolarHBondContact O-CB 3.39Å; T88-L91 PolarHBondContact O-N 2.93Å; T88-L91 VanDerWaalsContact O-N 3.08Å; L91-L94 PolarHBondContact O-N 3.28Å; L91-K95 HydrophobicContact CD1-CD 4.35Å; L91-K95 HydrophobicContact CD1-CG 4.5Å; L91-K95 HydrophobicContact CG-CD 4.23Å; L91-K95 WeakPolarHBondContact O-CB 3.48Å; L91-K95 WeakPolarHBondContact O-CG 3.4Å; L91-K95 PolarHBondContact O-N 3.44Å
92	E	93.1	Very high	90.5	Very high	115 Å²	115	70.9 Å²	70.9	54%	0.537	37%	0.371	S	S	.	.	H	α-helix	trans	-62.8	-46.7	177.9	-71.9	-176.4	170.5	0	0	111.7	T88 N89 L94 K95 V96	T88-E92 WeakPolarHBondContact O-CG 3.31Å; T88-E92 PolarHBondContact O-N 3.31Å; N89-E92 PolarHBondContact O-N 3.07Å; E92-L94 VanDerWaalsContact C-N 3.3Å; E92-L94 PolarHBondContact O-N 3.26Å; E92-K95 PolarHBondContact O-N 3.24Å; E92-V96 WeakPolarHBondContact O-CG2 3.46Å; E92-V96 PolarHBondContact O-N 2.96Å
93	L	91.9	Very high	90	Very high	114 Å²	114	70.3 Å²	70.3	60%	0.597	37%	0.373	S	S	*	.	H	α-helix	trans	-58.4	-41.9	176.1	-74.4	169.7	0	0	0	112.2	N89 R97	N89-L93 WeakPolarHBondContact O-CB 3.47Å; N89-L93 VanDerWaalsContact O-CG 3.3Å; N89-L93 WeakPolarHBondContact O-CG 3.39Å; N89-L93 PolarHBondContact O-N 3.48Å; L93-R97 VanDerWaalsContact O-CG 3.32Å; L93-R97 WeakPolarHBondContact O-CG 3.37Å; L93-R97 PolarHBondContact O-N 3.34Å
94	L	91	Very high	89.5	Confident	26 Å²	26	71.7 Å²	71.7	14%	0.136	38%	0.38	C	S	.	.	H	α-helix	trans	-66.3	-42.2	176.6	-72.2	172.6	0	0	0	111.9	L33 I34 T90 L91 E92 R97 L98	L33-L94 HydrophobicContact CB-CD1 3.8Å; I34-L94 HydrophobicContact CD1-CB 4.19Å; I34-L94 HydrophobicContact CG1-CB 3.74Å; I34-L94 HydrophobicContact CG1-CD1 4.25Å; T90-L94 HydrophobicContact CG2-CD1 4.19Å; T90-L94 VanDerWaalsContact O-CG 3.3Å; T90-L94 WeakPolarHBondContact O-CG 3.5Å; T90-L94 PolarHBondContact O-N 3.5Å; L91-L94 PolarHBondContact O-N 3.28Å; E92-L94 VanDerWaalsContact C-N 3.3Å; E92-L94 PolarHBondContact O-N 3.26Å; L94-R97 PolarHBondContact O-N 3.33Å; L94-L98 WeakPolarHBondContact O-CB 3.35Å; L94-L98 PolarHBondContact O-N 2.88Å
95	K	90.8	Very high	89.1	Confident	87 Å²	87	74 Å²	74	38%	0.378	39%	0.391	S	S	.	.	H	α-helix	trans	-62.1	-45.8	176.9	-76.9	179.5	176.7	176.5	0	111.5	I34 E38 L91 E92 R97 L98 T99	I34-K95 HydrophobicContact CD1-CG 4.3Å; E38-K95 WeakPolarHBondContact OE1-CE 3.49Å; E38-K95 IonicContact OE1-NZ 2.88Å; E38-K95 PolarHBondContact OE1-NZ 2.87Å; L91-K95 HydrophobicContact CD1-CD 4.35Å; L91-K95 HydrophobicContact CD1-CG 4.5Å; L91-K95 HydrophobicContact CG-CD 4.23Å; L91-K95 WeakPolarHBondContact O-CB 3.48Å; L91-K95 WeakPolarHBondContact O-CG 3.4Å; L91-K95 PolarHBondContact O-N 3.44Å; E92-K95 PolarHBondContact O-N 3.24Å; K95-R97 VanDerWaalsContact C-N 3.33Å; K95-R97 PolarHBondContact O-N 3.15Å; K95-L98 PolarHBondContact O-N 2.89Å; K95-T99 WeakPolarHBondContact O-CG2 3.33Å; K95-T99 PolarHBondContact O-N 3.16Å; K95-T99 PolarHBondContact O-OG1 2.98Å
96	V	90.2	Very high	88.6	Confident	81 Å²	81	72.8 Å²	72.8	49%	0.491	39%	0.391	S	S	.	.	H	α-helix	trans	-60.4	-42.6	176.3	171.9	0	0	0	0	111.5	E92 L98 T99 N100	E92-V96 WeakPolarHBondContact O-CG2 3.46Å; E92-V96 PolarHBondContact O-N 2.96Å; V96-L98 PolarHBondContact O-N 3.08Å; V96-T99 VanDerWaalsContact CA-OG1 3.32Å; V96-T99 WeakPolarHBondContact CA-OG1 3.38Å; V96-T99 PolarHBondContact O-N 3.46Å; V96-T99 PolarHBondContact O-OG1 3.49Å; V96-N100 PolarHBondContact O-N 2.92Å; V96-N100 PolarHBondContact O-ND2 2.93Å; V96-N100 PolarHBondContact O-OD1 3.02Å
97	R	86.9	Confident	88.2	Confident	179 Å²	179	70.5 Å²	70.5	68%	0.675	38%	0.378	S	S	*	.	H	α-helix	trans	-62.3	-43.5	175.9	-75.6	178	175.9	-165.6	-0.1	111.7	L93 L94 K95 N100 V101	L93-R97 VanDerWaalsContact O-CG 3.32Å; L93-R97 WeakPolarHBondContact O-CG 3.37Å; L93-R97 PolarHBondContact O-N 3.34Å; L94-R97 PolarHBondContact O-N 3.33Å; K95-R97 VanDerWaalsContact C-N 3.33Å; K95-R97 PolarHBondContact O-N 3.15Å; R97-N100 PolarHBondContact O-N 2.9Å; R97-V101 WeakPolarHBondContact O-CG2 3.49Å; R97-V101 PolarHBondContact O-N 3.46Å; R97-V101 VanDerWaalsContact O-N 3.11Å
98	L	86.6	Confident	87.9	Confident	36 Å²	36	76.3 Å²	76.3	19%	0.188	40%	0.403	C	S	.	.	H	α-helix	trans	-66.7	-40.7	179.1	-170.5	69.4	0	0	0	112.1	V27 D31 I34 L94 K95 V96 N100 V101 T102	V27-L98 HydrophobicContact CG1-CD1 3.94Å; D31-L98 VanDerWaalsContact OD1-CD2 3.25Å; D31-L98 WeakPolarHBondContact OD1-CD2 3.41Å; I34-L98 HydrophobicContact CD1-CD2 3.89Å; L94-L98 WeakPolarHBondContact O-CB 3.35Å; L94-L98 PolarHBondContact O-N 2.88Å; K95-L98 PolarHBondContact O-N 2.89Å; V96-L98 PolarHBondContact O-N 3.08Å; L98-N100 VanDerWaalsContact C-N 3.33Å; L98-N100 PolarHBondContact O-N 3.15Å; L98-V101 PolarHBondContact O-N 3.33Å; L98-T102 WeakPolarHBondContact O-CB 3.37Å; L98-T102 PolarHBondContact O-N 3.48Å; L98-T102 PolarHBondContact O-OG1 2.85Å
99	T	86.4	Confident	87.5	Confident	83 Å²	83	76.8 Å²	76.8	51%	0.509	41%	0.408	S	S	.	.	H	α-helix	trans	-63.5	-40	176.3	50.8	0	0	0	0	111.5	K95 V96 T102 C103	K95-T99 WeakPolarHBondContact O-CG2 3.33Å; K95-T99 PolarHBondContact O-N 3.16Å; K95-T99 PolarHBondContact O-OG1 2.98Å; V96-T99 VanDerWaalsContact CA-OG1 3.32Å; V96-T99 WeakPolarHBondContact CA-OG1 3.38Å; V96-T99 PolarHBondContact O-N 3.46Å; V96-T99 PolarHBondContact O-OG1 3.49Å; T99-T102 PolarHBondContact O-N 3.47Å; T99-C103 VanDerWaalsContact O-CB 3.28Å; T99-C103 WeakPolarHBondContact O-CB 3.49Å; T99-C103 PolarHBondContact O-N 3.41Å
100	N	84.7	Confident	87	Confident	95 Å²	95	78.7 Å²	78.7	51%	0.508	41%	0.411	S	S	.	.	H	α-helix	trans	-62.9	-47.5	176.7	-70.2	-12.3	0	0	0	111.3	V96 R97 L98 T102 C103 C104	V96-N100 PolarHBondContact O-N 2.92Å; V96-N100 PolarHBondContact O-ND2 2.93Å; V96-N100 PolarHBondContact O-OD1 3.02Å; R97-N100 PolarHBondContact O-N 2.9Å; L98-N100 VanDerWaalsContact C-N 3.33Å; L98-N100 PolarHBondContact O-N 3.15Å; N100-T102 VanDerWaalsContact C-N 3.33Å; N100-T102 PolarHBondContact O-N 2.9Å; N100-C103 PolarHBondContact O-N 3.09Å; N100-C104 PolarHBondContact O-N 3.42Å; N100-C104 PolarHBondContact O-SG 3.3Å
101	V	83.7	Confident	86.6	Confident	52 Å²	52	76.8 Å²	76.8	32%	0.315	40%	0.399	S	S	.	.	H	α-helix	trans	-60.3	-44.4	176.5	173	0	0	0	0	111.1	T23 V27 R97 L98 C104 I105	T23-V101 HydrophobicContact CG2-CG1 4.46Å; V27-V101 HydrophobicContact CG2-CG1 3.86Å; R97-V101 WeakPolarHBondContact O-CG2 3.49Å; R97-V101 PolarHBondContact O-N 3.46Å; R97-V101 VanDerWaalsContact O-N 3.11Å; L98-V101 PolarHBondContact O-N 3.33Å; V101-C104 PolarHBondContact O-N 2.96Å; V101-I105 HydrophobicContact CG1-CD1 3.94Å; V101-I105 VanDerWaalsContact O-CG1 3.31Å; V101-I105 WeakPolarHBondContact O-CG1 3.25Å; V101-I105 PolarHBondContact O-N 2.96Å
102	T	83.2	Confident	86.4	Confident	71 Å²	71	82.4 Å²	82.4	44%	0.436	42%	0.423	S	S	.	.	H	α-helix	trans	-64.3	-43.1	179.6	-55.4	0	0	0	0	111.4	L98 T99 N100 C104 I105 V106	L98-T102 WeakPolarHBondContact O-CB 3.37Å; L98-T102 PolarHBondContact O-N 3.48Å; L98-T102 PolarHBondContact O-OG1 2.85Å; T99-T102 PolarHBondContact O-N 3.47Å; N100-T102 VanDerWaalsContact C-N 3.33Å; N100-T102 PolarHBondContact O-N 2.9Å; T102-C104 PolarHBondContact O-N 2.88Å; T102-I105 PolarHBondContact O-N 2.67Å; T102-V106 WeakPolarHBondContact O-CG2 3.48Å; T102-V106 PolarHBondContact O-N 2.71Å
103	C	83.1	Confident	86	Confident	75 Å²	75	84.2 Å²	84.2	51%	0.507	43%	0.425	S	S	.	.	H	α-helix	trans	-58.1	-48.1	175.1	-173.6	0	0	0	0	111.1	T99 N100 I105 V106 M107	T99-C103 VanDerWaalsContact O-CB 3.28Å; T99-C103 WeakPolarHBondContact O-CB 3.49Å; T99-C103 PolarHBondContact O-N 3.41Å; N100-C103 PolarHBondContact O-N 3.09Å; C103-I105 VanDerWaalsContact C-N 3.31Å; C103-I105 PolarHBondContact O-N 2.92Å; C103-V106 PolarHBondContact O-N 3.04Å; C103-M107 WeakPolarHBondContact O-CB 3.44Å; C103-M107 PolarHBondContact O-N 2.97Å
104	C	82.2	Confident	85.5	Confident	53 Å²	53	80.5 Å²	80.5	36%	0.358	41%	0.406	S	S	.	.	H	α-helix	trans	-58.7	-40.9	175.9	-65.7	0	0	0	0	112	N100 V101 T102 M107 K108	N100-C104 PolarHBondContact O-N 3.42Å; N100-C104 PolarHBondContact O-SG 3.3Å; V101-C104 PolarHBondContact O-N 2.96Å; T102-C104 PolarHBondContact O-N 2.88Å; C104-M107 PolarHBondContact O-N 3.03Å; C104-K108 WeakPolarHBondContact O-CB 3.4Å; C104-K108 VanDerWaalsContact O-CG 3.31Å; C104-K108 WeakPolarHBondContact O-CG 3.43Å; C104-K108 PolarHBondContact O-N 3.5Å
105	I	83.8	Confident	85.2	Confident	88 Å²	88	84.7 Å²	84.7	45%	0.451	42%	0.42	S	S	.	.	H	α-helix	trans	-64	-45.3	177.9	-68.1	164.9	0	0	0	111.3	V101 T102 C103 M107 S109	V101-I105 HydrophobicContact CG1-CD1 3.94Å; V101-I105 VanDerWaalsContact O-CG1 3.31Å; V101-I105 WeakPolarHBondContact O-CG1 3.25Å; V101-I105 PolarHBondContact O-N 2.96Å; T102-I105 PolarHBondContact O-N 2.67Å; C103-I105 VanDerWaalsContact C-N 3.31Å; C103-I105 PolarHBondContact O-N 2.92Å; I105-M107 VanDerWaalsContact C-N 3.34Å; I105-S109 WeakPolarHBondContact O-CB 3.4Å; I105-S109 PolarHBondContact O-N 2.88Å; I105-S109 PolarHBondContact O-OG 2.83Å
106	V	83.9	Confident	84.9	Confident	89 Å²	89	86.6 Å²	86.6	54%	0.539	43%	0.428	S	S	.	.	H	α-helix	trans	-62.7	-44.4	177.9	173.1	0	0	0	0	110.2	T102 C103 S109 Y110	T102-V106 WeakPolarHBondContact O-CG2 3.48Å; T102-V106 PolarHBondContact O-N 2.71Å; C103-V106 PolarHBondContact O-N 3.04Å; V106-S109 CarbonylContact O-C 3.58Å; V106-S109 WeakPolarHBondContact O-CB 3.31Å; V106-S109 PolarHBondContact O-N 3.2Å; V106-Y110 WeakPolarHBondContact O-CB 3.27Å; V106-Y110 PolarHBondContact O-N 2.8Å
107	M	85.4	Confident	84.5	Confident	59 Å²	59	85.8 Å²	85.8	29%	0.291	43%	0.426	S	S	.	.	H	α-helix	trans	-67.8	-42.1	-179	-152.7	158	176.2	0	0	111.9	C103 C104 I105 S109 Y110 V111 L140 V144	C103-M107 WeakPolarHBondContact O-CB 3.44Å; C103-M107 PolarHBondContact O-N 2.97Å; C104-M107 PolarHBondContact O-N 3.03Å; I105-M107 VanDerWaalsContact C-N 3.34Å; M107-S109 VanDerWaalsContact C-N 3.26Å; M107-S109 PolarHBondContact O-N 3.48Å; M107-Y110 WeakPolarHBondContact O-CB 3.38Å; M107-Y110 PolarHBondContact O-N 2.93Å; M107-V111 WeakPolarHBondContact O-CG2 3.42Å; M107-V111 PolarHBondContact O-N 3.21Å; M107-L140 HydrophobicContact CE-CD2 3.3Å; M107-V144 HydrophobicContact CB-CG2 3.74Å; M107-V144 HydrophobicContact CE-CG2 4.3Å; M107-V144 HydrophobicContact CG-CG2 3.49Å; M107-V144 VanDerWaalsContact CG-CG2 3.49Å; M107-V144 HydrophobicContact SD-CG2 3.72Å
108	K	86.1	Confident	84.2	Confident	121 Å²	121	77.8 Å²	77.8	53%	0.526	40%	0.396	S	S	.	.	H	α-helix	trans	-56.4	-42.1	170.2	-74.3	-175.3	-178.6	175.1	0	111.7	C104 K112 V144	C104-K108 WeakPolarHBondContact O-CB 3.4Å; C104-K108 VanDerWaalsContact O-CG 3.31Å; C104-K108 WeakPolarHBondContact O-CG 3.43Å; C104-K108 PolarHBondContact O-N 3.5Å; K108-K112 VanDerWaalsContact O-CB 3.23Å; K108-K112 WeakPolarHBondContact O-CB 3.46Å; K108-K112 PolarHBondContact O-N 3.08Å; K108-V144 HydrophobicContact CB-CG1 4.31Å; K108-V144 HydrophobicContact CD-CG1 3.9Å; K108-V144 VanDerWaalsContact CE-O 3.24Å; K108-V144 WeakPolarHBondContact CE-O 3.31Å; K108-V144 HydrophobicContact CG-CG1 3.14Å; K108-V144 PolarHBondContact NZ-O 2.92Å
109	S	85	Confident	84	Confident	55 Å²	55	81.8 Å²	81.8	39%	0.385	41%	0.414	S	S	.	.	H	α-helix	trans	-70.3	-34.4	179.9	-58.5	0	0	0	0	112.5	I105 V106 M107 R113	I105-S109 WeakPolarHBondContact O-CB 3.4Å; I105-S109 PolarHBondContact O-N 2.88Å; I105-S109 PolarHBondContact O-OG 2.83Å; V106-S109 CarbonylContact O-C 3.58Å; V106-S109 WeakPolarHBondContact O-CB 3.31Å; V106-S109 PolarHBondContact O-N 3.2Å; M107-S109 VanDerWaalsContact C-N 3.26Å; M107-S109 PolarHBondContact O-N 3.48Å; S109-R113 WeakPolarHBondContact O-CB 3.37Å; S109-R113 WeakPolarHBondContact O-CG 3.3Å; S109-R113 PolarHBondContact O-N 2.83Å; S109-R113 VanDerWaalsContact O-N 3.16Å; S109-R113 PolarHBondContact O-NE 2.6Å
110	Y	84	Confident	83.8	Confident	112 Å²	112	81.1 Å²	81.1	44%	0.439	42%	0.417	S	S	.	.	H	α-helix	trans	-66.9	-52	173.6	178.2	-101	0	0	0	111.3	V106 M107 K112 R113 N114 L140	V106-Y110 WeakPolarHBondContact O-CB 3.27Å; V106-Y110 PolarHBondContact O-N 2.8Å; M107-Y110 WeakPolarHBondContact O-CB 3.38Å; M107-Y110 PolarHBondContact O-N 2.93Å; Y110-K112 VanDerWaalsContact C-N 3.34Å; Y110-K112 PolarHBondContact O-N 3.37Å; Y110-R113 WeakPolarHBondContact O-CB 3.48Å; Y110-R113 PolarHBondContact O-N 3.04Å; Y110-R113 VanDerWaalsContact O-N 3.09Å; Y110-N114 WeakPolarHBondContact CE1-ND2 3.5Å; Y110-N114 PolarHBondContact O-N 3.47Å; Y110-N114 PolarHBondContact OH-ND2 3.39Å; Y110-N114 VanDerWaalsContact OH-ND2 3.15Å; Y110-L140 HydrophobicContact CE1-CD1 4.4Å
111	V	85.7	Confident	83.6	Confident	8 Å²	8	80.2 Å²	80.2	5%	0.048	41%	0.412	C	S	.	.	H	α-helix	trans	-59.4	-44.8	178.5	174	0	0	0	0	111.3	M107 R113 N114 R115 I137 L140 E141	M107-V111 WeakPolarHBondContact O-CG2 3.42Å; M107-V111 PolarHBondContact O-N 3.21Å; V111-R113 VanDerWaalsContact C-N 3.3Å; V111-R113 PolarHBondContact O-N 3.08Å; V111-N114 PolarHBondContact O-N 3.41Å; V111-R115 WeakPolarHBondContact O-CB 3.47Å; V111-R115 PolarHBondContact O-N 3.25Å; V111-I137 HydrophobicContact CG1-CG2 4.13Å; V111-L140 HydrophobicContact CG2-CB 3.66Å; V111-L140 HydrophobicContact CG2-CD1 4.36Å; V111-E141 HydrophobicContact CG1-CG 3.58Å; V111-E141 WeakPolarHBondContact CG1-OE1 3.49Å
112	K	86.5	Confident	83.3	Confident	132 Å²	132	81.6 Å²	81.6	57%	0.574	42%	0.415	S	S	*	.	H	α-helix	trans	-59.7	-38.9	176.1	-175	174.7	-176.5	174.9	0	112.6	K108 Y110 K116	K108-K112 VanDerWaalsContact O-CB 3.23Å; K108-K112 WeakPolarHBondContact O-CB 3.46Å; K108-K112 PolarHBondContact O-N 3.08Å; Y110-K112 VanDerWaalsContact C-N 3.34Å; Y110-K112 PolarHBondContact O-N 3.37Å; K112-K116 WeakPolarHBondContact O-CG 3.3Å; K112-K116 PolarHBondContact O-N 3.49Å
113	R	85.8	Confident	83.2	Confident	152 Å²	152	86.5 Å²	86.5	57%	0.574	43%	0.43	S	S	*	.	H	α-helix	trans	-67.5	-49.1	175.8	-81.6	-177.3	-73.7	163.3	-5.1	111.2	S109 Y110 V111 R115 K116 S117	S109-R113 WeakPolarHBondContact O-CB 3.37Å; S109-R113 WeakPolarHBondContact O-CG 3.3Å; S109-R113 PolarHBondContact O-N 2.83Å; S109-R113 VanDerWaalsContact O-N 3.16Å; S109-R113 PolarHBondContact O-NE 2.6Å; Y110-R113 WeakPolarHBondContact O-CB 3.48Å; Y110-R113 PolarHBondContact O-N 3.04Å; Y110-R113 VanDerWaalsContact O-N 3.09Å; V111-R113 VanDerWaalsContact C-N 3.3Å; V111-R113 PolarHBondContact O-N 3.08Å; R113-R115 VanDerWaalsContact C-N 3.31Å; R113-R115 PolarHBondContact O-N 2.95Å; R113-K116 PolarHBondContact O-N 3.38Å; R113-K116 VanDerWaalsContact O-N 3.13Å; R113-S117 PolarHBondContact O-N 3.3Å; R113-S117 PolarHBondContact O-OG 3.48Å
114	N	81	Confident	83	Confident	37 Å²	37	89.8 Å²	89.8	20%	0.198	44%	0.437	C	S	.	.	H	α-helix	trans	-59	-42.2	178.2	-79.4	-7.4	0	0	0	112.4	Y110 V111 K116 S117 F118 F133 I137	Y110-N114 WeakPolarHBondContact CE1-ND2 3.5Å; Y110-N114 PolarHBondContact O-N 3.47Å; Y110-N114 PolarHBondContact OH-ND2 3.39Å; Y110-N114 VanDerWaalsContact OH-ND2 3.15Å; V111-N114 PolarHBondContact O-N 3.41Å; N114-K116 PolarHBondContact O-N 2.92Å; N114-S117 PolarHBondContact O-N 2.93Å; N114-F118 WeakPolarHBondContact O-CB 3.39Å; N114-F118 PolarHBondContact O-N 3.35Å; N114-F133 HydrophobicContact CB-CZ 4.13Å; N114-I137 HydrophobicContact CB-CD1 4.24Å
115	R	84	Confident	82.5	Confident	113 Å²	113	90.6 Å²	90.6	43%	0.426	43%	0.434	S	S	.	.	H	α-helix	trans	-59.3	-45.1	175.3	-173.5	-175.4	-81.4	-152.7	-13.6	111.7	V111 R113 F118 Q119 I137 E141	V111-R115 WeakPolarHBondContact O-CB 3.47Å; V111-R115 PolarHBondContact O-N 3.25Å; R113-R115 VanDerWaalsContact C-N 3.31Å; R113-R115 PolarHBondContact O-N 2.95Å; R115-F118 PolarHBondContact O-N 3.14Å; R115-Q119 WeakPolarHBondContact O-CG 3.26Å; R115-Q119 PolarHBondContact O-N 3.25Å; R115-I137 HydrophobicContact CB-CD1 4.2Å; R115-E141 IonicContact CZ-OE1 3.11Å; R115-E141 IonicContact CZ-OE2 3.86Å; R115-E141 IonicContact NE-OE1 3.18Å; R115-E141 PolarHBondContact NE-OE1 3.25Å; R115-E141 IonicContact NH2-OE1 2.61Å; R115-E141 PolarHBondContact NH2-OE1 3.2Å; R115-E141 IonicContact NH2-OE2 2.73Å; R115-E141 PolarHBondContact NH2-OE2 3.35Å
116	K	85.4	Confident	82.2	Confident	128 Å²	128	90.8 Å²	90.8	56%	0.557	44%	0.439	S	S	*	.	H	α-helix	trans	-64.7	-45.1	176.8	-74.7	-179.9	174.5	-164.4	0	112.4	K112 R113 N114 F118 Q119 A120	K112-K116 WeakPolarHBondContact O-CG 3.3Å; K112-K116 PolarHBondContact O-N 3.49Å; R113-K116 PolarHBondContact O-N 3.38Å; R113-K116 VanDerWaalsContact O-N 3.13Å; N114-K116 PolarHBondContact O-N 2.92Å; K116-F118 VanDerWaalsContact C-N 3.27Å; K116-F118 PolarHBondContact O-N 3.36Å; K116-Q119 PolarHBondContact O-N 3.45Å; K116-A120 PolarHBondContact O-N 2.89Å
117	S	80.3	Confident	82	Confident	64 Å²	64	95.4 Å²	95.4	45%	0.448	45%	0.452	S	S	.	.	H	α-helix	trans	-61.5	-38.8	177.8	-60.6	0	0	0	0	111.6	R113 N114 A120 N121	R113-S117 PolarHBondContact O-N 3.3Å; R113-S117 PolarHBondContact O-OG 3.48Å; N114-S117 PolarHBondContact O-N 2.93Å; S117-A120 PolarHBondContact O-N 3Å; S117-N121 VanDerWaalsContact O-CB 3.32Å; S117-N121 WeakPolarHBondContact O-CB 3.42Å; S117-N121 PolarHBondContact O-N 3.49Å; S117-N121 PolarHBondContact O-ND2 3.25Å
118	F	81.4	Confident	81.7	Confident	11 Å²	11	97 Å²	97	5%	0.048	47%	0.467	C	S	.	.	H	α-helix	trans	-67.2	-44.9	175.3	177.7	-96.7	0	0	0	112.8	N114 R115 K116 A120 N121 E122 F125 K130 F133 L134	N114-F118 WeakPolarHBondContact O-CB 3.39Å; N114-F118 PolarHBondContact O-N 3.35Å; R115-F118 PolarHBondContact O-N 3.14Å; K116-F118 VanDerWaalsContact C-N 3.27Å; K116-F118 PolarHBondContact O-N 3.36Å; F118-A120 VanDerWaalsContact C-N 3.28Å; F118-A120 PolarHBondContact O-N 3.31Å; F118-N121 CarbonylContact O-C 3.6Å; F118-N121 PolarHBondContact O-N 3.04Å; F118-N121 VanDerWaalsContact O-N 3.13Å; F118-E122 VanDerWaalsContact O-CA 3.29Å; F118-E122 WeakPolarHBondContact O-CA 3.28Å; F118-E122 WeakPolarHBondContact O-CB 3.37Å; F118-E122 PolarHBondContact O-N 3.17Å; F118-F125 AromaticContact CD2-CD2 3.95Å; F118-F125 HydrophobicContact CD2-CD2 3.95Å; F118-F125 AromaticContact CD2-CE2 3.74Å; F118-F125 HydrophobicContact CD2-CE2 3.74Å; F118-F125 HydrophobicContact CD2-CG 4.47Å; F118-F125 HydrophobicContact CD2-CZ 4.1Å; F118-F125 HydrophobicContact CE2-CD2 4.04Å; F118-F125 HydrophobicContact CE2-CE2 4.26Å; F118-F125 HydrophobicContact CE2-CG 4.18Å; F118-K130 HydrophobicContact CE1-CG 4.43Å; F118-K130 HydrophobicContact CE2-CG 4.1Å; F118-K130 HydrophobicContact CZ-CB 4.43Å; F118-K130 HydrophobicContact CZ-CD 4.45Å; F118-K130 HydrophobicContact CZ-CG 3.45Å; F118-K130 VanDerWaalsContact CZ-CG 3.45Å; F118-F133 HydrophobicContact CB-CD1 3.96Å; F118-F133 HydrophobicContact CB-CE1 3.25Å; F118-F133 HydrophobicContact CB-CZ 3.85Å; F118-F133 HydrophobicContact CD1-CD1 4.26Å; F118-F133 HydrophobicContact CD1-CE1 4.26Å; F118-F133 HydrophobicContact CD2-CB 4.32Å; F118-F133 AromaticContact CD2-CD1 3.14Å; F118-F133 HydrophobicContact CD2-CD1 3.14Å; F118-F133 AromaticContact CD2-CE1 3.4Å; F118-F133 HydrophobicContact CD2-CE1 3.4Å; F118-F133 VanDerWaalsContact CD2-CE1 3.4Å; F118-F133 AromaticContact CD2-CG 3.76Å; F118-F133 HydrophobicContact CD2-CG 3.76Å; F118-F133 HydrophobicContact CD2-CZ 4.22Å; F118-F133 HydrophobicContact CE2-CB 3.97Å; F118-F133 AromaticContact CE2-CD1 3.47Å; F118-F133 HydrophobicContact CE2-CD1 3.47Å; F118-F133 VanDerWaalsContact CE2-CD1 3.47Å; F118-F133 HydrophobicContact CE2-CE1 4.19Å; F118-F133 AromaticContact CE2-CG 3.91Å; F118-F133 HydrophobicContact CE2-CG 3.91Å; F118-F133 AromaticContact CG-CD1 3.54Å; F118-F133 HydrophobicContact CG-CD1 3.54Å; F118-F133 AromaticContact CG-CE1 3.39Å; F118-F133 HydrophobicContact CG-CE1 3.39Å; F118-F133 HydrophobicContact CG-CZ 4.33Å; F118-F133 HydrophobicContact CZ-CD1 4.12Å; F118-L134 HydrophobicContact CD1-CD2 4.38Å; F118-L134 HydrophobicContact CE1-CD1 4.45Å; F118-L134 HydrophobicContact CE1-CD2 3.7Å; F118-L134 HydrophobicContact CE1-CG 4.05Å; F118-L134 HydrophobicContact CZ-CD1 4.32Å; F118-L134 HydrophobicContact CZ-CD2 4.06Å; F118-L134 HydrophobicContact CZ-CG 3.9Å
119	Q	81.5	Confident	81.4	Confident	119 Å²	119	96 Å²	96	56%	0.556	46%	0.464	S	S	*	.	H	α-helix	trans	-60	-38.6	175.1	-74	173.6	-13.1	0	0	112	R115 K116 N121	R115-Q119 WeakPolarHBondContact O-CG 3.26Å; R115-Q119 PolarHBondContact O-N 3.25Å; K116-Q119 PolarHBondContact O-N 3.45Å; Q119-N121 VanDerWaalsContact C-N 3.33Å
120	A	82.9	Confident	81.2	Confident	70 Å²	70	96.6 Å²	96.6	58%	0.579	46%	0.46	S	S	*	.	H	α-helix	trans	-68	-32.7	176	0	0	0	0	0	112.9	K116 S117 F118	K116-A120 PolarHBondContact O-N 2.89Å; S117-A120 PolarHBondContact O-N 3Å; F118-A120 VanDerWaalsContact C-N 3.28Å; F118-A120 PolarHBondContact O-N 3.31Å
121	N	80.3	Confident	81	Confident	75 Å²	75	99.3 Å²	99.3	40%	0.401	47%	0.474	S	S	.	.	H	α-helix	trans	-103.7	7	-175.5	-65.9	-27	0	0	0	113.6	S117 F118 Q119 K123 F124 F125	S117-N121 VanDerWaalsContact O-CB 3.32Å; S117-N121 WeakPolarHBondContact O-CB 3.42Å; S117-N121 PolarHBondContact O-N 3.49Å; S117-N121 PolarHBondContact O-ND2 3.25Å; F118-N121 CarbonylContact O-C 3.6Å; F118-N121 PolarHBondContact O-N 3.04Å; F118-N121 VanDerWaalsContact O-N 3.13Å; Q119-N121 VanDerWaalsContact C-N 3.33Å; N121-K123 PolarHBondContact O-N 3.44Å; N121-F124 HydrophobicContact CB-CD2 4.28Å; N121-F124 WeakPolarHBondContact O-CB 3.44Å; N121-F124 PolarHBondContact O-N 2.87Å; N121-F125 HydrophobicContact CB-CD2 4.44Å; N121-F125 HydrophobicContact CB-CE2 3.94Å; N121-F125 WeakPolarHBondContact O-CD2 3.27Å
122	E	78	Confident	80.9	Confident	81 Å²	81	104.2 Å²	104.2	38%	0.379	50%	0.499	S	S	.	.	G	3₁₀ helix	trans	-55.8	-35	-168.4	-171.8	176.8	-176.8	0	0	112.8	F118 F124 F125 K130	F118-E122 VanDerWaalsContact O-CA 3.29Å; F118-E122 WeakPolarHBondContact O-CA 3.28Å; F118-E122 WeakPolarHBondContact O-CB 3.37Å; F118-E122 PolarHBondContact O-N 3.17Å; E122-F124 PolarHBondContact O-N 3.46Å; E122-F125 PolarHBondContact O-N 3.4Å; E122-K130 WeakPolarHBondContact OE1-CE 3.26Å; E122-K130 IonicContact OE1-NZ 2.59Å; E122-K130 PolarHBondContact OE1-NZ 3.22Å
123	K	80.9	Confident	80.6	Confident	174 Å²	174	100.5 Å²	100.5	76%	0.757	48%	0.483	S	S	*	.	G	3₁₀ helix	trans	-64.9	-18.8	177.4	66.5	-176.7	-178.6	-179.1	0	114.8	N121	N121-K123 PolarHBondContact O-N 3.44Å
124	F	78.6	Confident	80.4	Confident	145 Å²	145	97.4 Å²	97.4	64%	0.636	48%	0.477	S	S	*	.	G	3₁₀ helix	trans	-95.1	-13.8	-179	-61.2	-72.1	0	0	0	113.2	N121 E122	N121-F124 HydrophobicContact CB-CD2 4.28Å; N121-F124 WeakPolarHBondContact O-CB 3.44Å; N121-F124 PolarHBondContact O-N 2.87Å; E122-F124 PolarHBondContact O-N 3.46Å
125	F	72.5	Confident	80.5	Confident	69 Å²	69	98.8 Å²	98.8	30%	0.303	49%	0.49	S	S	.	.	S	Bend	trans	-83.5	134.9	-179.1	-78.7	-84.2	0	0	0	111.8	F118 N121 E122 E129	F118-F125 AromaticContact CD2-CD2 3.95Å; F118-F125 HydrophobicContact CD2-CD2 3.95Å; F118-F125 AromaticContact CD2-CE2 3.74Å; F118-F125 HydrophobicContact CD2-CE2 3.74Å; F118-F125 HydrophobicContact CD2-CG 4.47Å; F118-F125 HydrophobicContact CD2-CZ 4.1Å; F118-F125 HydrophobicContact CE2-CD2 4.04Å; F118-F125 HydrophobicContact CE2-CE2 4.26Å; F118-F125 HydrophobicContact CE2-CG 4.18Å; N121-F125 HydrophobicContact CB-CD2 4.44Å; N121-F125 HydrophobicContact CB-CE2 3.94Å; N121-F125 WeakPolarHBondContact O-CD2 3.27Å; E122-F125 PolarHBondContact O-N 3.4Å; F125-E129 HydrophobicContact CD1-CB 3.99Å
126	V	77.7	Confident	80.5	Confident	92 Å²	92	97.1 Å²	97.1	56%	0.558	49%	0.49	S	S	*	.			trans	-77.1	147.3	170.3	-161.4	0	0	0	0	108.9	P128 E129 K130	V126-P128 HydrophobicContact CG1-CG 4.49Å; V126-P128 VanDerWaalsContact O-N 3.13Å; V126-E129 PolarHBondContact N-OE2 2.97Å; V126-E129 WeakPolarHBondContact O-CB 3.46Å; V126-E129 PolarHBondContact O-N 3.33Å; V126-K130 PolarHBondContact O-N 2.95Å
127	K	79.3	Confident	80.4	Confident	186 Å²	186	91.4 Å²	91.4	81%	0.809	47%	0.465	S	S	*	.	H	α-helix	trans	-44.9	-43.9	-175.7	-76	-174.8	179.5	177.3	0	116.3	K130 K131	K127-K130 WeakPolarHBondContact O-CB 3.26Å; K127-K130 PolarHBondContact O-N 3.23Å; K127-K131 PolarHBondContact O-N 3.06Å
128	P	79.7	Confident	80.5	Confident	93 Å²	93	89.6 Å²	89.6	60%	0.604	46%	0.456	S	S	*	.	H	α-helix	trans	-68.7	-39.1	179.8	25.6	-31.4	0	0	0	112.6	V126 K130 K131 L132	V126-P128 HydrophobicContact CG1-CG 4.49Å; V126-P128 VanDerWaalsContact O-N 3.13Å; P128-K130 VanDerWaalsContact C-N 3.29Å; P128-K130 PolarHBondContact O-N 3.44Å; P128-K131 PolarHBondContact O-N 3.01Å; P128-L132 PolarHBondContact O-N 3.28Å; P128-L132 VanDerWaalsContact O-N 3.07Å
129	E	79.6	Confident	80.5	Confident	101 Å²	101	94.3 Å²	94.3	47%	0.472	48%	0.481	S	S	.	.	H	α-helix	trans	-64.2	-39.1	176.3	-59.8	178.1	153.1	0	0	110.9	F125 V126 K131 L132 F133	F125-E129 HydrophobicContact CD1-CB 3.99Å; V126-E129 PolarHBondContact N-OE2 2.97Å; V126-E129 WeakPolarHBondContact O-CB 3.46Å; V126-E129 PolarHBondContact O-N 3.33Å; E129-K131 VanDerWaalsContact C-N 3.33Å; E129-K131 PolarHBondContact O-N 3.33Å; E129-L132 PolarHBondContact O-N 2.89Å; E129-F133 WeakPolarHBondContact O-CB 3.44Å; E129-F133 PolarHBondContact O-N 3.28Å
130	K	79.6	Confident	80.3	Confident	67 Å²	67	90.9 Å²	90.9	29%	0.291	47%	0.467	S	S	.	.	H	α-helix	trans	-55.9	-47.7	174.8	-161.8	-172.9	-179.1	174.3	0	111.6	F118 E122 V126 K127 P128 L134	F118-K130 HydrophobicContact CE1-CG 4.43Å; F118-K130 HydrophobicContact CE2-CG 4.1Å; F118-K130 HydrophobicContact CZ-CB 4.43Å; F118-K130 HydrophobicContact CZ-CD 4.45Å; F118-K130 HydrophobicContact CZ-CG 3.45Å; F118-K130 VanDerWaalsContact CZ-CG 3.45Å; E122-K130 WeakPolarHBondContact OE1-CE 3.26Å; E122-K130 IonicContact OE1-NZ 2.59Å; E122-K130 PolarHBondContact OE1-NZ 3.22Å; V126-K130 PolarHBondContact O-N 2.95Å; K127-K130 WeakPolarHBondContact O-CB 3.26Å; K127-K130 PolarHBondContact O-N 3.23Å; P128-K130 VanDerWaalsContact C-N 3.29Å; P128-K130 PolarHBondContact O-N 3.44Å; K130-L134 HydrophobicContact CG-CD1 4.35Å; K130-L134 WeakPolarHBondContact O-CB 3.39Å; K130-L134 VanDerWaalsContact O-CG 3.31Å; K130-L134 WeakPolarHBondContact O-CG 3.38Å; K130-L134 PolarHBondContact O-N 2.87Å; K130-L134 VanDerWaalsContact O-N 3.08Å
131	K	81.1	Confident	80.1	Confident	169 Å²	169	90.3 Å²	90.3	74%	0.735	45%	0.452	S	S	*	.	H	α-helix	trans	-66.9	-43.3	-179	-168.5	177.6	-179.7	-177.2	0	111.5	K127 P128 E129 S135	K127-K131 PolarHBondContact O-N 3.06Å; P128-K131 PolarHBondContact O-N 3.01Å; E129-K131 VanDerWaalsContact C-N 3.33Å; E129-K131 PolarHBondContact O-N 3.33Å; K131-S135 WeakPolarHBondContact O-CB 3.08Å; K131-S135 PolarHBondContact O-N 3.06Å
132	L	82.1	Confident	80	Confident	111 Å²	111	92.4 Å²	92.4	58%	0.581	46%	0.463	S	S	*	.	H	α-helix	trans	-63.2	-44.4	177.8	-175.5	64.1	0	0	0	111.6	P128 E129 S135 N136	P128-L132 PolarHBondContact O-N 3.28Å; P128-L132 VanDerWaalsContact O-N 3.07Å; E129-L132 PolarHBondContact O-N 2.89Å; L132-S135 WeakPolarHBondContact O-CB 3.08Å; L132-S135 PolarHBondContact O-N 2.93Å; L132-N136 PolarHBondContact O-N 3.14Å
133	F	81.1	Confident	79.8	Confident	53 Å²	53	92.1 Å²	92.1	23%	0.232	48%	0.475	C	S	.	.	H	α-helix	trans	-64.6	-44.8	179.8	-173	-91	0	0	0	112.4	N114 F118 E129 S135 N136 I137	N114-F133 HydrophobicContact CB-CZ 4.13Å; F118-F133 HydrophobicContact CB-CD1 3.96Å; F118-F133 HydrophobicContact CB-CE1 3.25Å; F118-F133 HydrophobicContact CB-CZ 3.85Å; F118-F133 HydrophobicContact CD1-CD1 4.26Å; F118-F133 HydrophobicContact CD1-CE1 4.26Å; F118-F133 HydrophobicContact CD2-CB 4.32Å; F118-F133 AromaticContact CD2-CD1 3.14Å; F118-F133 HydrophobicContact CD2-CD1 3.14Å; F118-F133 AromaticContact CD2-CE1 3.4Å; F118-F133 HydrophobicContact CD2-CE1 3.4Å; F118-F133 VanDerWaalsContact CD2-CE1 3.4Å; F118-F133 AromaticContact CD2-CG 3.76Å; F118-F133 HydrophobicContact CD2-CG 3.76Å; F118-F133 HydrophobicContact CD2-CZ 4.22Å; F118-F133 HydrophobicContact CE2-CB 3.97Å; F118-F133 AromaticContact CE2-CD1 3.47Å; F118-F133 HydrophobicContact CE2-CD1 3.47Å; F118-F133 VanDerWaalsContact CE2-CD1 3.47Å; F118-F133 HydrophobicContact CE2-CE1 4.19Å; F118-F133 AromaticContact CE2-CG 3.91Å; F118-F133 HydrophobicContact CE2-CG 3.91Å; F118-F133 AromaticContact CG-CD1 3.54Å; F118-F133 HydrophobicContact CG-CD1 3.54Å; F118-F133 AromaticContact CG-CE1 3.39Å; F118-F133 HydrophobicContact CG-CE1 3.39Å; F118-F133 HydrophobicContact CG-CZ 4.33Å; F118-F133 HydrophobicContact CZ-CD1 4.12Å; E129-F133 WeakPolarHBondContact O-CB 3.44Å; E129-F133 PolarHBondContact O-N 3.28Å; F133-S135 VanDerWaalsContact C-N 3.3Å; F133-S135 PolarHBondContact O-N 3.01Å; F133-N136 PolarHBondContact O-N 3.5Å; F133-I137 HydrophobicContact CD1-CD1 3.86Å; F133-I137 HydrophobicContact CD1-CG1 4.21Å; F133-I137 HydrophobicContact CE1-CD1 3.13Å; F133-I137 HydrophobicContact CE1-CG1 3.81Å; F133-I137 HydrophobicContact CZ-CD1 3.7Å; F133-I137 HydrophobicContact CZ-CG1 4.22Å; F133-I137 PolarHBondContact O-N 3.22Å
134	L	81.3	Confident	79.3	Confident	87 Å²	87	84.3 Å²	84.3	46%	0.455	44%	0.442	S	S	.	.	H	α-helix	trans	-63	-37.6	175.8	-71.1	173	0	0	0	111.9	F118 K130 I137 G138	F118-L134 HydrophobicContact CD1-CD2 4.38Å; F118-L134 HydrophobicContact CE1-CD1 4.45Å; F118-L134 HydrophobicContact CE1-CD2 3.7Å; F118-L134 HydrophobicContact CE1-CG 4.05Å; F118-L134 HydrophobicContact CZ-CD1 4.32Å; F118-L134 HydrophobicContact CZ-CD2 4.06Å; F118-L134 HydrophobicContact CZ-CG 3.9Å; K130-L134 HydrophobicContact CG-CD1 4.35Å; K130-L134 WeakPolarHBondContact O-CB 3.39Å; K130-L134 VanDerWaalsContact O-CG 3.31Å; K130-L134 WeakPolarHBondContact O-CG 3.38Å; K130-L134 PolarHBondContact O-N 2.87Å; K130-L134 VanDerWaalsContact O-N 3.08Å; L134-I137 PolarHBondContact O-N 3.33Å; L134-G138 PolarHBondContact O-N 3.21Å
135	S	83.9	Confident	78.5	Confident	67 Å²	67	85.6 Å²	85.6	47%	0.469	46%	0.462	S	S	.	.	H	α-helix	trans	-61.8	-45.8	173.7	-168.7	0	0	0	0	111.7	K131 L132 F133 G138 L139	K131-S135 WeakPolarHBondContact O-CB 3.08Å; K131-S135 PolarHBondContact O-N 3.06Å; L132-S135 WeakPolarHBondContact O-CB 3.08Å; L132-S135 PolarHBondContact O-N 2.93Å; F133-S135 VanDerWaalsContact C-N 3.3Å; F133-S135 PolarHBondContact O-N 3.01Å; S135-G138 PolarHBondContact O-N 2.82Å; S135-L139 WeakPolarHBondContact O-CG 2.95Å; S135-L139 PolarHBondContact O-N 3.22Å
136	N	83.8	Confident	78.8	Confident	78 Å²	78	86.5 Å²	86.5	42%	0.417	47%	0.47	S	S	.	.	H	α-helix	trans	-65.9	-39.2	178.9	-71.5	-10.9	0	0	0	112	L132 F133 L140	L132-N136 PolarHBondContact O-N 3.14Å; F133-N136 PolarHBondContact O-N 3.5Å; N136-L140 WeakPolarHBondContact O-CD1 3.43Å; N136-L140 VanDerWaalsContact O-CG 3.23Å; N136-L140 WeakPolarHBondContact O-CG 3.44Å; N136-L140 PolarHBondContact O-N 3.04Å; N136-L140 VanDerWaalsContact O-N 3.08Å
137	I	82.8	Confident	78.9	Confident	8 Å²	8	86.2 Å²	86.2	4%	0.041	47%	0.465	C	S	.	.	H	α-helix	trans	-62.2	-45	172.2	-75.6	-167.5	0	0	0	110.8	V111 N114 R115 F133 L134 L139 L140 E141	V111-I137 HydrophobicContact CG1-CG2 4.13Å; N114-I137 HydrophobicContact CB-CD1 4.24Å; R115-I137 HydrophobicContact CB-CD1 4.2Å; F133-I137 HydrophobicContact CD1-CD1 3.86Å; F133-I137 HydrophobicContact CD1-CG1 4.21Å; F133-I137 HydrophobicContact CE1-CD1 3.13Å; F133-I137 HydrophobicContact CE1-CG1 3.81Å; F133-I137 HydrophobicContact CZ-CD1 3.7Å; F133-I137 HydrophobicContact CZ-CG1 4.22Å; F133-I137 PolarHBondContact O-N 3.22Å; L134-I137 PolarHBondContact O-N 3.33Å; I137-L139 PolarHBondContact O-N 3.35Å; I137-L140 PolarHBondContact O-N 3.38Å; I137-L140 VanDerWaalsContact O-N 3.15Å; I137-E141 HydrophobicContact CG2-CG 4.24Å; I137-E141 VanDerWaalsContact CG2-OE1 3.23Å; I137-E141 WeakPolarHBondContact CG2-OE1 3.39Å; I137-E141 WeakPolarHBondContact O-CG 3.42Å; I137-E141 PolarHBondContact O-N 3.41Å
138	G	81.5	Confident	78.8	Confident	25 Å²	25	80.6 Å²	80.6	26%	0.258	45%	0.446	S	S	.	.	H	α-helix	trans	-56.7	-49.6	177.8	0	0	0	0	0	112.2	L134 S135 L140 E141 D142	L134-G138 PolarHBondContact O-N 3.21Å; S135-G138 PolarHBondContact O-N 2.82Å; G138-L140 VanDerWaalsContact C-N 3.28Å; G138-L140 PolarHBondContact O-N 3.41Å; G138-E141 PolarHBondContact O-N 3.25Å; G138-D142 VanDerWaalsContact O-CG 3.31Å; G138-D142 PolarHBondContact O-N 3.33Å
139	L	81.4	Confident	78.8	Confident	110 Å²	110	79.9 Å²	79.9	58%	0.576	44%	0.437	S	S	*	.	H	α-helix	trans	-58.7	-38.5	176.2	-69.3	171.8	0	0	0	112.8	S135 I137 A143	S135-L139 WeakPolarHBondContact O-CG 2.95Å; S135-L139 PolarHBondContact O-N 3.22Å; I137-L139 PolarHBondContact O-N 3.35Å; L139-A143 WeakPolarHBondContact O-CB 3.39Å; L139-A143 PolarHBondContact O-N 3.19Å; L139-A143 VanDerWaalsContact O-N 3.11Å
140	L	78.2	Confident	78.7	Confident	48 Å²	48	78.6 Å²	78.6	25%	0.251	43%	0.434	S	S	.	.	H	α-helix	trans	-71.1	-29.6	176.3	-70	167.7	0	0	0	112.6	M107 Y110 V111 N136 I137 G138 V144	M107-L140 HydrophobicContact CE-CD2 3.3Å; Y110-L140 HydrophobicContact CE1-CD1 4.4Å; V111-L140 HydrophobicContact CG2-CB 3.66Å; V111-L140 HydrophobicContact CG2-CD1 4.36Å; N136-L140 WeakPolarHBondContact O-CD1 3.43Å; N136-L140 VanDerWaalsContact O-CG 3.23Å; N136-L140 WeakPolarHBondContact O-CG 3.44Å; N136-L140 PolarHBondContact O-N 3.04Å; N136-L140 VanDerWaalsContact O-N 3.08Å; I137-L140 PolarHBondContact O-N 3.38Å; I137-L140 VanDerWaalsContact O-N 3.15Å; G138-L140 VanDerWaalsContact C-N 3.28Å; G138-L140 PolarHBondContact O-N 3.41Å; L140-V144 WeakPolarHBondContact O-CB 3.17Å; L140-V144 WeakPolarHBondContact O-CG2 3.29Å
141	E	78.6	Confident	78.7	Confident	58 Å²	58	79.3 Å²	79.3	27%	0.271	44%	0.444	S	S	.	.	H	α-helix	trans	-74.1	-40	176.1	-71.2	176.5	178.1	0	0	111.6	V111 R115 I137 G138 A143 V144 T145	V111-E141 HydrophobicContact CG1-CG 3.58Å; V111-E141 WeakPolarHBondContact CG1-OE1 3.49Å; R115-E141 IonicContact CZ-OE1 3.11Å; R115-E141 IonicContact CZ-OE2 3.86Å; R115-E141 IonicContact NE-OE1 3.18Å; R115-E141 PolarHBondContact NE-OE1 3.25Å; R115-E141 IonicContact NH2-OE1 2.61Å; R115-E141 PolarHBondContact NH2-OE1 3.2Å; R115-E141 IonicContact NH2-OE2 2.73Å; R115-E141 PolarHBondContact NH2-OE2 3.35Å; I137-E141 HydrophobicContact CG2-CG 4.24Å; I137-E141 VanDerWaalsContact CG2-OE1 3.23Å; I137-E141 WeakPolarHBondContact CG2-OE1 3.39Å; I137-E141 WeakPolarHBondContact O-CG 3.42Å; I137-E141 PolarHBondContact O-N 3.41Å; G138-E141 PolarHBondContact O-N 3.25Å; E141-A143 VanDerWaalsContact C-N 3.33Å; E141-V144 PolarHBondContact O-N 3.43Å; E141-T145 PolarHBondContact O-N 3.44Å; E141-T145 PolarHBondContact O-OG1 2.69Å
142	D	78	Confident	78.5	Confident	118 Å²	118	72.9 Å²	72.9	63%	0.631	42%	0.423	S	S	*	.	H	α-helix	trans	-64.2	-39.2	175.5	-64.8	-23.1	0	0	0	111.3	G138 V144	G138-D142 VanDerWaalsContact O-CG 3.31Å; G138-D142 PolarHBondContact O-N 3.33Å; D142-V144 PolarHBondContact O-N 3.31Å
143	A	73.2	Confident	78.2	Confident	75 Å²	75	70 Å²	70	62%	0.62	41%	0.411	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.5	-13.6	177.6	0	0	0	0	0	114.4	L139 E141	L139-A143 WeakPolarHBondContact O-CB 3.39Å; L139-A143 PolarHBondContact O-N 3.19Å; L139-A143 VanDerWaalsContact O-N 3.11Å; E141-A143 VanDerWaalsContact C-N 3.33Å
144	V	70.1	Confident	78	Confident	11 Å²	11	71.4 Å²	71.4	7%	0.067	43%	0.426	C	S	.	.	T	Hydrogen-bonded Turn	trans	-114.4	-4.9	-169.6	172.7	0	0	0	0	112.5	M107 K108 L140 E141 D142	M107-V144 HydrophobicContact CB-CG2 3.74Å; M107-V144 HydrophobicContact CE-CG2 4.3Å; M107-V144 HydrophobicContact CG-CG2 3.49Å; M107-V144 VanDerWaalsContact CG-CG2 3.49Å; M107-V144 HydrophobicContact SD-CG2 3.72Å; K108-V144 HydrophobicContact CB-CG1 4.31Å; K108-V144 HydrophobicContact CD-CG1 3.9Å; K108-V144 VanDerWaalsContact CE-O 3.24Å; K108-V144 WeakPolarHBondContact CE-O 3.31Å; K108-V144 HydrophobicContact CG-CG1 3.14Å; K108-V144 PolarHBondContact NZ-O 2.92Å; L140-V144 WeakPolarHBondContact O-CB 3.17Å; L140-V144 WeakPolarHBondContact O-CG2 3.29Å; E141-V144 PolarHBondContact O-N 3.43Å; D142-V144 PolarHBondContact O-N 3.31Å
145	T	62.7	Low	77.7	Confident	172 Å²	172	70 Å²	70	100%	1.055	42%	0.423	S	S	*	.			trans	-88.6	0	178.7	-58.2	0	0	0	0	110.8	E141	E141-T145 PolarHBondContact O-N 3.44Å; E141-T145 PolarHBondContact O-OG1 2.69Å

Retrieved 145 of 145 residues in 29.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).