A0A077YW00_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YW00, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 34 aa.

						>A0A077YW00_TRITR|A0A077YW00
MVPYTTWSIFCILWTLNFPPSTKRHLAIPVVSIT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	79.8	Confident	86.8	Confident	239 Å²	239	111.9 Å²	111.9	100%	1.177	57%	0.574	S	S	*	*				0	111.3	0	-74.3	164.8	171.9	0	0	107.1
2	V	74.4	Confident	87.2	Confident	123 Å²	123	111.5 Å²	111.5	75%	0.745	57%	0.572	S	S	*	*			trans	-67.9	126.9	173.8	175	0	0	0	0	107.1	Y4	V2-Y4 PolarHBondContact O-N 2.85Å; V2-Y4 VanDerWaalsContact O-N 3.09Å
3	P	83	Confident	87.5	Confident	68 Å²	68	110.1 Å²	110.1	44%	0.442	57%	0.566	S	S	.	*			trans	-60.8	116.6	177.7	23.3	-32.5	0	0	0	109.1	T5 T6 W7	P3-T5 PolarHBondContact O-N 2.69Å; P3-T5 VanDerWaalsContact O-N 3.1Å; P3-T6 VanDerWaalsContact CG-OG1 3.3Å; P3-T6 WeakPolarHBondContact CG-OG1 3.48Å; P3-T6 PolarHBondContact O-N 2.77Å; P3-W7 PolarHBondContact O-N 2.96Å
4	Y	88.2	Confident	87.7	Confident	165 Å²	165	111.6 Å²	111.6	65%	0.647	56%	0.561	S	S	*	*	H	α-helix	trans	-56.8	-27.6	177.5	-167.2	-96.6	0	0	0	111.5	V2 T6 W7 S8	V2-Y4 PolarHBondContact O-N 2.85Å; V2-Y4 VanDerWaalsContact O-N 3.09Å; Y4-T6 PolarHBondContact O-N 3.25Å; Y4-W7 HydrophobicContact CD2-CE3 4.12Å; Y4-W7 AromaticContact CE2-CE3 3.65Å; Y4-W7 HydrophobicContact CE2-CE3 3.65Å; Y4-W7 AromaticContact CE2-CZ3 3.83Å; Y4-W7 HydrophobicContact CE2-CZ3 3.83Å; Y4-W7 PolarHBondContact O-N 3.37Å; Y4-S8 WeakPolarHBondContact CE1-OG 3.48Å; Y4-S8 PolarHBondContact O-N 3.39Å; Y4-S8 PolarHBondContact O-OG 3.17Å
5	T	87	Confident	87.5	Confident	96 Å²	96	109.2 Å²	109.2	59%	0.589	55%	0.554	S	S	*	*	H	α-helix	trans	-59.7	-44.3	173.7	53.9	0	0	0	0	112.4	P3 W7 S8 I9	P3-T5 PolarHBondContact O-N 2.69Å; P3-T5 VanDerWaalsContact O-N 3.1Å; T5-W7 VanDerWaalsContact C-N 3.34Å; T5-S8 PolarHBondContact O-N 2.84Å; T5-I9 WeakPolarHBondContact O-CD1 3.34Å; T5-I9 VanDerWaalsContact O-CG1 3.25Å; T5-I9 WeakPolarHBondContact O-CG1 3.18Å; T5-I9 PolarHBondContact O-N 2.95Å
6	T	90.6	Very high	87.2	Confident	82 Å²	82	110.3 Å²	110.3	50%	0.503	56%	0.561	S	S	.	*	H	α-helix	trans	-66.8	-38	176.9	-55.8	0	0	0	0	111.2	P3 Y4 F10	P3-T6 VanDerWaalsContact CG-OG1 3.3Å; P3-T6 WeakPolarHBondContact CG-OG1 3.48Å; P3-T6 PolarHBondContact O-N 2.77Å; Y4-T6 PolarHBondContact O-N 3.25Å; T6-F10 VanDerWaalsContact O-CB 3.3Å; T6-F10 WeakPolarHBondContact O-CB 3.49Å; T6-F10 PolarHBondContact O-N 2.67Å
7	W	88.2	Confident	87	Confident	144 Å²	144	110.9 Å²	110.9	55%	0.545	57%	0.566	S	S	.	*	H	α-helix	trans	-65.2	-44.6	176.6	-164.4	61.2	0	0	0	111.9	P3 Y4 T5 F10 C11	P3-W7 PolarHBondContact O-N 2.96Å; Y4-W7 HydrophobicContact CD2-CE3 4.12Å; Y4-W7 AromaticContact CE2-CE3 3.65Å; Y4-W7 HydrophobicContact CE2-CE3 3.65Å; Y4-W7 AromaticContact CE2-CZ3 3.83Å; Y4-W7 HydrophobicContact CE2-CZ3 3.83Å; Y4-W7 PolarHBondContact O-N 3.37Å; T5-W7 VanDerWaalsContact C-N 3.34Å; W7-F10 PolarHBondContact O-N 3.22Å; W7-C11 PolarHBondContact O-N 3.04Å; W7-C11 PolarHBondContact O-SG 3.49Å
8	S	90.8	Very high	86.5	Confident	42 Å²	42	111.4 Å²	111.4	29%	0.294	56%	0.564	S	S	.	*	H	α-helix	trans	-63	-44.9	176.7	-65.6	0	0	0	0	113.1	Y4 T5 F10 C11 I12	Y4-S8 WeakPolarHBondContact CE1-OG 3.48Å; Y4-S8 PolarHBondContact O-N 3.39Å; Y4-S8 PolarHBondContact O-OG 3.17Å; T5-S8 PolarHBondContact O-N 2.84Å; S8-F10 VanDerWaalsContact C-N 3.32Å; S8-F10 PolarHBondContact O-N 2.9Å; S8-C11 PolarHBondContact O-N 2.73Å; S8-I12 WeakPolarHBondContact O-CG1 3.08Å; S8-I12 PolarHBondContact O-N 3.44Å
9	I	92.5	Very high	85.6	Confident	101 Å²	101	110.2 Å²	110.2	52%	0.518	56%	0.564	S	S	.	*	H	α-helix	trans	-61.3	-45.3	177	-66.9	164.9	0	0	0	110	T5 C11 I12 L13	T5-I9 WeakPolarHBondContact O-CD1 3.34Å; T5-I9 VanDerWaalsContact O-CG1 3.25Å; T5-I9 WeakPolarHBondContact O-CG1 3.18Å; T5-I9 PolarHBondContact O-N 2.95Å; I9-C11 VanDerWaalsContact C-N 3.35Å; I9-C11 PolarHBondContact O-N 3.09Å; I9-I12 PolarHBondContact O-N 3.06Å; I9-L13 HydrophobicContact CG2-CD1 3.91Å; I9-L13 HydrophobicContact CG2-CG 4.46Å; I9-L13 WeakPolarHBondContact O-CG 3.42Å; I9-L13 PolarHBondContact O-N 3.02Å
10	F	91.4	Very high	84.7	Confident	126 Å²	126	109 Å²	109	55%	0.553	56%	0.564	S	S	*	*	H	α-helix	trans	-59.2	-43.9	176.4	-178.4	-96.7	0	0	0	111.8	T6 W7 S8 I12 L13 W14	T6-F10 VanDerWaalsContact O-CB 3.3Å; T6-F10 WeakPolarHBondContact O-CB 3.49Å; T6-F10 PolarHBondContact O-N 2.67Å; W7-F10 PolarHBondContact O-N 3.22Å; S8-F10 VanDerWaalsContact C-N 3.32Å; S8-F10 PolarHBondContact O-N 2.9Å; F10-I12 PolarHBondContact O-N 2.77Å; F10-L13 PolarHBondContact O-N 3.39Å; F10-W14 HydrophobicContact CZ-CE3 4.42Å; F10-W14 WeakPolarHBondContact O-CB 3.4Å; F10-W14 PolarHBondContact O-N 3.35Å
11	C	89.1	Confident	83.5	Confident	45 Å²	45	109.4 Å²	109.4	30%	0.304	58%	0.576	S	S	.	*	H	α-helix	trans	-64.1	-38.7	178.3	-71.3	0	0	0	0	113.7	W7 S8 I9 T15	W7-C11 PolarHBondContact O-N 3.04Å; W7-C11 PolarHBondContact O-SG 3.49Å; S8-C11 PolarHBondContact O-N 2.73Å; I9-C11 VanDerWaalsContact C-N 3.35Å; I9-C11 PolarHBondContact O-N 3.09Å; C11-T15 WeakPolarHBondContact O-CB 3.32Å; C11-T15 PolarHBondContact O-N 3.35Å; C11-T15 PolarHBondContact O-OG1 3.23Å
12	I	91.4	Very high	82.5	Confident	107 Å²	107	103.1 Å²	103.1	55%	0.549	55%	0.551	S	S	.	*	H	α-helix	trans	-66.4	-50.6	176.2	-64.9	165.2	0	0	0	109.8	S8 I9 F10 W14 T15 L16	S8-I12 WeakPolarHBondContact O-CG1 3.08Å; S8-I12 PolarHBondContact O-N 3.44Å; I9-I12 PolarHBondContact O-N 3.06Å; F10-I12 PolarHBondContact O-N 2.77Å; I12-W14 VanDerWaalsContact C-N 3.28Å; I12-W14 PolarHBondContact O-N 3.48Å; I12-T15 PolarHBondContact O-N 3.45Å; I12-L16 HydrophobicContact CG2-CD1 4.04Å; I12-L16 VanDerWaalsContact O-CG 3.32Å; I12-L16 WeakPolarHBondContact O-CG 3.36Å; I12-L16 PolarHBondContact O-N 3.04Å
13	L	91.4	Very high	81.5	Confident	93 Å²	93	107 Å²	107	49%	0.487	56%	0.559	S	S	.	*	H	α-helix	trans	-61	-39.4	177.4	-70.6	174.2	0	0	0	111.6	I9 F10 L16 N17	I9-L13 HydrophobicContact CG2-CD1 3.91Å; I9-L13 HydrophobicContact CG2-CG 4.46Å; I9-L13 WeakPolarHBondContact O-CG 3.42Å; I9-L13 PolarHBondContact O-N 3.02Å; F10-L13 PolarHBondContact O-N 3.39Å; L13-L16 PolarHBondContact O-N 3.06Å; L13-N17 WeakPolarHBondContact O-CB 3.3Å; L13-N17 PolarHBondContact O-N 2.93Å; L13-N17 PolarHBondContact O-ND2 3.25Å
14	W	89.7	Confident	80.3	Confident	132 Å²	132	113.2 Å²	113.2	50%	0.5	57%	0.573	S	S	.	*	H	α-helix	trans	-61	-48.8	174.6	175.2	-97.7	0	0	0	111.4	F10 I12 L16 N17 F18	F10-W14 HydrophobicContact CZ-CE3 4.42Å; F10-W14 WeakPolarHBondContact O-CB 3.4Å; F10-W14 PolarHBondContact O-N 3.35Å; I12-W14 VanDerWaalsContact C-N 3.28Å; I12-W14 PolarHBondContact O-N 3.48Å; W14-L16 VanDerWaalsContact C-N 3.28Å; W14-L16 PolarHBondContact O-N 3.26Å; W14-N17 PolarHBondContact O-N 3.33Å; W14-F18 AromaticContact CD2-CD2 3.76Å; W14-F18 HydrophobicContact CD2-CD2 3.76Å; W14-F18 HydrophobicContact CD2-CE2 4.38Å; W14-F18 AromaticContact CE2-CD2 3.93Å; W14-F18 AromaticContact CE3-CD2 3.48Å; W14-F18 HydrophobicContact CE3-CD2 3.48Å; W14-F18 VanDerWaalsContact CE3-CD2 3.48Å; W14-F18 AromaticContact CE3-CE2 3.65Å; W14-F18 HydrophobicContact CE3-CE2 3.65Å; W14-F18 AromaticContact CH2-CD2 3.59Å; W14-F18 HydrophobicContact CH2-CD2 3.59Å; W14-F18 AromaticContact CH2-CE2 3.61Å; W14-F18 HydrophobicContact CH2-CE2 3.61Å; W14-F18 HydrophobicContact CH2-CG 4.1Å; W14-F18 HydrophobicContact CH2-CZ 4.13Å; W14-F18 HydrophobicContact CZ2-CB 4.38Å; W14-F18 AromaticContact CZ2-CD2 3.86Å; W14-F18 HydrophobicContact CZ2-CD2 3.86Å; W14-F18 HydrophobicContact CZ2-CE2 4.35Å; W14-F18 HydrophobicContact CZ2-CG 4.08Å; W14-F18 AromaticContact CZ3-CD2 3.4Å; W14-F18 HydrophobicContact CZ3-CD2 3.4Å; W14-F18 AromaticContact CZ3-CE2 3.21Å; W14-F18 HydrophobicContact CZ3-CE2 3.21Å; W14-F18 HydrophobicContact CZ3-CG 4.35Å; W14-F18 HydrophobicContact CZ3-CZ 4.04Å; W14-F18 WeakPolarHBondContact O-CA 3.3Å; W14-F18 WeakPolarHBondContact O-CB 3.48Å; W14-F18 PolarHBondContact O-N 2.98Å
15	T	84.6	Confident	78.2	Confident	75 Å²	75	112.4 Å²	112.4	46%	0.46	58%	0.575	S	S	.	*	H	α-helix	trans	-64.5	-32.2	179	-55.3	0	0	0	0	112.1	C11 I12 F18 P19	C11-T15 WeakPolarHBondContact O-CB 3.32Å; C11-T15 PolarHBondContact O-N 3.35Å; C11-T15 PolarHBondContact O-OG1 3.23Å; I12-T15 PolarHBondContact O-N 3.45Å; T15-F18 CarbonylContact O-C 3.3Å; T15-F18 VanDerWaalsContact O-C 3.3Å; T15-P19 WeakPolarHBondContact O-CA 3.44Å; T15-P19 VanDerWaalsContact O-N 3.1Å
16	L	83.4	Confident	76.3	Confident	127 Å²	127	116 Å²	116	67%	0.665	59%	0.59	S	S	*	*	H	α-helix	trans	-73.9	-38	175	-69.3	171.1	0	0	0	112.9	I12 L13 W14	I12-L16 HydrophobicContact CG2-CD1 4.04Å; I12-L16 VanDerWaalsContact O-CG 3.32Å; I12-L16 WeakPolarHBondContact O-CG 3.36Å; I12-L16 PolarHBondContact O-N 3.04Å; L13-L16 PolarHBondContact O-N 3.06Å; W14-L16 VanDerWaalsContact C-N 3.28Å; W14-L16 PolarHBondContact O-N 3.26Å
17	N	84	Confident	74.5	Confident	120 Å²	120	115.1 Å²	115.1	64%	0.642	59%	0.591	S	S	*	*	H	α-helix	trans	-77.9	-34.4	177.7	-81.2	-83.6	0	0	0	112.5	L13 W14 P19	L13-N17 WeakPolarHBondContact O-CB 3.3Å; L13-N17 PolarHBondContact O-N 2.93Å; L13-N17 PolarHBondContact O-ND2 3.25Å; W14-N17 PolarHBondContact O-N 3.33Å; N17-P19 WeakPolarHBondContact O-CD 3.25Å
18	F	77.8	Confident	72.7	Confident	120 Å²	120	113.9 Å²	113.9	53%	0.526	59%	0.593	S	S	.	*	S	Bend	trans	-120.7	69.9	176.7	-61.2	-83.9	0	0	0	108.2	W14 T15 P20	W14-F18 AromaticContact CD2-CD2 3.76Å; W14-F18 HydrophobicContact CD2-CD2 3.76Å; W14-F18 HydrophobicContact CD2-CE2 4.38Å; W14-F18 AromaticContact CE2-CD2 3.93Å; W14-F18 AromaticContact CE3-CD2 3.48Å; W14-F18 HydrophobicContact CE3-CD2 3.48Å; W14-F18 VanDerWaalsContact CE3-CD2 3.48Å; W14-F18 AromaticContact CE3-CE2 3.65Å; W14-F18 HydrophobicContact CE3-CE2 3.65Å; W14-F18 AromaticContact CH2-CD2 3.59Å; W14-F18 HydrophobicContact CH2-CD2 3.59Å; W14-F18 AromaticContact CH2-CE2 3.61Å; W14-F18 HydrophobicContact CH2-CE2 3.61Å; W14-F18 HydrophobicContact CH2-CG 4.1Å; W14-F18 HydrophobicContact CH2-CZ 4.13Å; W14-F18 HydrophobicContact CZ2-CB 4.38Å; W14-F18 AromaticContact CZ2-CD2 3.86Å; W14-F18 HydrophobicContact CZ2-CD2 3.86Å; W14-F18 HydrophobicContact CZ2-CE2 4.35Å; W14-F18 HydrophobicContact CZ2-CG 4.08Å; W14-F18 AromaticContact CZ3-CD2 3.4Å; W14-F18 HydrophobicContact CZ3-CD2 3.4Å; W14-F18 AromaticContact CZ3-CE2 3.21Å; W14-F18 HydrophobicContact CZ3-CE2 3.21Å; W14-F18 HydrophobicContact CZ3-CG 4.35Å; W14-F18 HydrophobicContact CZ3-CZ 4.04Å; W14-F18 WeakPolarHBondContact O-CA 3.3Å; W14-F18 WeakPolarHBondContact O-CB 3.48Å; W14-F18 PolarHBondContact O-N 2.98Å; T15-F18 CarbonylContact O-C 3.3Å; T15-F18 VanDerWaalsContact O-C 3.3Å; F18-P20 VanDerWaalsContact O-N 3.14Å
19	P	69	Low	70.8	Confident	88 Å²	88	117.9 Å²	117.9	57%	0.571	62%	0.618	S	S	*	*			trans	-52.8	128.7	171.3	23.8	-32.1	0	0	0	106.6	T15 N17 S21	T15-P19 WeakPolarHBondContact O-CA 3.44Å; T15-P19 VanDerWaalsContact O-N 3.1Å; N17-P19 WeakPolarHBondContact O-CD 3.25Å; P19-S21 PolarHBondContact O-N 3.49Å; P19-S21 VanDerWaalsContact O-N 3.09Å
20	P	68	Low	68.7	Low	86 Å²	86	118.1 Å²	118.1	56%	0.558	62%	0.624	S	S	*	*			trans	-50.9	129.5	179.2	19.6	-30.4	0	0	0	106.8	F18 T22	F18-P20 VanDerWaalsContact O-N 3.14Å; P20-T22 PolarHBondContact O-N 2.89Å; P20-T22 PolarHBondContact O-OG1 3.09Å; P20-T22 VanDerWaalsContact O-OG1 3.06Å
21	S	58.9	Low	66.5	Low	118 Å²	118	117.7 Å²	117.7	83%	0.825	63%	0.632	S	S	*	*			trans	-69.4	43.7	-175.3	-164.1	0	0	0	0	111.7	P19 K23	P19-S21 PolarHBondContact O-N 3.49Å; P19-S21 VanDerWaalsContact O-N 3.09Å; S21-K23 PolarHBondContact O-N 3.45Å
22	T	60.2	Low	64.3	Low	107 Å²	107	120.6 Å²	120.6	66%	0.656	65%	0.653	S	S	*	*			trans	-69	98.1	153.6	42.1	0	0	0	0	106.4	P20 R24	P20-T22 PolarHBondContact O-N 2.89Å; P20-T22 PolarHBondContact O-OG1 3.09Å; P20-T22 VanDerWaalsContact O-OG1 3.06Å; T22-R24 PolarHBondContact O-N 3.17Å
23	K	53.4	Low	62.5	Low	206 Å²	206	123 Å²	123	90%	0.896	67%	0.665	S	S	*	*	S	Bend	trans	-56.5	42.1	168.2	-77.2	179.1	165.8	174.7	0	113.9	S21	S21-K23 PolarHBondContact O-N 3.45Å
24	R	56.6	Low	60.5	Low	198 Å²	198	127.2 Å²	127.2	75%	0.747	70%	0.695	S	S	*	*			trans	-148.8	112.7	175.9	-98.2	-173.7	178.3	153	-0.5	109.7	T22	T22-R24 PolarHBondContact O-N 3.17Å
25	H	44.1	Very low	59	Low	148 Å²	148	127 Å²	127	69%	0.685	71%	0.705	S	S	*	*			trans	81	107.3	158.4	-44.5	-174.2	0	0	0	113.3	A27	H25-A27 HydrophobicContact CB-CB 3.9Å
26	L	47.3	Very low	57.7	Low	172 Å²	172	129.7 Å²	129.7	90%	0.901	72%	0.718	S	S	*	*			cis	45.6	17.7	33.4	-129.1	149.5	0	0	0	115
27	A	52.3	Low	56.3	Low	63 Å²	63	129.9 Å²	129.9	52%	0.521	72%	0.72	S	S	.	*			trans	-128.1	80	161.9	0	0	0	0	0	106	H25	H25-A27 HydrophobicContact CB-CB 3.9Å
28	I	51.2	Low	54.6	Low	118 Å²	118	130.5 Å²	130.5	61%	0.605	73%	0.725	S	S	*	*				40.1	85.1	92.3	-48.7	174.4	0	0	0	109	V30	I28-V30 HydrophobicContact CG2-CB 3.47Å; I28-V30 VanDerWaalsContact CG2-CB 3.47Å; I28-V30 HydrophobicContact CG2-CG2 3.33Å; I28-V30 PolarHBondContact O-N 3.1Å
29	P	50.2	Low	53.2	Low	125 Å²	125	131.1 Å²	131.1	81%	0.812	74%	0.737	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.2	49.4	166.2	32.8	-34.6	0	0	0	110.6
30	V	49.7	Very low	52.1	Low	106 Å²	106	134 Å²	134	64%	0.642	75%	0.749	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.1	-13.2	172.8	170.2	0	0	0	0	111.3	I28	I28-V30 HydrophobicContact CG2-CB 3.47Å; I28-V30 VanDerWaalsContact CG2-CB 3.47Å; I28-V30 HydrophobicContact CG2-CG2 3.33Å; I28-V30 PolarHBondContact O-N 3.1Å
31	V	43.9	Very low	51	Low	117 Å²	117	137.4 Å²	137.4	71%	0.709	76%	0.762	S	S	*	*	S	Bend	trans	-122.1	69.6	178.1	-164.9	0	0	0	0	111.3
32	S	43.6	Very low	50.4	Low	107 Å²	107	138.9 Å²	138.9	75%	0.748	76%	0.757	S	S	*	*			trans	-143.8	33.8	154.9	-70.4	0	0	0	0	110.7
33	I	52.4	Low	49.6	Very low	156 Å²	156	141.6 Å²	141.6	80%	0.8	77%	0.766	S	S	*	*			trans	-105.1	20.1	172.8	-44.2	178.7	0	0	0	110.3
34	T	50.2	Low	49.2	Very low	183 Å²	183	135.7 Å²	135.7	100%	1.123	75%	0.754	S	S	*	*			trans	-141	0	169.8	43.5	0	0	0	0	107.6

Retrieved 34 of 34 residues in 22.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).