A0A077YVV3_TRITR Loading...

LSM domain containing protein

AlphaFold DB , UniProt , Accession A0A077YVV3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 81 aa.

						>A0A077YVV3_TRITR|A0A077YVV3
MRFILSVSGNLHSVDQYLNVKLLDVCVQEPAKFPQLISAKNCFIRGSVVRYIHLPPEEVDTTLLQDATRKEYLQQSNKKVN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.3	Very low	83.4	Confident	197 Å²	197	100.3 Å²	100.3	97%	0.97	52%	0.515	S	S	*	.				0	105.4	0	-165.8	168	177.7	0	0	108.2	F3	M1-F3 HydrophobicContact CB-CD2 4.5Å; M1-F3 HydrophobicContact CB-CE2 3.89Å; M1-F3 HydrophobicContact CB-CZ 4.12Å; M1-F3 HydrophobicContact CE-CD1 4.29Å; M1-F3 HydrophobicContact CE-CE1 3.37Å; M1-F3 HydrophobicContact CE-CZ 3.65Å; M1-F3 HydrophobicContact CG-CD1 4.47Å; M1-F3 HydrophobicContact CG-CD2 4.34Å; M1-F3 HydrophobicContact CG-CE1 3.94Å; M1-F3 HydrophobicContact CG-CE2 3.78Å; M1-F3 HydrophobicContact CG-CZ 3.57Å; M1-F3 WeakPolarHBondContact O-CD2 3.49Å; M1-F3 HydrophobicContact SD-CE1 3.69Å; M1-F3 HydrophobicContact SD-CE2 4.01Å; M1-F3 HydrophobicContact SD-CZ 3.27Å; M1-F3 WeakPolarHBondContact SD-CZ 3.42Å
2	R	58.5	Low	84.4	Confident	217 Å²	217	100.7 Å²	100.7	82%	0.819	51%	0.513	S	S	*	.			trans	-82.1	116	173.6	-77.6	-176.8	-177	173	1.1	107.5	I4	R2-I4 VanDerWaalsContact C-N 3.32Å
3	F	74.6	Confident	85.4	Confident	156 Å²	156	97.3 Å²	97.3	68%	0.684	50%	0.504	S	S	*	.			trans	-93.2	10.1	177.7	-66.1	-84.6	0	0	0	113	M1 L5	M1-F3 HydrophobicContact CB-CD2 4.5Å; M1-F3 HydrophobicContact CB-CE2 3.89Å; M1-F3 HydrophobicContact CB-CZ 4.12Å; M1-F3 HydrophobicContact CE-CD1 4.29Å; M1-F3 HydrophobicContact CE-CE1 3.37Å; M1-F3 HydrophobicContact CE-CZ 3.65Å; M1-F3 HydrophobicContact CG-CD1 4.47Å; M1-F3 HydrophobicContact CG-CD2 4.34Å; M1-F3 HydrophobicContact CG-CE1 3.94Å; M1-F3 HydrophobicContact CG-CE2 3.78Å; M1-F3 HydrophobicContact CG-CZ 3.57Å; M1-F3 WeakPolarHBondContact O-CD2 3.49Å; M1-F3 HydrophobicContact SD-CE1 3.69Å; M1-F3 HydrophobicContact SD-CE2 4.01Å; M1-F3 HydrophobicContact SD-CZ 3.27Å; M1-F3 WeakPolarHBondContact SD-CZ 3.42Å; F3-L5 PolarHBondContact O-N 2.89Å
4	I	81.7	Confident	86.2	Confident	61 Å²	61	95.9 Å²	95.9	31%	0.313	50%	0.502	S	S	.	.			trans	-80.9	121.9	-176.1	-52.8	168.7	0	0	0	107.6	R2 R50	R2-I4 VanDerWaalsContact C-N 3.32Å; I4-R50 VanDerWaalsContact CD1-NH1 3.25Å
5	L	90.4	Very high	86.9	Confident	74 Å²	74	93.7 Å²	93.7	39%	0.387	49%	0.491	S	S	.	.			trans	-74.2	124.9	166.4	170.4	66.6	0	0	0	108.8	F3 V7 V27 F33 L36	F3-L5 PolarHBondContact O-N 2.89Å; L5-V7 HydrophobicContact CD1-CG1 4.09Å; L5-V7 HydrophobicContact CD2-CG1 4.2Å; L5-V7 HydrophobicContact CG-CG1 4.01Å; L5-V27 HydrophobicContact CD1-CG1 3.95Å; L5-F33 HydrophobicContact CB-CE2 4.44Å; L5-F33 HydrophobicContact CB-CZ 4.48Å; L5-F33 HydrophobicContact CD1-CD2 3.68Å; L5-F33 HydrophobicContact CD1-CE2 4.01Å; L5-F33 HydrophobicContact CD1-CG 4.07Å; L5-L36 HydrophobicContact CD1-CD1 3.6Å; L5-L36 HydrophobicContact CD2-CD1 3.39Å; L5-L36 HydrophobicContact CG-CD1 4.14Å
6	S	92.4	Very high	87.5	Confident	60 Å²	60	98.1 Å²	98.1	42%	0.42	51%	0.508	S	S	.	.			trans	-107.7	125.7	171.2	-63.9	0	0	0	0	109.9	Q28	S6-Q28 PolarHBondContact O-N 2.96Å; S6-Q28 VanDerWaalsContact O-N 3.11Å
7	V	92.9	Very high	88	Confident	49 Å²	49	101.9 Å²	101.9	30%	0.297	52%	0.516	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.2	142.7	175.5	-65.6	0	0	0	0	109.5	L5 L22 V25 C26 V27 I44	L5-V7 HydrophobicContact CD1-CG1 4.09Å; L5-V7 HydrophobicContact CD2-CG1 4.2Å; L5-V7 HydrophobicContact CG-CG1 4.01Å; V7-L22 HydrophobicContact CG2-CD1 4.17Å; V7-V25 HydrophobicContact CB-CG1 3.9Å; V7-V25 HydrophobicContact CG1-CG1 4.11Å; V7-C26 WeakPolarHBondContact CA-O 3.19Å; V7-V27 HydrophobicContact CG1-CG2 4.33Å; V7-I44 HydrophobicContact CG2-CD1 3.96Å
8	S	93.6	Very high	88.5	Confident	47 Å²	47	102.9 Å²	102.9	33%	0.329	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.1	147.7	169.9	51.5	0	0	0	0	109	V25 C26 Q28	S8-V25 CarbonylContact O-C 3.49Å; S8-V25 VanDerWaalsContact O-CA 3.31Å; S8-V25 WeakPolarHBondContact O-CA 3.13Å; S8-C26 PolarHBondContact N-O 3.01Å; S8-C26 PolarHBondContact O-N 3.46Å; S8-C26 PolarHBondContact OG-O 3.04Å; S8-Q28 PolarHBondContact OG-NE2 3.28Å
9	G	93.7	Very high	89	Confident	33 Å²	33	98.5 Å²	98.5	34%	0.34	50%	0.5	S	S	.	.	E	Extended strand (participates in β ladder)	trans	179.2	175.2	177.6	0	0	0	0	0	110.8	L23	G9-L23 CarbonylContact C-O 3.57Å; G9-L23 WeakPolarHBondContact CA-O 3.4Å
10	N	95	Very high	89.4	Confident	100 Å²	100	94.1 Å²	94.1	54%	0.535	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.4	125.3	179.7	-65.5	-39.1	0	0	0	110.2	H12 L22 L23 D24	N10-H12 PolarHBondContact O-N 3.29Å; N10-L22 CarbonylContact O-C 3.52Å; N10-L22 VanDerWaalsContact O-CA 3.31Å; N10-L22 WeakPolarHBondContact O-CA 3.49Å; N10-L23 HydrophobicContact CB-CB 4.49Å; N10-L23 PolarHBondContact N-O 2.91Å; N10-L23 PolarHBondContact O-N 3.01Å; N10-D24 PolarHBondContact ND2-OD2 3.45Å
11	L	95.9	Very high	89.7	Confident	109 Å²	109	93.3 Å²	93.3	57%	0.571	47%	0.471	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-69.4	116.7	176.9	-177.3	61.9	0	0	0	110.7	V14 V20 L22	L11-V14 HydrophobicContact CD1-CG2 3.74Å; L11-V14 HydrophobicContact CD2-CG2 4.13Å; L11-V14 HydrophobicContact CG-CG2 4.3Å; L11-V20 HydrophobicContact CD1-CG1 3.35Å; L11-L22 HydrophobicContact CB-CD2 4.4Å; L11-L22 HydrophobicContact CD1-CD2 4.12Å
12	H	96.3	Very high	92	Very high	105 Å²	105	84.9 Å²	84.9	49%	0.486	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.4	-40.7	-177.9	176	81.3	0	0	0	113.7	N10 K21 L23	N10-H12 PolarHBondContact O-N 3.29Å; H12-K21 HydrophobicContact CB-CG 4.45Å; H12-K21 WeakPolarHBondContact CB-O 3.33Å; H12-K21 PolarHBondContact N-O 3.09Å; H12-K21 PolarHBondContact NE2-NZ 3.43Å; H12-L23 HydrophobicContact CB-CD1 3.84Å; H12-L23 HydrophobicContact CB-CG 3.75Å; H12-L23 WeakPolarHBondContact ND1-CD1 3.41Å
13	S	96.7	Very high	93.8	Very high	57 Å²	57	76.6 Å²	76.6	40%	0.399	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.1	150	177.5	63.6	0	0	0	0	111.7	K21	S13-K21 PolarHBondContact N-O 3.34Å; S13-K21 PolarHBondContact O-N 3.49Å; S13-K21 VanDerWaalsContact OG-CB 3.27Å; S13-K21 WeakPolarHBondContact OG-CB 3.41Å
14	V	97.3	Very high	94.7	Very high	78 Å²	78	74.4 Å²	74.4	47%	0.473	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.5	139.5	172.7	-175.4	0	0	0	0	108.8	L11 L18 N19 V20	L11-V14 HydrophobicContact CD1-CG2 3.74Å; L11-V14 HydrophobicContact CD2-CG2 4.13Å; L11-V14 HydrophobicContact CG-CG2 4.3Å; V14-L18 HydrophobicContact CG1-CD2 4.39Å; V14-N19 WeakPolarHBondContact CA-O 3.37Å; V14-V20 HydrophobicContact CG2-CG2 4.37Å
15	D	97	Very high	95.2	Very high	63 Å²	63	72.3 Å²	72.3	34%	0.337	39%	0.387	S	S	.	.			trans	-105.4	-179.9	175.6	73.8	14.9	0	0	0	113.1	Y17 L18 N19	D15-Y17 PolarHBondContact O-N 3.02Å; D15-Y17 VanDerWaalsContact O-N 3.17Å; D15-Y17 WeakPolarHBondContact OD1-CA 3.41Å; D15-Y17 PolarHBondContact OD1-N 2.64Å; D15-L18 PolarHBondContact O-N 3.36Å; D15-L18 PolarHBondContact OD1-N 3.07Å; D15-N19 PolarHBondContact N-O 3.25Å; D15-N19 WeakPolarHBondContact OD1-CB 3.39Å; D15-N19 PolarHBondContact OD1-N 3.46Å; D15-N19 PolarHBondContact OD1-ND2 3.4Å; D15-N19 WeakPolarHBondContact OD2-CB 3.42Å; D15-N19 PolarHBondContact OD2-ND2 3.09Å
16	Q	96.2	Very high	95.3	Very high	164 Å²	164	72.3 Å²	72.3	77%	0.766	39%	0.392	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.4	-17.9	-179.4	68.1	-178.3	-13.4	0	0	114.8	L18	Q16-L18 VanDerWaalsContact C-N 3.33Å
17	Y	96.5	Very high	95.3	Very high	163 Å²	163	70 Å²	70	64%	0.639	38%	0.376	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.6	10.1	176.2	-59.3	-66.5	0	0	0	112	D15 N19	D15-Y17 PolarHBondContact O-N 3.02Å; D15-Y17 VanDerWaalsContact O-N 3.17Å; D15-Y17 WeakPolarHBondContact OD1-CA 3.41Å; D15-Y17 PolarHBondContact OD1-N 2.64Å; Y17-N19 PolarHBondContact O-N 2.85Å
18	L	96.4	Very high	95.1	Very high	120 Å²	120	73.2 Å²	73.2	63%	0.628	39%	0.388	S	S	*	.			trans	60	28.1	-176	-48.3	177.4	0	0	0	112.3	V14 D15 Q16 G46	V14-L18 HydrophobicContact CG1-CD2 4.39Å; D15-L18 PolarHBondContact O-N 3.36Å; D15-L18 PolarHBondContact OD1-N 3.07Å; Q16-L18 VanDerWaalsContact C-N 3.33Å; L18-G46 WeakPolarHBondContact O-CA 3.38Å
19	N	97.3	Very high	94.8	Very high	19 Å²	19	74.4 Å²	74.4	10%	0.102	39%	0.388	C	S	.	.			trans	-70.9	138.8	167.1	-55.1	-51.3	0	0	0	108.9	V14 D15 Y17 F43 I44 R45 G46	V14-N19 WeakPolarHBondContact CA-O 3.37Å; D15-N19 PolarHBondContact N-O 3.25Å; D15-N19 WeakPolarHBondContact OD1-CB 3.39Å; D15-N19 PolarHBondContact OD1-N 3.46Å; D15-N19 PolarHBondContact OD1-ND2 3.4Å; D15-N19 WeakPolarHBondContact OD2-CB 3.42Å; D15-N19 PolarHBondContact OD2-ND2 3.09Å; Y17-N19 PolarHBondContact O-N 2.85Å; N19-F43 HydrophobicContact CB-CE1 4.35Å; N19-F43 HydrophobicContact CB-CE2 3.67Å; N19-F43 HydrophobicContact CB-CZ 3.45Å; N19-F43 VanDerWaalsContact CB-CZ 3.45Å; N19-I44 CarbonylContact C-O 3.57Å; N19-I44 WeakPolarHBondContact CA-O 3.4Å; N19-R45 WeakPolarHBondContact OD1-CA 3.39Å; N19-R45 WeakPolarHBondContact OD1-CG 3.42Å; N19-G46 PolarHBondContact OD1-N 3.41Å
20	V	97.6	Very high	94.5	Very high	9 Å²	9	75.7 Å²	75.7	6%	0.055	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118	130.2	-170.7	177.4	0	0	0	0	110.1	L11 V14 L22 F43 I44 I52	L11-V20 HydrophobicContact CD1-CG1 3.35Å; V14-V20 HydrophobicContact CG2-CG2 4.37Å; V20-L22 HydrophobicContact CG1-CD2 3.68Å; V20-L22 HydrophobicContact CG1-CG 3.93Å; V20-F43 WeakPolarHBondContact O-CA 3.31Å; V20-I44 PolarHBondContact N-O 2.96Å; V20-I44 PolarHBondContact O-N 3.42Å; V20-I52 HydrophobicContact CG2-CD1 4.09Å
21	K	96.6	Very high	94.1	Very high	79 Å²	79	75.7 Å²	75.7	34%	0.343	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.9	119.9	166.4	-172.2	168.3	164.3	-158.7	0	109.4	H12 S13 C42	H12-K21 HydrophobicContact CB-CG 4.45Å; H12-K21 WeakPolarHBondContact CB-O 3.33Å; H12-K21 PolarHBondContact N-O 3.09Å; H12-K21 PolarHBondContact NE2-NZ 3.43Å; S13-K21 PolarHBondContact N-O 3.34Å; S13-K21 PolarHBondContact O-N 3.49Å; S13-K21 VanDerWaalsContact OG-CB 3.27Å; S13-K21 WeakPolarHBondContact OG-CB 3.41Å; K21-C42 WeakPolarHBondContact CA-O 3.36Å
22	L	96.2	Very high	93.8	Very high	19 Å²	19	76.2 Å²	76.2	10%	0.099	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.6	140.7	173.8	-61.6	-178.5	0	0	0	110.4	V7 N10 L11 V20 V25 N41 C42 I44	V7-L22 HydrophobicContact CG2-CD1 4.17Å; N10-L22 CarbonylContact O-C 3.52Å; N10-L22 VanDerWaalsContact O-CA 3.31Å; N10-L22 WeakPolarHBondContact O-CA 3.49Å; L11-L22 HydrophobicContact CB-CD2 4.4Å; L11-L22 HydrophobicContact CD1-CD2 4.12Å; V20-L22 HydrophobicContact CG1-CD2 3.68Å; V20-L22 HydrophobicContact CG1-CG 3.93Å; L22-V25 HydrophobicContact CB-CG2 3.54Å; L22-V25 HydrophobicContact CD1-CG2 4.47Å; L22-N41 WeakPolarHBondContact O-CA 3.13Å; L22-C42 PolarHBondContact N-O 2.98Å; L22-C42 PolarHBondContact O-N 2.84Å; L22-I44 HydrophobicContact CD1-CD1 3.84Å; L22-I44 HydrophobicContact CG-CD1 4.4Å
23	L	95.2	Very high	93.3	Very high	44 Å²	44	73.5 Å²	73.5	23%	0.23	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	161	168	-57.3	176.5	0	0	0	109.7	G9 N10 H12 V25 K40 N41	G9-L23 CarbonylContact C-O 3.57Å; G9-L23 WeakPolarHBondContact CA-O 3.4Å; N10-L23 HydrophobicContact CB-CB 4.49Å; N10-L23 PolarHBondContact N-O 2.91Å; N10-L23 PolarHBondContact O-N 3.01Å; H12-L23 HydrophobicContact CB-CD1 3.84Å; H12-L23 HydrophobicContact CB-CG 3.75Å; H12-L23 WeakPolarHBondContact ND1-CD1 3.41Å; L23-V25 VanDerWaalsContact C-N 3.28Å; L23-V25 PolarHBondContact O-N 3.39Å; L23-K40 CarbonylContact C-O 3.58Å; L23-N41 HydrophobicContact CD2-CB 4.16Å; L23-N41 WeakPolarHBondContact CD2-OD1 3.43Å
24	D	93.4	Very high	92.9	Very high	109 Å²	109	74.6 Å²	74.6	58%	0.583	39%	0.394	S	S	*	.	E	Extended strand (participates in β ladder)	trans	48.6	47.9	179	-54.1	-50.2	0	0	0	113.3	N10 C26 K40	N10-D24 PolarHBondContact ND2-OD2 3.45Å; D24-C26 PolarHBondContact O-N 3.39Å; D24-K40 WeakPolarHBondContact CA-O 3.42Å; D24-K40 PolarHBondContact N-O 3.49Å
25	V	93.7	Very high	92.4	Very high	18 Å²	18	76.9 Å²	76.9	11%	0.109	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.2	131.6	-174.6	178.3	0	0	0	0	111.2	V7 S8 L22 L23 K40 C42	V7-V25 HydrophobicContact CB-CG1 3.9Å; V7-V25 HydrophobicContact CG1-CG1 4.11Å; S8-V25 CarbonylContact O-C 3.49Å; S8-V25 VanDerWaalsContact O-CA 3.31Å; S8-V25 WeakPolarHBondContact O-CA 3.13Å; L22-V25 HydrophobicContact CB-CG2 3.54Å; L22-V25 HydrophobicContact CD1-CG2 4.47Å; L23-V25 VanDerWaalsContact C-N 3.28Å; L23-V25 PolarHBondContact O-N 3.39Å; V25-K40 PolarHBondContact N-O 2.94Å; V25-C42 HydrophobicContact CG2-CB 3.97Å
26	C	91.7	Very high	91.8	Very high	73 Å²	73	76.2 Å²	76.2	49%	0.493	40%	0.396	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.5	127.6	170.9	-174.6	0	0	0	0	109.7	V7 S8 D24	V7-C26 WeakPolarHBondContact CA-O 3.19Å; S8-C26 PolarHBondContact N-O 3.01Å; S8-C26 PolarHBondContact O-N 3.46Å; S8-C26 PolarHBondContact OG-O 3.04Å; D24-C26 PolarHBondContact O-N 3.39Å
27	V	91.6	Very high	91.2	Very high	13 Å²	13	73.5 Å²	73.5	8%	0.079	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86	124.5	177.5	-179.5	0	0	0	0	108.2	L5 V7 E29 P30 F33 L36	L5-V27 HydrophobicContact CD1-CG1 3.95Å; V7-V27 HydrophobicContact CG1-CG2 4.33Å; V27-E29 VanDerWaalsContact C-N 3.28Å; V27-E29 PolarHBondContact O-N 2.73Å; V27-P30 WeakPolarHBondContact O-CD 3.47Å; V27-F33 HydrophobicContact CG1-CB 4.46Å; V27-L36 HydrophobicContact CG2-CB 3.53Å
28	Q	89.3	Confident	90.7	Very high	116 Å²	116	70.7 Å²	70.7	54%	0.542	39%	0.39	S	S	.	.	S	Bend	trans	-68	-28.3	-176.1	-65.1	-68.4	-30.6	0	0	112.8	S6 S8 P30	S6-Q28 PolarHBondContact O-N 2.96Å; S6-Q28 VanDerWaalsContact O-N 3.11Å; S8-Q28 PolarHBondContact OG-NE2 3.28Å; Q28-P30 WeakPolarHBondContact O-CD 3.32Å
29	E	88	Confident	90.1	Very high	72 Å²	72	66.2 Å²	66.2	34%	0.336	37%	0.371	S	S	.	.			trans	-125.7	68.9	-179.5	-62	-173.1	-97.7	0	0	111.6	V27 A31 K32 F33	V27-E29 VanDerWaalsContact C-N 3.28Å; V27-E29 PolarHBondContact O-N 2.73Å; E29-A31 PolarHBondContact O-N 3.13Å; E29-K32 HydrophobicContact CB-CB 4.4Å; E29-K32 HydrophobicContact CB-CD 4.33Å; E29-K32 PolarHBondContact O-N 3.24Å; E29-K32 VanDerWaalsContact O-N 3.1Å; E29-K32 IonicContact OE1-NZ 3.76Å; E29-K32 WeakPolarHBondContact OE2-CD 3.5Å; E29-K32 WeakPolarHBondContact OE2-CE 3.27Å; E29-K32 IonicContact OE2-NZ 2.63Å; E29-K32 PolarHBondContact OE2-NZ 3.39Å; E29-F33 PolarHBondContact O-N 3.07Å
30	P	86.4	Confident	89.7	Confident	59 Å²	59	72.7 Å²	72.7	38%	0.383	40%	0.398	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.8	-29.1	-173.2	25.8	-33.9	0	0	0	112.7	V27 Q28 K32 F33 P34 I37	V27-P30 WeakPolarHBondContact O-CD 3.47Å; Q28-P30 WeakPolarHBondContact O-CD 3.32Å; P30-K32 VanDerWaalsContact C-N 3.29Å; P30-K32 PolarHBondContact O-N 3.44Å; P30-F33 CarbonylContact O-C 3.27Å; P30-F33 VanDerWaalsContact O-C 3.27Å; P30-F33 PolarHBondContact O-N 3.42Å; P30-P34 WeakPolarHBondContact O-CA 3.38Å; P30-P34 VanDerWaalsContact O-N 3.15Å; P30-I37 HydrophobicContact CB-CD1 3.73Å; P30-I37 HydrophobicContact CB-CG1 3.7Å
31	A	87.7	Confident	89.4	Confident	101 Å²	101	77 Å²	77	84%	0.835	42%	0.421	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.3	-29.4	177.5	0	0	0	0	0	113.5	E29	E29-A31 PolarHBondContact O-N 3.13Å
32	K	88	Confident	89.2	Confident	120 Å²	120	74.8 Å²	74.8	52%	0.522	42%	0.415	S	S	.	.	T	Hydrogen-bonded Turn	trans	-84.5	-27.5	177	-70.5	-176.7	-178.8	166.6	0	112.6	E29 P30 P34	E29-K32 HydrophobicContact CB-CB 4.4Å; E29-K32 HydrophobicContact CB-CD 4.33Å; E29-K32 PolarHBondContact O-N 3.24Å; E29-K32 VanDerWaalsContact O-N 3.1Å; E29-K32 IonicContact OE1-NZ 3.76Å; E29-K32 WeakPolarHBondContact OE2-CD 3.5Å; E29-K32 WeakPolarHBondContact OE2-CE 3.27Å; E29-K32 IonicContact OE2-NZ 2.63Å; E29-K32 PolarHBondContact OE2-NZ 3.39Å; P30-K32 VanDerWaalsContact C-N 3.29Å; P30-K32 PolarHBondContact O-N 3.44Å; K32-P34 VanDerWaalsContact C-CD 3.48Å
33	F	87.1	Confident	89.2	Confident	47 Å²	47	80.4 Å²	80.4	21%	0.206	44%	0.438	C	S	.	.			trans	-131.6	62.6	-174.6	-53.7	-74.8	0	0	0	111.3	L5 V27 E29 P30 Q35 L36	L5-F33 HydrophobicContact CB-CE2 4.44Å; L5-F33 HydrophobicContact CB-CZ 4.48Å; L5-F33 HydrophobicContact CD1-CD2 3.68Å; L5-F33 HydrophobicContact CD1-CE2 4.01Å; L5-F33 HydrophobicContact CD1-CG 4.07Å; V27-F33 HydrophobicContact CG1-CB 4.46Å; E29-F33 PolarHBondContact O-N 3.07Å; P30-F33 CarbonylContact O-C 3.27Å; P30-F33 VanDerWaalsContact O-C 3.27Å; P30-F33 PolarHBondContact O-N 3.42Å; F33-Q35 VanDerWaalsContact C-OE1 3.28Å; F33-Q35 PolarHBondContact O-N 3.29Å; F33-Q35 VanDerWaalsContact O-N 3.14Å; F33-L36 HydrophobicContact CB-CB 4.47Å; F33-L36 HydrophobicContact CB-CD1 3.9Å; F33-L36 HydrophobicContact CB-CG 4.23Å; F33-L36 HydrophobicContact CG-CD1 4.42Å; F33-L36 PolarHBondContact O-N 3.35Å
34	P	87.5	Confident	89.2	Confident	80 Å²	80	80.3 Å²	80.3	52%	0.519	44%	0.438	S	S	.	.	G	3₁₀ helix	trans	-59.9	-29	-175.6	24.3	-34.9	0	0	0	113.1	P30 K32 L36 I37	P30-P34 WeakPolarHBondContact O-CA 3.38Å; P30-P34 VanDerWaalsContact O-N 3.15Å; K32-P34 VanDerWaalsContact C-CD 3.48Å; P34-L36 PolarHBondContact O-N 2.88Å; P34-L36 VanDerWaalsContact O-N 3.15Å; P34-I37 HydrophobicContact CB-CD1 4.31Å; P34-I37 WeakPolarHBondContact O-CG1 3.43Å; P34-I37 PolarHBondContact O-N 3.13Å
35	Q	86.3	Confident	89.3	Confident	127 Å²	127	82.9 Å²	82.9	59%	0.593	44%	0.439	S	S	*	.	G	3₁₀ helix	trans	-63.8	-17.3	177.8	70.4	-82	15.3	0	0	114.1	F33	F33-Q35 VanDerWaalsContact C-OE1 3.28Å; F33-Q35 PolarHBondContact O-N 3.29Å; F33-Q35 VanDerWaalsContact O-N 3.14Å
36	L	85.8	Confident	89.4	Confident	49 Å²	49	82.7 Å²	82.7	26%	0.257	44%	0.441	S	S	.	.	G	3₁₀ helix	trans	-97.5	-6.7	-178	-61.8	-179.9	0	0	0	113.3	L5 V27 F33 P34 S38 A39	L5-L36 HydrophobicContact CD1-CD1 3.6Å; L5-L36 HydrophobicContact CD2-CD1 3.39Å; L5-L36 HydrophobicContact CG-CD1 4.14Å; V27-L36 HydrophobicContact CG2-CB 3.53Å; F33-L36 HydrophobicContact CB-CB 4.47Å; F33-L36 HydrophobicContact CB-CD1 3.9Å; F33-L36 HydrophobicContact CB-CG 4.23Å; F33-L36 HydrophobicContact CG-CD1 4.42Å; F33-L36 PolarHBondContact O-N 3.35Å; P34-L36 PolarHBondContact O-N 2.88Å; P34-L36 VanDerWaalsContact O-N 3.15Å; L36-S38 VanDerWaalsContact C-N 3.27Å; L36-S38 PolarHBondContact O-N 3.4Å; L36-A39 WeakPolarHBondContact O-CB 3.31Å; L36-A39 PolarHBondContact O-N 3.41Å; L36-A39 VanDerWaalsContact O-N 3.15Å
37	I	83	Confident	89.6	Confident	106 Å²	106	83.6 Å²	83.6	54%	0.544	45%	0.448	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.1	-32	-175.2	-63.1	173.2	0	0	0	112.1	P30 P34 A39	P30-I37 HydrophobicContact CB-CD1 3.73Å; P30-I37 HydrophobicContact CB-CG1 3.7Å; P34-I37 HydrophobicContact CB-CD1 4.31Å; P34-I37 WeakPolarHBondContact O-CG1 3.43Å; P34-I37 PolarHBondContact O-N 3.13Å; I37-A39 VanDerWaalsContact C-N 3.33Å
38	S	85.3	Confident	89.8	Confident	104 Å²	104	88 Å²	88	73%	0.727	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.2	-8.7	179.6	59.9	0	0	0	0	113.8	L36 K40	L36-S38 VanDerWaalsContact C-N 3.27Å; L36-S38 PolarHBondContact O-N 3.4Å; S38-K40 PolarHBondContact O-N 3.16Å; S38-K40 VanDerWaalsContact O-N 3.1Å
39	A	83.6	Confident	90	Very high	27 Å²	27	84.9 Å²	84.9	22%	0.223	46%	0.464	C	S	.	.			trans	-77.3	99.9	-175.1	0	0	0	0	0	110.4	L36 I37	L36-A39 WeakPolarHBondContact O-CB 3.31Å; L36-A39 PolarHBondContact O-N 3.41Å; L36-A39 VanDerWaalsContact O-N 3.15Å; I37-A39 VanDerWaalsContact C-N 3.33Å
40	K	89	Confident	90.4	Very high	155 Å²	155	89.4 Å²	89.4	67%	0.674	48%	0.478	S	S	*	.	S	Bend	trans	-77.5	-36.4	173.8	-65	-170.2	177.1	-172.3	0	112.7	L23 D24 V25 S38	L23-K40 CarbonylContact C-O 3.58Å; D24-K40 WeakPolarHBondContact CA-O 3.42Å; D24-K40 PolarHBondContact N-O 3.49Å; V25-K40 PolarHBondContact N-O 2.94Å; S38-K40 PolarHBondContact O-N 3.16Å; S38-K40 VanDerWaalsContact O-N 3.1Å
41	N	92.4	Very high	90.8	Very high	100 Å²	100	94.5 Å²	94.5	54%	0.535	49%	0.491	S	S	.	.	S	Bend	trans	-125.6	134.1	-177.4	-59.3	-27	0	0	0	109.2	L22 L23	L22-N41 WeakPolarHBondContact O-CA 3.13Å; L23-N41 HydrophobicContact CD2-CB 4.16Å; L23-N41 WeakPolarHBondContact CD2-OD1 3.43Å
42	C	92.6	Very high	91.2	Very high	32 Å²	32	94.9 Å²	94.9	22%	0.216	48%	0.477	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	140.4	-179.1	-68	0	0	0	0	111.1	K21 L22 V25 I44	K21-C42 WeakPolarHBondContact CA-O 3.36Å; L22-C42 PolarHBondContact N-O 2.98Å; L22-C42 PolarHBondContact O-N 2.84Å; V25-C42 HydrophobicContact CG2-CB 3.97Å; C42-I44 HydrophobicContact CB-CG1 4.41Å
43	F	95.2	Very high	91.5	Very high	137 Å²	137	97 Å²	97	60%	0.601	49%	0.489	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.7	121.1	164.2	177.4	-96.4	0	0	0	108.4	N19 V20	N19-F43 HydrophobicContact CB-CE1 4.35Å; N19-F43 HydrophobicContact CB-CE2 3.67Å; N19-F43 HydrophobicContact CB-CZ 3.45Å; N19-F43 VanDerWaalsContact CB-CZ 3.45Å; V20-F43 WeakPolarHBondContact O-CA 3.31Å
44	I	95	Very high	91.8	Very high	41 Å²	41	99.6 Å²	99.6	21%	0.21	50%	0.504	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114	123.1	-176.1	-53.9	173.5	0	0	0	107.9	V7 N19 V20 L22 C42 G46 V48 V49	V7-I44 HydrophobicContact CG2-CD1 3.96Å; N19-I44 CarbonylContact C-O 3.57Å; N19-I44 WeakPolarHBondContact CA-O 3.4Å; V20-I44 PolarHBondContact N-O 2.96Å; V20-I44 PolarHBondContact O-N 3.42Å; L22-I44 HydrophobicContact CD1-CD1 3.84Å; L22-I44 HydrophobicContact CG-CD1 4.4Å; C42-I44 HydrophobicContact CB-CG1 4.41Å; I44-G46 PolarHBondContact O-N 3.24Å; I44-V48 HydrophobicContact CG2-CG2 4.05Å; I44-V49 HydrophobicContact CG2-CG2 3.61Å
45	R	96.1	Very high	92.2	Very high	163 Å²	163	98 Å²	98	62%	0.615	49%	0.494	S	S	*	.			trans	-69.2	127.8	177	-169.5	-178.7	177.2	107.3	0.7	109.8	N19 S47 V48	N19-R45 WeakPolarHBondContact OD1-CA 3.39Å; N19-R45 WeakPolarHBondContact OD1-CG 3.42Å; R45-S47 VanDerWaalsContact CD-OG 3.29Å; R45-S47 WeakPolarHBondContact CD-OG 3.4Å; R45-S47 WeakPolarHBondContact CG-OG 3.38Å; R45-S47 PolarHBondContact NE-OG 3.46Å; R45-S47 PolarHBondContact O-N 3.28Å; R45-S47 VanDerWaalsContact O-N 3.09Å; R45-V48 HydrophobicContact CB-CG2 4.31Å; R45-V48 WeakPolarHBondContact O-CG2 3.47Å; R45-V48 PolarHBondContact O-N 3.45Å
46	G	95.7	Very high	92.6	Very high	15 Å²	15	97.2 Å²	97.2	16%	0.155	50%	0.5	C	S	.	.	G	3₁₀ helix	trans	-54.9	-35	-176.4	0	0	0	0	0	113	L18 N19 I44 V48 V49	L18-G46 WeakPolarHBondContact O-CA 3.38Å; N19-G46 PolarHBondContact OD1-N 3.41Å; I44-G46 PolarHBondContact O-N 3.24Å; G46-V48 PolarHBondContact O-N 3.14Å; G46-V48 VanDerWaalsContact O-N 3.17Å; G46-V49 WeakPolarHBondContact O-CB 3.21Å; G46-V49 PolarHBondContact O-N 2.92Å; G46-V49 VanDerWaalsContact O-N 3.16Å
47	S	96.4	Very high	93.1	Very high	92 Å²	92	102.4 Å²	102.4	64%	0.643	52%	0.523	S	S	*	.	G	3₁₀ helix	trans	-66.4	-15	179	67.6	0	0	0	0	115.3	R45	R45-S47 VanDerWaalsContact CD-OG 3.29Å; R45-S47 WeakPolarHBondContact CD-OG 3.4Å; R45-S47 WeakPolarHBondContact CG-OG 3.38Å; R45-S47 PolarHBondContact NE-OG 3.46Å; R45-S47 PolarHBondContact O-N 3.28Å; R45-S47 VanDerWaalsContact O-N 3.09Å
48	V	95	Very high	93.6	Very high	105 Å²	105	104.1 Å²	104.1	64%	0.636	53%	0.529	S	S	*	.	G	3₁₀ helix	trans	-101.4	-6	177	-54.9	0	0	0	0	112.9	I44 R45 G46	I44-V48 HydrophobicContact CG2-CG2 4.05Å; R45-V48 HydrophobicContact CB-CG2 4.31Å; R45-V48 WeakPolarHBondContact O-CG2 3.47Å; R45-V48 PolarHBondContact O-N 3.45Å; G46-V48 PolarHBondContact O-N 3.14Å; G46-V48 VanDerWaalsContact O-N 3.17Å
49	V	95.1	Very high	94.1	Very high	51 Å²	51	101.6 Å²	101.6	31%	0.309	51%	0.508	S	S	.	.			trans	-77.2	127	-179.4	-179.7	0	0	0	0	109.2	I44 G46 I52	I44-V49 HydrophobicContact CG2-CG2 3.61Å; G46-V49 WeakPolarHBondContact O-CB 3.21Å; G46-V49 PolarHBondContact O-N 2.92Å; G46-V49 VanDerWaalsContact O-N 3.16Å; V49-I52 HydrophobicContact CG1-CD1 4.08Å; V49-I52 HydrophobicContact CG1-CG1 3.6Å
50	R	95.5	Very high	94.7	Very high	166 Å²	166	104.9 Å²	104.9	63%	0.626	52%	0.522	S	S	*	.			trans	-91.1	-48.9	172.9	-171.7	179.1	-64.5	-163.6	-2.8	111.9	I4	I4-R50 VanDerWaalsContact CD1-NH1 3.25Å
51	Y	95.3	Very high	95.1	Very high	167 Å²	167	101.5 Å²	101.5	66%	0.655	52%	0.515	S	S	*	.			trans	-143.3	145.2	-178.6	-58	-56.5	0	0	0	109.7
52	I	95	Very high	95.3	Very high	108 Å²	108	100.8 Å²	100.8	55%	0.554	51%	0.514	S	S	*	.			trans	-120.8	119.5	164.3	-58.8	-179.5	0	0	0	105.5	V20 V49 L54	V20-I52 HydrophobicContact CG2-CD1 4.09Å; V49-I52 HydrophobicContact CG1-CD1 4.08Å; V49-I52 HydrophobicContact CG1-CG1 3.6Å; I52-L54 HydrophobicContact CG2-CD2 4Å; I52-L54 HydrophobicContact CG2-CG 4.32Å
53	H	94.7	Very high	95.5	Very high	165 Å²	165	104.8 Å²	104.8	76%	0.764	53%	0.533	S	S	*	.			trans	-94.8	128.5	175.7	-66.3	-92.4	0	0	0	108.3
54	L	94	Very high	95.6	Very high	101 Å²	101	103 Å²	103	53%	0.529	53%	0.529	S	S	.	.			trans	-117.5	147.2	176.6	-59.4	174	0	0	0	108.8	I52 V59	I52-L54 HydrophobicContact CG2-CD2 4Å; I52-L54 HydrophobicContact CG2-CG 4.32Å; L54-V59 HydrophobicContact CB-CG2 4.11Å; L54-V59 HydrophobicContact CD1-CG2 4.11Å
55	P	94.9	Very high	95.7	Very high	48 Å²	48	105.9 Å²	105.9	31%	0.312	54%	0.542	S	S	.	.			trans	-61.2	138.1	169.7	-17.3	30.5	0	0	0	110.6	E57 E58	P55-E57 HydrophobicContact CB-CG 4Å; P55-E57 WeakPolarHBondContact CB-OE1 3.43Å; P55-E57 WeakPolarHBondContact CB-OE2 3.4Å; P55-E57 PolarHBondContact O-N 3.37Å; P55-E58 HydrophobicContact CB-CG 4.32Å; P55-E58 HydrophobicContact CG-CG 4.33Å; P55-E58 PolarHBondContact O-N 3.32Å; P55-E58 VanDerWaalsContact O-N 3.13Å
56	P	95.1	Very high	95.7	Very high	110 Å²	110	101.1 Å²	101.1	71%	0.714	53%	0.528	S	S	*	.	G	3₁₀ helix	trans	-61.6	-28.2	-178.8	24.2	-33.6	0	0	0	113.2	E58 V59	P56-E58 VanDerWaalsContact C-N 3.26Å; P56-E58 PolarHBondContact O-N 3.48Å; P56-V59 PolarHBondContact O-N 2.88Å
57	E	95.9	Very high	95.8	Very high	157 Å²	157	102.8 Å²	102.8	73%	0.734	54%	0.54	S	S	*	.	G	3₁₀ helix	trans	-67.3	-21.8	177	59.4	-90.5	-150.5	0	0	114	P55 V59	P55-E57 HydrophobicContact CB-CG 4Å; P55-E57 WeakPolarHBondContact CB-OE1 3.43Å; P55-E57 WeakPolarHBondContact CB-OE2 3.4Å; P55-E57 PolarHBondContact O-N 3.37Å; E57-V59 VanDerWaalsContact C-N 3.33Å
58	E	93.4	Very high	95.8	Very high	143 Å²	143	102.1 Å²	102.1	67%	0.668	53%	0.533	S	S	*	.	G	3₁₀ helix	trans	-88.6	-2.1	178	-64.8	-171.9	178	0	0	112.8	P55 P56	P55-E58 HydrophobicContact CB-CG 4.32Å; P55-E58 HydrophobicContact CG-CG 4.33Å; P55-E58 PolarHBondContact O-N 3.32Å; P55-E58 VanDerWaalsContact O-N 3.13Å; P56-E58 VanDerWaalsContact C-N 3.26Å; P56-E58 PolarHBondContact O-N 3.48Å
59	V	95.6	Very high	95.9	Very high	50 Å²	50	103.3 Å²	103.3	30%	0.303	53%	0.526	S	S	.	.			trans	-122.4	106.4	-173.3	-174.5	0	0	0	0	111.3	L54 P56 E57 T61 L64	L54-V59 HydrophobicContact CB-CG2 4.11Å; L54-V59 HydrophobicContact CD1-CG2 4.11Å; P56-V59 PolarHBondContact O-N 2.88Å; E57-V59 VanDerWaalsContact C-N 3.33Å; V59-T61 PolarHBondContact O-N 2.99Å; V59-L64 HydrophobicContact CG1-CD2 4.24Å
60	D	96.9	Very high	95.9	Very high	97 Å²	97	107.5 Å²	107.5	52%	0.519	54%	0.54	S	S	.	.			trans	-74.4	98.4	166.7	-172.9	-25.5	0	0	0	110	T62 L63 L64	D60-T62 VanDerWaalsContact C-N 3.26Å; D60-T62 PolarHBondContact O-N 3.49Å; D60-T62 WeakPolarHBondContact OD1-CA 3.41Å; D60-T62 WeakPolarHBondContact OD1-CB 3.37Å; D60-T62 PolarHBondContact OD1-N 2.92Å; D60-L63 HydrophobicContact CB-CB 3.98Å; D60-L63 PolarHBondContact O-N 3.27Å; D60-L63 PolarHBondContact OD1-N 3.23Å; D60-L64 WeakPolarHBondContact O-CB 3.35Å; D60-L64 PolarHBondContact O-N 3.29Å
61	T	96.5	Very high	95.8	Very high	84 Å²	84	104.6 Å²	104.6	52%	0.515	53%	0.533	S	S	.	.	H	α-helix	trans	-64.3	-28.4	-179.6	59.8	0	0	0	0	113.3	V59 Q65	V59-T61 PolarHBondContact O-N 2.99Å; T61-Q65 WeakPolarHBondContact O-CB 3.49Å; T61-Q65 WeakPolarHBondContact O-CG 3.13Å; T61-Q65 PolarHBondContact O-N 2.82Å
62	T	96.7	Very high	95.8	Very high	85 Å²	85	104.5 Å²	104.5	52%	0.521	53%	0.533	S	S	.	.	H	α-helix	trans	-73.5	-47.1	-179.3	-61.3	0	0	0	0	109.5	D60 L64 Q65 D66	D60-T62 VanDerWaalsContact C-N 3.26Å; D60-T62 PolarHBondContact O-N 3.49Å; D60-T62 WeakPolarHBondContact OD1-CA 3.41Å; D60-T62 WeakPolarHBondContact OD1-CB 3.37Å; D60-T62 PolarHBondContact OD1-N 2.92Å; T62-L64 VanDerWaalsContact C-N 3.32Å; T62-L64 PolarHBondContact O-N 3.19Å; T62-Q65 PolarHBondContact O-N 3.17Å; T62-D66 PolarHBondContact O-N 2.89Å
63	L	97.1	Very high	95.7	Very high	116 Å²	116	104.4 Å²	104.4	61%	0.607	53%	0.533	S	S	*	.	H	α-helix	trans	-60.8	-41.9	174.5	-174.6	64.8	0	0	0	111.7	D60 D66 A67	D60-L63 HydrophobicContact CB-CB 3.98Å; D60-L63 PolarHBondContact O-N 3.27Å; D60-L63 PolarHBondContact OD1-N 3.23Å; L63-D66 PolarHBondContact O-N 2.87Å; L63-A67 WeakPolarHBondContact O-CB 3.49Å; L63-A67 PolarHBondContact O-N 2.87Å
64	L	97.1	Very high	95.5	Very high	99 Å²	99	102.1 Å²	102.1	52%	0.518	52%	0.523	S	S	.	.	H	α-helix	trans	-61.9	-43.7	177.5	-179	62.5	0	0	0	112.1	V59 D60 T62 A67 T68	V59-L64 HydrophobicContact CG1-CD2 4.24Å; D60-L64 WeakPolarHBondContact O-CB 3.35Å; D60-L64 PolarHBondContact O-N 3.29Å; T62-L64 VanDerWaalsContact C-N 3.32Å; T62-L64 PolarHBondContact O-N 3.19Å; L64-A67 PolarHBondContact O-N 2.78Å; L64-T68 WeakPolarHBondContact O-CB 3.48Å; L64-T68 PolarHBondContact O-N 2.79Å; L64-T68 PolarHBondContact O-OG1 2.86Å
65	Q	97.3	Very high	95.3	Very high	102 Å²	102	101.7 Å²	101.7	48%	0.477	52%	0.518	S	S	.	.	H	α-helix	trans	-64.2	-42.8	177.2	-74.5	170.5	22.3	0	0	111.9	T61 T62 T68 R69	T61-Q65 WeakPolarHBondContact O-CB 3.49Å; T61-Q65 WeakPolarHBondContact O-CG 3.13Å; T61-Q65 PolarHBondContact O-N 2.82Å; T62-Q65 PolarHBondContact O-N 3.17Å; Q65-T68 PolarHBondContact O-N 2.73Å; Q65-R69 PolarHBondContact O-N 2.88Å
66	D	97.3	Very high	94.7	Very high	63 Å²	63	101.4 Å²	101.4	34%	0.337	52%	0.517	S	S	.	.	H	α-helix	trans	-63	-45.2	176	-83	-27.6	0	0	0	112.4	T62 L63 T68 R69 K70	T62-D66 PolarHBondContact O-N 2.89Å; L63-D66 PolarHBondContact O-N 2.87Å; D66-T68 VanDerWaalsContact C-N 3.33Å; D66-T68 PolarHBondContact O-N 3.28Å; D66-R69 PolarHBondContact O-N 3.49Å; D66-R69 IonicContact OD1-CZ 3.49Å; D66-R69 IonicContact OD1-NE 3.58Å; D66-R69 IonicContact OD1-NH2 2.64Å; D66-R69 PolarHBondContact OD1-NH2 3.29Å; D66-K70 WeakPolarHBondContact O-CG 3.32Å; D66-K70 PolarHBondContact O-N 3.1Å; D66-K70 VanDerWaalsContact O-N 3.09Å
67	A	97	Very high	94	Very high	49 Å²	49	101.4 Å²	101.4	41%	0.405	51%	0.511	S	S	.	.	H	α-helix	trans	-60.5	-43.8	175.8	0	0	0	0	0	111.2	L63 L64 R69 K70 E71	L63-A67 WeakPolarHBondContact O-CB 3.49Å; L63-A67 PolarHBondContact O-N 2.87Å; L64-A67 PolarHBondContact O-N 2.78Å; A67-R69 PolarHBondContact O-N 2.92Å; A67-K70 PolarHBondContact O-N 3.03Å; A67-E71 WeakPolarHBondContact O-CB 3.47Å; A67-E71 PolarHBondContact O-N 3.28Å
68	T	96.7	Very high	93	Very high	79 Å²	79	101.7 Å²	101.7	49%	0.485	51%	0.51	S	S	.	.	H	α-helix	trans	-60.4	-45.3	178.3	-57.5	0	0	0	0	111.7	L64 Q65 D66 K70 E71 Y72	L64-T68 WeakPolarHBondContact O-CB 3.48Å; L64-T68 PolarHBondContact O-N 2.79Å; L64-T68 PolarHBondContact O-OG1 2.86Å; Q65-T68 PolarHBondContact O-N 2.73Å; D66-T68 VanDerWaalsContact C-N 3.33Å; D66-T68 PolarHBondContact O-N 3.28Å; T68-K70 PolarHBondContact O-N 2.94Å; T68-E71 PolarHBondContact O-N 2.97Å; T68-Y72 WeakPolarHBondContact O-CB 3.1Å; T68-Y72 PolarHBondContact O-N 2.9Å
69	R	96.1	Very high	91.5	Very high	130 Å²	130	103.1 Å²	103.1	49%	0.491	51%	0.514	S	S	.	.	H	α-helix	trans	-60.3	-45.6	176.3	-76.1	-175	-76.5	-92.6	5.9	111.7	Q65 D66 A67 L73	Q65-R69 PolarHBondContact O-N 2.88Å; D66-R69 PolarHBondContact O-N 3.49Å; D66-R69 IonicContact OD1-CZ 3.49Å; D66-R69 IonicContact OD1-NE 3.58Å; D66-R69 IonicContact OD1-NH2 2.64Å; D66-R69 PolarHBondContact OD1-NH2 3.29Å; A67-R69 PolarHBondContact O-N 2.92Å; R69-L73 WeakPolarHBondContact O-CG 3.38Å; R69-L73 PolarHBondContact O-N 3.11Å
70	K	95.7	Very high	90	Very high	138 Å²	138	106.5 Å²	106.5	60%	0.6	53%	0.534	S	S	*	.	H	α-helix	trans	-63.8	-44.4	178.3	-71.5	174.2	-176.9	173.5	0	111.6	D66 A67 T68 L73 Q74	D66-K70 WeakPolarHBondContact O-CG 3.32Å; D66-K70 PolarHBondContact O-N 3.1Å; D66-K70 VanDerWaalsContact O-N 3.09Å; A67-K70 PolarHBondContact O-N 3.03Å; T68-K70 PolarHBondContact O-N 2.94Å; K70-L73 PolarHBondContact O-N 2.8Å; K70-Q74 WeakPolarHBondContact O-CG 3.44Å; K70-Q74 PolarHBondContact O-N 3.44Å; K70-Q74 VanDerWaalsContact O-N 3.09Å
71	E	94.4	Very high	87.7	Confident	106 Å²	106	111.3 Å²	111.3	50%	0.495	56%	0.56	S	S	.	*	H	α-helix	trans	-63.3	-43.9	179.1	-166.9	-173.4	161	0	0	111.5	A67 T68 L73 Q74 Q75	A67-E71 WeakPolarHBondContact O-CB 3.47Å; A67-E71 PolarHBondContact O-N 3.28Å; T68-E71 PolarHBondContact O-N 2.97Å; E71-L73 PolarHBondContact O-N 3.09Å; E71-Q74 WeakPolarHBondContact O-CB 3.43Å; E71-Q74 PolarHBondContact O-N 2.86Å; E71-Q74 VanDerWaalsContact O-N 3.13Å; E71-Q75 HydrophobicContact CG-CG 4.48Å; E71-Q75 WeakPolarHBondContact O-CG 3.29Å; E71-Q75 PolarHBondContact O-N 3.16Å; E71-Q75 PolarHBondContact OE1-NE2 3.17Å
72	Y	94.1	Very high	87.3	Confident	165 Å²	165	112.7 Å²	112.7	65%	0.647	56%	0.562	S	S	*	*	H	α-helix	trans	-57.4	-45.8	176.9	-179.2	-97.8	0	0	0	112.4	T68 Q74 Q75 S76	T68-Y72 WeakPolarHBondContact O-CB 3.1Å; T68-Y72 PolarHBondContact O-N 2.9Å; Y72-Q74 VanDerWaalsContact C-N 3.33Å; Y72-Q74 PolarHBondContact O-N 3.36Å; Y72-Q75 PolarHBondContact O-N 3.44Å; Y72-S76 PolarHBondContact O-N 3.18Å; Y72-S76 PolarHBondContact O-OG 3.27Å
73	L	93.2	Very high	86.8	Confident	106 Å²	106	114.1 Å²	114.1	56%	0.555	56%	0.564	S	S	*	*	H	α-helix	trans	-64.7	-34.9	176.8	-67.5	171.3	0	0	0	112.6	R69 K70 E71 S76 N77	R69-L73 WeakPolarHBondContact O-CG 3.38Å; R69-L73 PolarHBondContact O-N 3.11Å; K70-L73 PolarHBondContact O-N 2.8Å; E71-L73 PolarHBondContact O-N 3.09Å; L73-S76 WeakPolarHBondContact CA-OG 3.46Å; L73-S76 PolarHBondContact O-OG 3.04Å; L73-N77 VanDerWaalsContact O-CG 3.27Å; L73-N77 PolarHBondContact O-N 3.15Å; L73-N77 VanDerWaalsContact O-N 3.16Å
74	Q	91.5	Very high	86.2	Confident	117 Å²	117	114 Å²	114	55%	0.547	56%	0.562	S	S	.	*	H	α-helix	trans	-69.8	-40.1	175.1	-70.4	173.6	16.9	0	0	111.7	K70 E71 Y72 N77 K78	K70-Q74 WeakPolarHBondContact O-CG 3.44Å; K70-Q74 PolarHBondContact O-N 3.44Å; K70-Q74 VanDerWaalsContact O-N 3.09Å; E71-Q74 WeakPolarHBondContact O-CB 3.43Å; E71-Q74 PolarHBondContact O-N 2.86Å; E71-Q74 VanDerWaalsContact O-N 3.13Å; Y72-Q74 VanDerWaalsContact C-N 3.33Å; Y72-Q74 PolarHBondContact O-N 3.36Å; Q74-N77 PolarHBondContact O-N 3.14Å; Q74-K78 WeakPolarHBondContact O-CG 3.41Å; Q74-K78 PolarHBondContact O-N 3.37Å; Q74-K78 VanDerWaalsContact O-N 3.07Å
75	Q	88.3	Confident	85.5	Confident	91 Å²	91	114.9 Å²	114.9	43%	0.425	57%	0.565	S	S	.	*	H	α-helix	trans	-66.5	-37.6	176.4	-70.5	-174.6	30.2	0	0	111.8	E71 Y72 K78 K79	E71-Q75 HydrophobicContact CG-CG 4.48Å; E71-Q75 WeakPolarHBondContact O-CG 3.29Å; E71-Q75 PolarHBondContact O-N 3.16Å; E71-Q75 PolarHBondContact OE1-NE2 3.17Å; Y72-Q75 PolarHBondContact O-N 3.44Å; Q75-K78 PolarHBondContact O-N 3.1Å; Q75-K79 PolarHBondContact O-N 2.63Å
76	S	83	Confident	84.8	Confident	43 Å²	43	115.7 Å²	115.7	30%	0.301	57%	0.57	S	S	.	*	H	α-helix	trans	-64.8	-42.3	174.6	58.6	0	0	0	0	111.8	Y72 L73 K78 K79 V80	Y72-S76 PolarHBondContact O-N 3.18Å; Y72-S76 PolarHBondContact O-OG 3.27Å; L73-S76 WeakPolarHBondContact CA-OG 3.46Å; L73-S76 PolarHBondContact O-OG 3.04Å; S76-K78 VanDerWaalsContact C-N 3.32Å; S76-K78 PolarHBondContact O-N 3.2Å; S76-K79 PolarHBondContact O-N 3.3Å; S76-K79 VanDerWaalsContact O-N 3.14Å; S76-V80 WeakPolarHBondContact O-CG2 3.27Å; S76-V80 PolarHBondContact O-N 3.15Å
77	N	79.5	Confident	84	Confident	110 Å²	110	119.2 Å²	119.2	59%	0.588	59%	0.586	S	S	*	*	H	α-helix	trans	-65.9	-34.5	178.3	-70.6	-8.4	0	0	0	112.6	L73 Q74 K79 V80	L73-N77 VanDerWaalsContact O-CG 3.27Å; L73-N77 PolarHBondContact O-N 3.15Å; L73-N77 VanDerWaalsContact O-N 3.16Å; Q74-N77 PolarHBondContact O-N 3.14Å; N77-K79 PolarHBondContact O-N 3.3Å; N77-V80 PolarHBondContact O-N 3.38Å
78	K	75.1	Confident	83	Confident	162 Å²	162	124.2 Å²	124.2	70%	0.704	60%	0.599	S	S	*	*	H	α-helix	trans	-67	-21	174.4	-76.4	-178.5	-178.4	179	0	114	Q74 Q75 S76	Q74-K78 WeakPolarHBondContact O-CG 3.41Å; Q74-K78 PolarHBondContact O-N 3.37Å; Q74-K78 VanDerWaalsContact O-N 3.07Å; Q75-K78 PolarHBondContact O-N 3.1Å; S76-K78 VanDerWaalsContact C-N 3.32Å; S76-K78 PolarHBondContact O-N 3.2Å
79	K	63.3	Low	82	Confident	174 Å²	174	127.7 Å²	127.7	76%	0.757	61%	0.607	S	S	*	*	H	α-helix	trans	-88.2	-13.8	177.3	-70.2	-178.3	-179.2	-178.6	0	113.2	Q75 S76 N77	Q75-K79 PolarHBondContact O-N 2.63Å; S76-K79 PolarHBondContact O-N 3.3Å; S76-K79 VanDerWaalsContact O-N 3.14Å; N77-K79 PolarHBondContact O-N 3.3Å
80	V	62.3	Low	80.8	Confident	120 Å²	120	127.5 Å²	127.5	73%	0.727	62%	0.617	S	S	*	*	H	α-helix	trans	-94.3	-13.7	-176.9	176.7	0	0	0	0	112	S76 N77	S76-V80 WeakPolarHBondContact O-CG2 3.27Å; S76-V80 PolarHBondContact O-N 3.15Å; N77-V80 PolarHBondContact O-N 3.38Å
81	N	49.6	Very low	79.5	Confident	198 Å²	198	126.5 Å²	126.5	100%	1.059	62%	0.619	S	S	*	*			trans	-106.2	0	169.5	-68.1	-19.5	0	0	0	110.8

Retrieved 81 of 81 residues in 48.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).