A0A077YW05_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YW05, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 65 aa.

						>A0A077YW05_TRITR|A0A077YW05
MIAPIAAKRVGRTLKRVPAYFRFHLTKQWKRENDILNFERKKSPLASRRAGRPKEQTTQVHGSEN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.1	Very low	58.4	Low	241 Å²	241	113 Å²	113	100%	1.187	63%	0.627	S	S	*	*				0	102.7	0	-69.8	-178.1	-171.8	0	0	108.8
2	I	50.2	Low	59.5	Low	172 Å²	172	120.6 Å²	120.6	88%	0.882	64%	0.639	S	S	*	*			trans	-135	111.1	-179.8	-55.1	171.4	0	0	0	106.4
3	A	58.2	Low	60	Low	66 Å²	66	118.3 Å²	118.3	55%	0.545	63%	0.633	S	S	.	*			trans	156	30.1	149.9	0	0	0	0	0	117.9	I5	A3-I5 VanDerWaalsContact C-N 3.29Å; A3-I5 PolarHBondContact O-N 2.93Å
4	P	57.5	Low	60.5	Low	81 Å²	81	115.1 Å²	115.1	53%	0.526	62%	0.615	S	S	.	*	H	α-helix	trans	-73.5	-21.4	168.2	28.2	-29.8	0	0	0	112.7	K8	P4-K8 WeakPolarHBondContact O-CB 3.44Å; P4-K8 WeakPolarHBondContact O-CG 3.47Å; P4-K8 PolarHBondContact O-N 3.32Å
5	I	60.4	Low	61.5	Low	113 Å²	113	119 Å²	119	58%	0.579	62%	0.624	S	S	*	*	H	α-helix	trans	-71.3	-45.5	-171.1	-57.2	169	0	0	0	112	A3 K8 R9	A3-I5 VanDerWaalsContact C-N 3.29Å; A3-I5 PolarHBondContact O-N 2.93Å; I5-K8 PolarHBondContact O-N 3.14Å; I5-R9 PolarHBondContact O-N 3.23Å; I5-R9 VanDerWaalsContact O-N 3.08Å
6	A	60.6	Low	62.8	Low	64 Å²	64	125.7 Å²	125.7	53%	0.529	64%	0.639	S	S	.	*	H	α-helix	trans	-63	-47.8	-179.9	0	0	0	0	0	110.6	K8 R9 V10	A6-K8 VanDerWaalsContact C-N 3.35Å; A6-K8 PolarHBondContact O-N 3.08Å; A6-R9 PolarHBondContact O-N 3.49Å; A6-V10 WeakPolarHBondContact O-CG2 3.38Å; A6-V10 PolarHBondContact O-N 3.37Å
7	A	61.8	Low	63.8	Low	61 Å²	61	120 Å²	120	50%	0.504	61%	0.611	S	S	.	*	H	α-helix	trans	-59	-41.7	176.2	0	0	0	0	0	112.6	R9 G11	A7-R9 PolarHBondContact O-N 3.39Å; A7-G11 WeakPolarHBondContact O-CA 3.13Å; A7-G11 PolarHBondContact O-N 3.26Å
8	K	63.5	Low	65	Low	154 Å²	154	117.7 Å²	117.7	67%	0.67	61%	0.605	S	S	*	*	H	α-helix	trans	-60.9	-43	176.2	-78.6	174.6	-178.1	-173.5	0	112	P4 I5 A6 R12	P4-K8 WeakPolarHBondContact O-CB 3.44Å; P4-K8 WeakPolarHBondContact O-CG 3.47Å; P4-K8 PolarHBondContact O-N 3.32Å; I5-K8 PolarHBondContact O-N 3.14Å; A6-K8 VanDerWaalsContact C-N 3.35Å; A6-K8 PolarHBondContact O-N 3.08Å; K8-R12 PolarHBondContact O-N 3.44Å
9	R	63.5	Low	66.2	Low	181 Å²	181	115.7 Å²	115.7	68%	0.683	61%	0.609	S	S	*	*	H	α-helix	trans	-71.5	-53	179.9	-69.9	-175.1	-177.8	-176	1.2	111.7	I5 A6 A7 G11 R12 T13	I5-R9 PolarHBondContact O-N 3.23Å; I5-R9 VanDerWaalsContact O-N 3.08Å; A6-R9 PolarHBondContact O-N 3.49Å; A7-R9 PolarHBondContact O-N 3.39Å; R9-G11 VanDerWaalsContact C-N 3.26Å; R9-G11 PolarHBondContact O-N 3.1Å; R9-R12 PolarHBondContact O-N 3.18Å; R9-T13 PolarHBondContact O-N 3Å; R9-T13 PolarHBondContact O-OG1 3.36Å
10	V	61.4	Low	67.6	Low	81 Å²	81	117.8 Å²	117.8	49%	0.491	61%	0.609	S	S	.	*	H	α-helix	trans	-64	-35.7	179.7	-57.3	0	0	0	0	110.7	A6 R12 T13 L14	A6-V10 WeakPolarHBondContact O-CG2 3.38Å; A6-V10 PolarHBondContact O-N 3.37Å; V10-R12 PolarHBondContact O-N 2.87Å; V10-T13 PolarHBondContact O-N 3.08Å; V10-L14 HydrophobicContact CB-CD1 4.27Å; V10-L14 HydrophobicContact CG2-CD1 4.41Å; V10-L14 WeakPolarHBondContact O-CB 3.31Å; V10-L14 WeakPolarHBondContact O-CD1 3.21Å; V10-L14 WeakPolarHBondContact O-CG 3.4Å; V10-L14 PolarHBondContact O-N 3.47Å
11	G	64.3	Low	68.7	Low	29 Å²	29	118 Å²	118	30%	0.299	61%	0.605	S	S	.	*	H	α-helix	trans	-59.7	-44.7	174.6	0	0	0	0	0	112.7	A7 R9 K15	A7-G11 WeakPolarHBondContact O-CA 3.13Å; A7-G11 PolarHBondContact O-N 3.26Å; R9-G11 VanDerWaalsContact C-N 3.26Å; R9-G11 PolarHBondContact O-N 3.1Å; G11-K15 VanDerWaalsContact O-CG 3.26Å; G11-K15 WeakPolarHBondContact O-CG 3.28Å; G11-K15 PolarHBondContact O-N 2.76Å; G11-K15 VanDerWaalsContact O-N 3.09Å
12	R	71.1	Confident	70.8	Confident	204 Å²	204	111.8 Å²	111.8	77%	0.77	57%	0.569	S	S	*	*	H	α-helix	trans	-66.2	-43	175.7	-106.8	-172.9	163.9	176.1	-3	112.5	K8 R9 V10 K15	K8-R12 PolarHBondContact O-N 3.44Å; R9-R12 PolarHBondContact O-N 3.18Å; V10-R12 PolarHBondContact O-N 2.87Å; R12-K15 PolarHBondContact O-N 2.82Å
13	T	65.9	Low	72.7	Confident	91 Å²	91	109.2 Å²	109.2	56%	0.558	55%	0.552	S	S	*	*	H	α-helix	trans	-65.9	-49.9	178	-57.1	0	0	0	0	110.6	R9 V10 K15 R16 V17	R9-T13 PolarHBondContact O-N 3Å; R9-T13 PolarHBondContact O-OG1 3.36Å; V10-T13 PolarHBondContact O-N 3.08Å; T13-K15 PolarHBondContact O-N 3.33Å; T13-K15 VanDerWaalsContact O-N 3.16Å; T13-R16 CarbonylContact O-C 3.58Å; T13-R16 WeakPolarHBondContact O-CA 3.36Å; T13-R16 PolarHBondContact O-N 3.31Å; T13-V17 HydrophobicContact CG2-CG2 4.11Å; T13-V17 VanDerWaalsContact O-CG2 3.28Å; T13-V17 WeakPolarHBondContact O-CG2 3.3Å; T13-V17 PolarHBondContact O-N 2.82Å
14	L	67.8	Low	74.4	Confident	74 Å²	74	108.9 Å²	108.9	39%	0.387	54%	0.539	S	S	.	.	H	α-helix	trans	-58.8	-30.7	179.1	-68.9	172.1	0	0	0	112.4	V10 R16 V17 R22	V10-L14 HydrophobicContact CB-CD1 4.27Å; V10-L14 HydrophobicContact CG2-CD1 4.41Å; V10-L14 WeakPolarHBondContact O-CB 3.31Å; V10-L14 WeakPolarHBondContact O-CD1 3.21Å; V10-L14 WeakPolarHBondContact O-CG 3.4Å; V10-L14 PolarHBondContact O-N 3.47Å; L14-R16 VanDerWaalsContact C-N 3.34Å; L14-V17 PolarHBondContact O-N 3.15Å; L14-R22 PolarHBondContact O-NH2 2.97Å
15	K	74.7	Confident	75.9	Confident	173 Å²	173	109.8 Å²	109.8	75%	0.752	54%	0.539	S	S	*	.	H	α-helix	trans	-63.8	-35.8	172.2	-79.3	178.3	-177.6	-167.6	0	113.1	G11 R12 T13	G11-K15 VanDerWaalsContact O-CG 3.26Å; G11-K15 WeakPolarHBondContact O-CG 3.28Å; G11-K15 PolarHBondContact O-N 2.76Å; G11-K15 VanDerWaalsContact O-N 3.09Å; R12-K15 PolarHBondContact O-N 2.82Å; T13-K15 PolarHBondContact O-N 3.33Å; T13-K15 VanDerWaalsContact O-N 3.16Å
16	R	82.5	Confident	77.2	Confident	226 Å²	226	107.6 Å²	107.6	85%	0.853	53%	0.53	S	S	*	.	H	α-helix	trans	-88.9	-17.1	176.9	-66.7	-173.6	177	-175.6	-1.9	113.6	T13 L14 P18	T13-R16 CarbonylContact O-C 3.58Å; T13-R16 WeakPolarHBondContact O-CA 3.36Å; T13-R16 PolarHBondContact O-N 3.31Å; L14-R16 VanDerWaalsContact C-N 3.34Å; R16-P18 VanDerWaalsContact O-CD 3.31Å; R16-P18 WeakPolarHBondContact O-CD 3.46Å
17	V	79.5	Confident	78.7	Confident	29 Å²	29	109.3 Å²	109.3	18%	0.176	53%	0.526	C	S	.	.	S	Bend	trans	-62.5	120.9	176.6	170.7	0	0	0	0	108.6	T13 L14 F21 R22	T13-V17 HydrophobicContact CG2-CG2 4.11Å; T13-V17 VanDerWaalsContact O-CG2 3.28Å; T13-V17 WeakPolarHBondContact O-CG2 3.3Å; T13-V17 PolarHBondContact O-N 2.82Å; L14-V17 PolarHBondContact O-N 3.15Å; V17-F21 HydrophobicContact CG1-CB 3.52Å; V17-R22 HydrophobicContact CG1-CB 4.43Å
18	P	85.7	Confident	80	Confident	78 Å²	78	110.5 Å²	110.5	51%	0.506	52%	0.521	S	S	.	.			trans	-54.9	150.4	178.2	-24.5	32	0	0	0	112	R16 Y20 F21 R22	R16-P18 VanDerWaalsContact O-CD 3.31Å; R16-P18 WeakPolarHBondContact O-CD 3.46Å; P18-Y20 PolarHBondContact O-N 3.12Å; P18-Y20 VanDerWaalsContact O-N 3.12Å; P18-F21 HydrophobicContact CB-CD2 4Å; P18-F21 HydrophobicContact CG-CD2 3.93Å; P18-F21 HydrophobicContact CG-CE2 4.27Å; P18-F21 PolarHBondContact O-N 3.47Å; P18-F21 VanDerWaalsContact O-N 3.13Å; P18-R22 PolarHBondContact O-N 3.19Å; P18-R22 VanDerWaalsContact O-N 3.15Å
19	A	88.4	Confident	81.3	Confident	81 Å²	81	111.1 Å²	111.1	67%	0.669	52%	0.519	S	S	*	.	H	α-helix	trans	-53.9	-37.4	-174.1	0	0	0	0	0	113.1	R22 F23	A19-R22 WeakPolarHBondContact O-CB 3.39Å; A19-R22 PolarHBondContact O-N 2.94Å; A19-F23 WeakPolarHBondContact O-CB 3.24Å; A19-F23 PolarHBondContact O-N 3.41Å
20	Y	94.6	Very high	82.4	Confident	156 Å²	156	109.3 Å²	109.3	61%	0.612	52%	0.517	S	S	*	.	H	α-helix	trans	-61.2	-50.5	178.2	-179.7	-101	0	0	0	112.8	P18 R22 F23 H24	P18-Y20 PolarHBondContact O-N 3.12Å; P18-Y20 VanDerWaalsContact O-N 3.12Å; Y20-R22 VanDerWaalsContact C-N 3.29Å; Y20-R22 PolarHBondContact O-N 2.76Å; Y20-F23 WeakPolarHBondContact O-CB 3.41Å; Y20-F23 PolarHBondContact O-N 2.79Å; Y20-F23 VanDerWaalsContact O-N 3.14Å; Y20-H24 AromaticContact CD1-CD2 3.7Å; Y20-H24 AromaticContact CD2-CD2 3.92Å; Y20-H24 AromaticContact CD2-NE2 3.73Å; Y20-H24 AromaticContact CE1-CD2 3.4Å; Y20-H24 WeakPolarHBondContact CE1-CD2 3.47Å; Y20-H24 AromaticContact CE1-NE2 3.47Å; Y20-H24 WeakPolarHBondContact CE1-NE2 3.37Å; Y20-H24 AromaticContact CE2-CD2 3.66Å; Y20-H24 AromaticContact CE2-NE2 3.05Å; Y20-H24 WeakPolarHBondContact CE2-NE2 3.45Å; Y20-H24 AromaticContact CG-CD2 3.96Å; Y20-H24 AromaticContact CZ-CD2 3.39Å; Y20-H24 AromaticContact CZ-CE1 3.98Å; Y20-H24 AromaticContact CZ-NE2 2.9Å; Y20-H24 PolarHBondContact O-CD2 3.42Å; Y20-H24 PolarHBondContact O-N 3.07Å; Y20-H24 PolarHBondContact OH-NE2 3.46Å; Y20-H24 VanDerWaalsContact OH-NE2 3.09Å
21	F	89.5	Confident	83.8	Confident	122 Å²	122	111 Å²	111	54%	0.535	51%	0.514	S	S	.	.	H	α-helix	trans	-62	-40.1	176.4	-69.1	-76	0	0	0	111.5	V17 P18 F23 H24 L25	V17-F21 HydrophobicContact CG1-CB 3.52Å; P18-F21 HydrophobicContact CB-CD2 4Å; P18-F21 HydrophobicContact CG-CD2 3.93Å; P18-F21 HydrophobicContact CG-CE2 4.27Å; P18-F21 PolarHBondContact O-N 3.47Å; P18-F21 VanDerWaalsContact O-N 3.13Å; F21-F23 VanDerWaalsContact C-N 3.32Å; F21-F23 PolarHBondContact O-N 2.97Å; F21-H24 PolarHBondContact O-N 3.22Å; F21-L25 VanDerWaalsContact O-CG 3.31Å; F21-L25 WeakPolarHBondContact O-CG 3.44Å; F21-L25 PolarHBondContact O-N 2.7Å
22	R	85.3	Confident	85	Confident	111 Å²	111	114.4 Å²	114.4	42%	0.419	52%	0.522	S	S	.	.	H	α-helix	trans	-61.3	-42.4	175.1	-170.5	-175.4	-60.8	174.6	6.7	111.5	L14 V17 P18 A19 Y20 H24 L25 T26	L14-R22 PolarHBondContact O-NH2 2.97Å; V17-R22 HydrophobicContact CG1-CB 4.43Å; P18-R22 PolarHBondContact O-N 3.19Å; P18-R22 VanDerWaalsContact O-N 3.15Å; A19-R22 WeakPolarHBondContact O-CB 3.39Å; A19-R22 PolarHBondContact O-N 2.94Å; Y20-R22 VanDerWaalsContact C-N 3.29Å; Y20-R22 PolarHBondContact O-N 2.76Å; R22-H24 VanDerWaalsContact C-N 3.34Å; R22-L25 PolarHBondContact O-N 3.1Å; R22-T26 HydrophobicContact CG-CG2 4.31Å; R22-T26 WeakPolarHBondContact O-CB 3.34Å; R22-T26 VanDerWaalsContact O-CG2 3.3Å; R22-T26 WeakPolarHBondContact O-CG2 3.42Å; R22-T26 PolarHBondContact O-N 2.83Å; R22-T26 PolarHBondContact O-OG1 2.87Å
23	F	91.6	Very high	85.6	Confident	118 Å²	118	106.8 Å²	106.8	52%	0.518	50%	0.497	S	S	.	.	H	α-helix	trans	-58.8	-46.7	174.7	174	-101.1	0	0	0	110.9	A19 Y20 F21 T26 K27	A19-F23 WeakPolarHBondContact O-CB 3.24Å; A19-F23 PolarHBondContact O-N 3.41Å; Y20-F23 WeakPolarHBondContact O-CB 3.41Å; Y20-F23 PolarHBondContact O-N 2.79Å; Y20-F23 VanDerWaalsContact O-N 3.14Å; F21-F23 VanDerWaalsContact C-N 3.32Å; F21-F23 PolarHBondContact O-N 2.97Å; F23-T26 PolarHBondContact O-OG1 3.13Å; F23-K27 HydrophobicContact CE1-CD 4.11Å; F23-K27 HydrophobicContact CZ-CD 4.2Å; F23-K27 WeakPolarHBondContact O-CB 2.95Å; F23-K27 PolarHBondContact O-N 2.9Å
24	H	93.7	Very high	86.7	Confident	59 Å²	59	107.8 Å²	107.8	27%	0.273	50%	0.499	S	S	.	.	H	α-helix	trans	-63.1	-47.2	176.5	-77.6	-71.8	0	0	0	112.7	Y20 F21 R22 T26 K27 Q28	Y20-H24 AromaticContact CD1-CD2 3.7Å; Y20-H24 AromaticContact CD2-CD2 3.92Å; Y20-H24 AromaticContact CD2-NE2 3.73Å; Y20-H24 AromaticContact CE1-CD2 3.4Å; Y20-H24 WeakPolarHBondContact CE1-CD2 3.47Å; Y20-H24 AromaticContact CE1-NE2 3.47Å; Y20-H24 WeakPolarHBondContact CE1-NE2 3.37Å; Y20-H24 AromaticContact CE2-CD2 3.66Å; Y20-H24 AromaticContact CE2-NE2 3.05Å; Y20-H24 WeakPolarHBondContact CE2-NE2 3.45Å; Y20-H24 AromaticContact CG-CD2 3.96Å; Y20-H24 AromaticContact CZ-CD2 3.39Å; Y20-H24 AromaticContact CZ-CE1 3.98Å; Y20-H24 AromaticContact CZ-NE2 2.9Å; Y20-H24 PolarHBondContact O-CD2 3.42Å; Y20-H24 PolarHBondContact O-N 3.07Å; Y20-H24 PolarHBondContact OH-NE2 3.46Å; Y20-H24 VanDerWaalsContact OH-NE2 3.09Å; F21-H24 PolarHBondContact O-N 3.22Å; R22-H24 VanDerWaalsContact C-N 3.34Å; H24-T26 PolarHBondContact O-N 3.49Å; H24-K27 PolarHBondContact O-N 3.44Å; H24-Q28 VanDerWaalsContact O-CG 3.24Å; H24-Q28 WeakPolarHBondContact O-CG 3.17Å; H24-Q28 PolarHBondContact O-N 3.3Å
25	L	87.7	Confident	87.6	Confident	101 Å²	101	107.6 Å²	107.6	53%	0.529	50%	0.497	S	S	.	.	H	α-helix	trans	-62.9	-43.9	179.5	-67.7	176.4	0	0	0	112.1	F21 R22 Q28 W29	F21-L25 VanDerWaalsContact O-CG 3.31Å; F21-L25 WeakPolarHBondContact O-CG 3.44Å; F21-L25 PolarHBondContact O-N 2.7Å; R22-L25 PolarHBondContact O-N 3.1Å; L25-Q28 PolarHBondContact O-N 2.95Å; L25-W29 WeakPolarHBondContact O-CB 3.48Å; L25-W29 PolarHBondContact O-N 3.36Å
26	T	87.5	Confident	88	Confident	66 Å²	66	103 Å²	103	41%	0.405	48%	0.481	S	S	.	.	H	α-helix	trans	-67.4	-35.6	176	54.7	0	0	0	0	112	R22 F23 H24 K30	R22-T26 HydrophobicContact CG-CG2 4.31Å; R22-T26 WeakPolarHBondContact O-CB 3.34Å; R22-T26 VanDerWaalsContact O-CG2 3.3Å; R22-T26 WeakPolarHBondContact O-CG2 3.42Å; R22-T26 PolarHBondContact O-N 2.83Å; R22-T26 PolarHBondContact O-OG1 2.87Å; F23-T26 PolarHBondContact O-OG1 3.13Å; H24-T26 PolarHBondContact O-N 3.49Å; T26-K30 WeakPolarHBondContact O-CB 3.35Å; T26-K30 VanDerWaalsContact O-CG 3.28Å; T26-K30 WeakPolarHBondContact O-CG 3.28Å; T26-K30 PolarHBondContact O-N 3.42Å
27	K	92.4	Very high	87.8	Confident	101 Å²	101	95.2 Å²	95.2	44%	0.439	46%	0.456	S	S	.	.	H	α-helix	trans	-65.6	-44.8	173.1	-175.3	175.4	-177.6	176	0	111.9	F23 H24 K30 R31	F23-K27 HydrophobicContact CE1-CD 4.11Å; F23-K27 HydrophobicContact CZ-CD 4.2Å; F23-K27 WeakPolarHBondContact O-CB 2.95Å; F23-K27 PolarHBondContact O-N 2.9Å; H24-K27 PolarHBondContact O-N 3.44Å; K27-K30 PolarHBondContact O-N 2.8Å; K27-R31 WeakPolarHBondContact O-CB 3.35Å; K27-R31 PolarHBondContact O-N 2.88Å
28	Q	90	Very high	87.8	Confident	85 Å²	85	99.6 Å²	99.6	40%	0.397	47%	0.473	S	S	.	.	H	α-helix	trans	-61.4	-49	175.1	-66.8	-62.3	-9.4	0	0	110.1	H24 L25 K30 R31 E32	H24-Q28 VanDerWaalsContact O-CG 3.24Å; H24-Q28 WeakPolarHBondContact O-CG 3.17Å; H24-Q28 PolarHBondContact O-N 3.3Å; L25-Q28 PolarHBondContact O-N 2.95Å; Q28-K30 VanDerWaalsContact C-N 3.34Å; Q28-K30 PolarHBondContact O-N 2.89Å; Q28-R31 WeakPolarHBondContact O-CB 3.15Å; Q28-R31 PolarHBondContact O-N 3.11Å; Q28-R31 VanDerWaalsContact O-N 3.11Å; Q28-E32 WeakPolarHBondContact O-CG 3.31Å; Q28-E32 PolarHBondContact O-N 3.24Å
29	W	89.5	Confident	87.5	Confident	167 Å²	167	101.3 Å²	101.3	63%	0.633	47%	0.474	S	S	*	.	H	α-helix	trans	-60.5	-41	177.5	-178.6	80.5	0	0	0	113.1	L25 E32 N33	L25-W29 WeakPolarHBondContact O-CB 3.48Å; L25-W29 PolarHBondContact O-N 3.36Å; W29-E32 PolarHBondContact O-N 2.78Å; W29-N33 WeakPolarHBondContact CH2-ND2 3.38Å; W29-N33 WeakPolarHBondContact CZ2-ND2 3.4Å; W29-N33 WeakPolarHBondContact CZ3-ND2 3.35Å; W29-N33 WeakPolarHBondContact O-CB 3.3Å; W29-N33 PolarHBondContact O-N 3.47Å
30	K	87.5	Confident	86.7	Confident	144 Å²	144	102.7 Å²	102.7	63%	0.626	46%	0.462	S	S	*	.	H	α-helix	trans	-62.9	-41.9	174.2	-79.3	-177.8	178.7	-171.2	0	111.7	T26 K27 Q28 N33 D34	T26-K30 WeakPolarHBondContact O-CB 3.35Å; T26-K30 VanDerWaalsContact O-CG 3.28Å; T26-K30 WeakPolarHBondContact O-CG 3.28Å; T26-K30 PolarHBondContact O-N 3.42Å; K27-K30 PolarHBondContact O-N 2.8Å; Q28-K30 VanDerWaalsContact C-N 3.34Å; Q28-K30 PolarHBondContact O-N 2.89Å; K30-N33 PolarHBondContact O-N 3.4Å; K30-D34 WeakPolarHBondContact O-CB 3.24Å; K30-D34 PolarHBondContact O-N 2.93Å
31	R	90.4	Very high	85.5	Confident	115 Å²	115	104.3 Å²	104.3	43%	0.434	47%	0.472	S	S	.	.	H	α-helix	trans	-62.9	-49.2	176.5	-177	-172.3	-67.4	147.7	-9.9	111.3	K27 Q28 N33 D34 I35	K27-R31 WeakPolarHBondContact O-CB 3.35Å; K27-R31 PolarHBondContact O-N 2.88Å; Q28-R31 WeakPolarHBondContact O-CB 3.15Å; Q28-R31 PolarHBondContact O-N 3.11Å; Q28-R31 VanDerWaalsContact O-N 3.11Å; R31-N33 VanDerWaalsContact C-N 3.31Å; R31-N33 PolarHBondContact O-N 2.86Å; R31-D34 PolarHBondContact O-N 3.4Å; R31-D34 VanDerWaalsContact O-N 3.13Å; R31-I35 HydrophobicContact CG-CD1 3.84Å; R31-I35 HydrophobicContact CG-CG1 4.4Å; R31-I35 VanDerWaalsContact O-CG1 3.28Å; R31-I35 WeakPolarHBondContact O-CG1 3.43Å; R31-I35 PolarHBondContact O-N 3.16Å
32	E	89.3	Confident	84.3	Confident	102 Å²	102	105.5 Å²	105.5	48%	0.477	48%	0.477	S	S	.	.	H	α-helix	trans	-59.3	-43.1	177.2	-67.4	-59.5	135.9	0	0	111.3	Q28 W29 D34 I35 L36	Q28-E32 WeakPolarHBondContact O-CG 3.31Å; Q28-E32 PolarHBondContact O-N 3.24Å; W29-E32 PolarHBondContact O-N 2.78Å; E32-D34 VanDerWaalsContact C-N 3.33Å; E32-D34 PolarHBondContact O-N 3.03Å; E32-I35 PolarHBondContact O-N 2.88Å; E32-L36 WeakPolarHBondContact O-CB 3.05Å; E32-L36 WeakPolarHBondContact O-CG 3.47Å; E32-L36 PolarHBondContact O-N 3.45Å
33	N	84.8	Confident	83	Confident	43 Å²	43	102.9 Å²	102.9	23%	0.23	48%	0.476	C	S	.	.	H	α-helix	trans	-64.8	-37	175.3	-92.7	-29.8	0	0	0	113.3	W29 K30 R31 N37	W29-N33 WeakPolarHBondContact CH2-ND2 3.38Å; W29-N33 WeakPolarHBondContact CZ2-ND2 3.4Å; W29-N33 WeakPolarHBondContact CZ3-ND2 3.35Å; W29-N33 WeakPolarHBondContact O-CB 3.3Å; W29-N33 PolarHBondContact O-N 3.47Å; K30-N33 PolarHBondContact O-N 3.4Å; R31-N33 VanDerWaalsContact C-N 3.31Å; R31-N33 PolarHBondContact O-N 2.86Å; N33-N37 VanDerWaalsContact O-CB 3.24Å; N33-N37 WeakPolarHBondContact O-CB 3.37Å; N33-N37 PolarHBondContact O-N 3.22Å; N33-N37 PolarHBondContact O-ND2 2.84Å; N33-N37 VanDerWaalsContact O-ND2 3.1Å
34	D	87.8	Confident	81.4	Confident	112 Å²	112	102.9 Å²	102.9	60%	0.599	49%	0.487	S	S	*	.	H	α-helix	trans	-70.1	-41.4	177.4	-166.3	49.5	0	0	0	111.4	K30 R31 E32 N37 F38	K30-D34 WeakPolarHBondContact O-CB 3.24Å; K30-D34 PolarHBondContact O-N 2.93Å; R31-D34 PolarHBondContact O-N 3.4Å; R31-D34 VanDerWaalsContact O-N 3.13Å; E32-D34 VanDerWaalsContact C-N 3.33Å; E32-D34 PolarHBondContact O-N 3.03Å; D34-N37 CarbonylContact O-C 3.54Å; D34-N37 WeakPolarHBondContact O-CB 3.18Å; D34-N37 PolarHBondContact O-N 3.37Å; D34-N37 VanDerWaalsContact O-N 3.15Å; D34-F38 WeakPolarHBondContact O-CB 3.05Å; D34-F38 PolarHBondContact O-N 3.09Å
35	I	87	Confident	79.8	Confident	70 Å²	70	106 Å²	106	36%	0.359	51%	0.505	S	S	.	.	H	α-helix	trans	-58.9	-51.4	172	-68.9	167.4	0	0	0	109.9	R31 E32 N37 F38 E39	R31-I35 HydrophobicContact CG-CD1 3.84Å; R31-I35 HydrophobicContact CG-CG1 4.4Å; R31-I35 VanDerWaalsContact O-CG1 3.28Å; R31-I35 WeakPolarHBondContact O-CG1 3.43Å; R31-I35 PolarHBondContact O-N 3.16Å; E32-I35 PolarHBondContact O-N 2.88Å; I35-N37 VanDerWaalsContact C-N 3.27Å; I35-N37 PolarHBondContact O-N 3.14Å; I35-F38 WeakPolarHBondContact O-CB 3.13Å; I35-F38 PolarHBondContact O-N 3.47Å; I35-F38 VanDerWaalsContact O-N 3.12Å; I35-E39 PolarHBondContact O-N 3.4Å
36	L	82.9	Confident	78.3	Confident	78 Å²	78	102.1 Å²	102.1	41%	0.408	49%	0.488	S	S	.	.	H	α-helix	trans	-58.8	-40.9	175.5	-71.2	170.9	0	0	0	110.8	E32 E39 R40	E32-L36 WeakPolarHBondContact O-CB 3.05Å; E32-L36 WeakPolarHBondContact O-CG 3.47Å; E32-L36 PolarHBondContact O-N 3.45Å; L36-E39 PolarHBondContact O-N 3.33Å; L36-R40 VanDerWaalsContact O-CB 3.3Å; L36-R40 WeakPolarHBondContact O-CB 3.26Å; L36-R40 WeakPolarHBondContact O-CG 3.47Å; L36-R40 PolarHBondContact O-N 3.34Å
37	N	79.5	Confident	76.7	Confident	62 Å²	62	103.9 Å²	103.9	33%	0.332	50%	0.503	S	S	.	.	H	α-helix	trans	-66.5	-35.9	176.3	-79.6	-29.7	0	0	0	113.4	N33 D34 I35 R40 K41	N33-N37 VanDerWaalsContact O-CB 3.24Å; N33-N37 WeakPolarHBondContact O-CB 3.37Å; N33-N37 PolarHBondContact O-N 3.22Å; N33-N37 PolarHBondContact O-ND2 2.84Å; N33-N37 VanDerWaalsContact O-ND2 3.1Å; D34-N37 CarbonylContact O-C 3.54Å; D34-N37 WeakPolarHBondContact O-CB 3.18Å; D34-N37 PolarHBondContact O-N 3.37Å; D34-N37 VanDerWaalsContact O-N 3.15Å; I35-N37 VanDerWaalsContact C-N 3.27Å; I35-N37 PolarHBondContact O-N 3.14Å; N37-R40 CarbonylContact O-C 3.37Å; N37-R40 PolarHBondContact O-N 2.81Å; N37-R40 VanDerWaalsContact OD1-CZ 3.23Å; N37-R40 PolarHBondContact OD1-NE 3.17Å; N37-R40 PolarHBondContact OD1-NH2 2.98Å; N37-K41 WeakPolarHBondContact O-CB 3.36Å; N37-K41 VanDerWaalsContact O-CG 3.31Å; N37-K41 WeakPolarHBondContact O-CG 3.4Å; N37-K41 PolarHBondContact O-N 2.95Å
38	F	79.8	Confident	74.8	Confident	121 Å²	121	109.1 Å²	109.1	53%	0.531	52%	0.52	S	S	.	.	H	α-helix	trans	-66.1	-45.1	176.3	-179.8	-111.4	0	0	0	110.6	D34 I35 R40 K41 K42	D34-F38 WeakPolarHBondContact O-CB 3.05Å; D34-F38 PolarHBondContact O-N 3.09Å; I35-F38 WeakPolarHBondContact O-CB 3.13Å; I35-F38 PolarHBondContact O-N 3.47Å; I35-F38 VanDerWaalsContact O-N 3.12Å; F38-R40 VanDerWaalsContact C-N 3.33Å; F38-R40 PolarHBondContact O-N 3.19Å; F38-K41 PolarHBondContact O-N 3.08Å; F38-K42 HydrophobicContact CD1-CD 4.5Å; F38-K42 HydrophobicContact CE1-CD 4.25Å; F38-K42 HydrophobicContact CZ-CD 4.47Å; F38-K42 WeakPolarHBondContact O-CG 3.49Å; F38-K42 PolarHBondContact O-N 3.47Å
39	E	78.9	Confident	73.3	Confident	114 Å²	114	116.5 Å²	116.5	53%	0.533	55%	0.545	S	S	.	.	H	α-helix	trans	-60.7	-42.4	170.6	-68.8	176.9	-166.4	0	0	111.6	I35 L36 K42 S43	I35-E39 PolarHBondContact O-N 3.4Å; L36-E39 PolarHBondContact O-N 3.33Å; E39-K42 WeakPolarHBondContact O-CB 3.5Å; E39-K42 PolarHBondContact O-N 3Å; E39-S43 WeakPolarHBondContact O-CB 3.28Å; E39-S43 PolarHBondContact O-N 2.9Å; E39-S43 VanDerWaalsContact O-N 3.08Å
40	R	70.7	Confident	71.7	Confident	109 Å²	109	112.4 Å²	112.4	41%	0.411	55%	0.546	S	S	.	.	H	α-helix	trans	-64.2	-41	176.7	-75.7	-167.1	-81.6	-123.7	2.1	112.8	L36 N37 F38 K42 S43 A46	L36-R40 VanDerWaalsContact O-CB 3.3Å; L36-R40 WeakPolarHBondContact O-CB 3.26Å; L36-R40 WeakPolarHBondContact O-CG 3.47Å; L36-R40 PolarHBondContact O-N 3.34Å; N37-R40 CarbonylContact O-C 3.37Å; N37-R40 PolarHBondContact O-N 2.81Å; N37-R40 VanDerWaalsContact OD1-CZ 3.23Å; N37-R40 PolarHBondContact OD1-NE 3.17Å; N37-R40 PolarHBondContact OD1-NH2 2.98Å; F38-R40 VanDerWaalsContact C-N 3.33Å; F38-R40 PolarHBondContact O-N 3.19Å; R40-K42 PolarHBondContact O-N 3.24Å; R40-S43 CarbonylContact O-C 3.53Å; R40-S43 PolarHBondContact O-N 2.74Å; R40-A46 HydrophobicContact CB-CB 3.44Å; R40-A46 VanDerWaalsContact CB-CB 3.44Å; R40-A46 HydrophobicContact CG-CB 3.31Å
41	K	69.1	Low	69.9	Low	190 Å²	190	108.4 Å²	108.4	83%	0.826	55%	0.546	S	S	*	.	H	α-helix	trans	-65.6	-28.2	176.9	-77.4	-179.5	178.5	-176.5	0	111.6	N37 F38 S43	N37-K41 WeakPolarHBondContact O-CB 3.36Å; N37-K41 VanDerWaalsContact O-CG 3.31Å; N37-K41 WeakPolarHBondContact O-CG 3.4Å; N37-K41 PolarHBondContact O-N 2.95Å; F38-K41 PolarHBondContact O-N 3.08Å; K41-S43 VanDerWaalsContact C-N 3.35Å
42	K	64.1	Low	68	Low	148 Å²	148	113.7 Å²	113.7	64%	0.643	57%	0.566	S	S	*	*	H	α-helix	trans	-77.8	-18.7	171	-67.1	177.5	177.6	-169.5	0	113.4	F38 E39 R40	F38-K42 HydrophobicContact CD1-CD 4.5Å; F38-K42 HydrophobicContact CE1-CD 4.25Å; F38-K42 HydrophobicContact CZ-CD 4.47Å; F38-K42 WeakPolarHBondContact O-CG 3.49Å; F38-K42 PolarHBondContact O-N 3.47Å; E39-K42 WeakPolarHBondContact O-CB 3.5Å; E39-K42 PolarHBondContact O-N 3Å; R40-K42 PolarHBondContact O-N 3.24Å
43	S	58.9	Low	66	Low	55 Å²	55	114 Å²	114	39%	0.385	58%	0.577	S	S	.	*			trans	-118.1	107.3	-173.5	-170.1	0	0	0	0	112.1	E39 R40 K41 L45 A46	E39-S43 WeakPolarHBondContact O-CB 3.28Å; E39-S43 PolarHBondContact O-N 2.9Å; E39-S43 VanDerWaalsContact O-N 3.08Å; R40-S43 CarbonylContact O-C 3.53Å; R40-S43 PolarHBondContact O-N 2.74Å; K41-S43 VanDerWaalsContact C-N 3.35Å; S43-L45 PolarHBondContact O-N 3.13Å; S43-A46 PolarHBondContact O-N 3.31Å; S43-A46 VanDerWaalsContact O-N 3.14Å
44	P	58.9	Low	64.4	Low	118 Å²	118	120.4 Å²	120.4	77%	0.766	60%	0.603	S	S	*	*	G	3₁₀ helix	trans	-58.9	-17.7	-178.3	20.8	-30.6	0	0	0	113.9	A46 S47	P44-A46 VanDerWaalsContact C-N 3.26Å; P44-A46 PolarHBondContact O-N 3.15Å; P44-S47 PolarHBondContact O-N 3.31Å
45	L	58.9	Low	62.9	Low	124 Å²	124	124 Å²	124	65%	0.649	62%	0.616	S	S	*	*	G	3₁₀ helix	trans	-67.7	-24.9	-179.6	-165.3	63.2	0	0	0	113.3	S43 S47 R48	S43-L45 PolarHBondContact O-N 3.13Å; L45-S47 VanDerWaalsContact C-N 3.31Å; L45-S47 PolarHBondContact O-N 3.12Å; L45-R48 PolarHBondContact O-N 2.83Å
46	A	56.3	Low	61.1	Low	21 Å²	21	130.4 Å²	130.4	17%	0.174	64%	0.644	C	S	.	*	G	3₁₀ helix	trans	-72	-24.4	-179.8	0	0	0	0	0	113.9	R40 S43 P44 R48 R49 A50	R40-A46 HydrophobicContact CB-CB 3.44Å; R40-A46 VanDerWaalsContact CB-CB 3.44Å; R40-A46 HydrophobicContact CG-CB 3.31Å; S43-A46 PolarHBondContact O-N 3.31Å; S43-A46 VanDerWaalsContact O-N 3.14Å; P44-A46 VanDerWaalsContact C-N 3.26Å; P44-A46 PolarHBondContact O-N 3.15Å; A46-R48 PolarHBondContact O-N 3.21Å; A46-R48 VanDerWaalsContact O-N 3.1Å; A46-R49 PolarHBondContact O-N 3.44Å; A46-R49 VanDerWaalsContact O-N 3.08Å; A46-A50 PolarHBondContact O-N 3.45Å
47	S	54.7	Low	59.2	Low	103 Å²	103	132.2 Å²	132.2	72%	0.72	66%	0.659	S	S	*	*	G	3₁₀ helix	trans	-59.8	-21	174.1	-147	0	0	0	0	111.8	P44 L45	P44-S47 PolarHBondContact O-N 3.31Å; L45-S47 VanDerWaalsContact C-N 3.31Å; L45-S47 PolarHBondContact O-N 3.12Å
48	R	51.4	Low	57.7	Low	211 Å²	211	134.9 Å²	134.9	80%	0.796	68%	0.677	S	S	*	*	G	3₁₀ helix	trans	-87.1	-22.1	177.2	-54.9	-174.6	98.5	176.3	6.5	114.3	L45 A46	L45-R48 PolarHBondContact O-N 2.83Å; A46-R48 PolarHBondContact O-N 3.21Å; A46-R48 VanDerWaalsContact O-N 3.1Å
49	R	58.3	Low	56.7	Low	240 Å²	240	138 Å²	138	91%	0.906	69%	0.693	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.7	-14.5	176.6	-79.4	-171.3	87.6	161.7	5.9	113.7	A46 G51	A46-R49 PolarHBondContact O-N 3.44Å; A46-R49 VanDerWaalsContact O-N 3.08Å; R49-G51 PolarHBondContact O-N 3.16Å
50	A	57	Low	55.9	Low	80 Å²	80	138.9 Å²	138.9	66%	0.661	71%	0.706	S	S	*	*			trans	-68.6	44.2	157.1	0	0	0	0	0	110.8	A46 R52	A46-A50 PolarHBondContact O-N 3.45Å; A50-R52 PolarHBondContact O-N 3.09Å; A50-R52 VanDerWaalsContact O-N 3.07Å
51	G	49.9	Very low	54.5	Low	60 Å²	60	142.2 Å²	142.2	62%	0.619	73%	0.726	S	S	*	*			trans	-81.3	45.4	172.4	0	0	0	0	0	111.4	R49 P53	R49-G51 PolarHBondContact O-N 3.16Å; G51-P53 VanDerWaalsContact C-CD 3.46Å; G51-P53 WeakPolarHBondContact O-CD 3.31Å
52	R	49.5	Very low	53.7	Low	226 Å²	226	136.3 Å²	136.3	85%	0.853	72%	0.719	S	S	*	*			trans	-106.1	87.8	147.6	-171.2	158.4	179.4	142.7	-2.7	106.6	A50 K54	A50-R52 PolarHBondContact O-N 3.09Å; A50-R52 VanDerWaalsContact O-N 3.07Å; R52-K54 PolarHBondContact O-N 2.89Å
53	P	47.9	Very low	53.2	Low	110 Å²	110	133.9 Å²	133.9	71%	0.714	72%	0.721	S	S	*	*			trans	-85	97.9	-172.9	32.9	-27.6	0	0	0	108	G51	G51-P53 VanDerWaalsContact C-CD 3.46Å; G51-P53 WeakPolarHBondContact O-CD 3.31Å
54	K	52.1	Low	53.3	Low	177 Å²	177	141 Å²	141	77%	0.77	75%	0.748	S	S	*	*			trans	-150.8	135.7	164.7	-69.2	-158.6	174.4	-163.3	0	107.3	R52	R52-K54 PolarHBondContact O-N 2.89Å
55	E	55.1	Low	52.4	Low	188 Å²	188	145.7 Å²	145.7	88%	0.879	77%	0.767	S	S	*	*			trans	93	36.7	-177.5	-51.5	171.7	-160	0	0	115.9
56	Q	50.4	Low	52.1	Low	203 Å²	203	146.8 Å²	146.8	95%	0.949	77%	0.772	S	S	*	*			trans	-100.8	76.9	140	-82.5	-176.1	-2.5	0	0	107
57	T	42.9	Very low	51.9	Low	117 Å²	117	153.4 Å²	153.4	72%	0.718	80%	0.804	S	S	*	*			trans	-125.9	107.5	172.2	-77.8	0	0	0	0	107
58	T	47.4	Very low	51.7	Low	117 Å²	117	156.2 Å²	156.2	72%	0.718	81%	0.809	S	S	*	*			trans	74.9	124.3	158	-26.4	0	0	0	0	113.9
59	Q	59.4	Low	51.8	Low	187 Å²	187	152.9 Å²	152.9	87%	0.874	81%	0.809	S	S	*	*				-148.4	145.3	59.2	-94.3	171.9	-22.5	0	0	113.1
60	V	61.1	Low	51.4	Low	132 Å²	132	147.5 Å²	147.5	80%	0.8	80%	0.803	S	S	*	*			trans	-46.2	137.3	172.6	177.6	0	0	0	0	111.5	G62	V60-G62 PolarHBondContact O-N 2.89Å
61	H	40.5	Very low	51	Low	180 Å²	180	152 Å²	152	83%	0.833	81%	0.813	S	S	*	*			trans	-54.6	97.9	166.3	-173	35.1	0	0	0	109.4
62	G	52.1	Low	51.1	Low	66 Å²	66	158.6 Å²	158.6	68%	0.68	83%	0.827	S	S	*	*			trans	-86.3	108.8	166.1	0	0	0	0	0	108.3	V60 E64	V60-G62 PolarHBondContact O-N 2.89Å; G62-E64 PolarHBondContact O-N 2.71Å
63	S	54.4	Low	51.2	Low	97 Å²	97	153.4 Å²	153.4	68%	0.678	83%	0.825	S	S	*	*			trans	-69	105.1	165.5	60	0	0	0	0	107.8	N65	S63-N65 VanDerWaalsContact C-N 3.34Å; S63-N65 PolarHBondContact O-N 3.42Å
64	E	61.3	Low	51.4	Low	204 Å²	204	157 Å²	157	95%	0.953	83%	0.834	S	S	*	*			trans	-77.5	102.1	156.5	-81.8	-175.3	158.4	0	0	107.2	G62	G62-E64 PolarHBondContact O-N 2.71Å
65	N	40.7	Very low	51.4	Low	216 Å²	216	155.2 Å²	155.2	100%	1.155	84%	0.84	S	S	*	*			trans	-63.6	0	159.6	-156.6	106.3	0	0	0	110.7	S63	S63-N65 VanDerWaalsContact C-N 3.34Å; S63-N65 PolarHBondContact O-N 3.42Å

Retrieved 65 of 65 residues in 11.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).