A0A077YW78_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YW78, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 54 aa.

						>A0A077YW78_TRITR|A0A077YW78
MSAWNASQIVPFQESFDSLLLFGAAQPHGHFQCLKVSFGRQPLLAFRLPKDDRI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.8	Very low	51.6	Low	247 Å²	247	142.4 Å²	142.4	100%	1.217	80%	0.804	S	S	*	*				0	101.3	0	-70.4	173.5	171.4	0	0	106.8
2	S	50.6	Low	51.7	Low	129 Å²	129	146.5 Å²	146.5	90%	0.902	81%	0.807	S	S	*	*			trans	-83.6	127.2	-170	-55.4	0	0	0	0	111.1
3	A	50.4	Low	51.8	Low	101 Å²	101	146.3 Å²	146.3	84%	0.835	80%	0.797	S	S	*	*			trans	-65.1	129.8	178	0	0	0	0	0	111.2	N5	A3-N5 PolarHBondContact O-N 2.73Å
4	W	55.8	Low	51.7	Low	237 Å²	237	148.3 Å²	148.3	90%	0.898	80%	0.798	S	S	*	*			trans	-81.7	110.1	172.9	-178.6	-88	0	0	0	109.3	A6	W4-A6 PolarHBondContact O-N 3.42Å
5	N	47.6	Very low	51.6	Low	137 Å²	137	142.9 Å²	142.9	73%	0.733	78%	0.776	S	S	*	*			trans	-77.1	101.9	179.9	-161.7	-0.9	0	0	0	109.7	A3 S7	A3-N5 PolarHBondContact O-N 2.73Å; N5-S7 PolarHBondContact OD1-OG 3.24Å; N5-S7 PolarHBondContact O-N 3.11Å
6	A	52.8	Low	51.3	Low	79 Å²	79	142 Å²	142	65%	0.653	76%	0.763	S	S	*	*			trans	-83.7	22.3	-172.1	0	0	0	0	0	114.5	W4 Q8	W4-A6 PolarHBondContact O-N 3.42Å; A6-Q8 PolarHBondContact O-N 3.48Å
7	S	51.5	Low	51.1	Low	94 Å²	94	142.2 Å²	142.2	66%	0.657	76%	0.763	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92	10.7	-160.7	-59.9	0	0	0	0	117.4	N5	N5-S7 PolarHBondContact OD1-OG 3.24Å; N5-S7 PolarHBondContact O-N 3.11Å
8	Q	51.1	Low	51	Low	180 Å²	180	137.4 Å²	137.4	84%	0.841	74%	0.743	S	S	*	*	T	Hydrogen-bonded Turn	trans	-140.3	25.5	-171.9	-69.4	-166.7	-32.6	0	0	117.2	A6 V10	A6-Q8 PolarHBondContact O-N 3.48Å; Q8-V10 PolarHBondContact O-N 3.36Å
9	I	53.5	Low	51	Low	140 Å²	140	136.1 Å²	136.1	72%	0.718	74%	0.735	S	S	*	*			trans	-87.7	85.9	167.7	-53.3	176.2	0	0	0	108.3
10	V	56	Low	51	Low	124 Å²	124	136.4 Å²	136.4	75%	0.752	74%	0.735	S	S	*	*			trans	-85.3	121.3	166.5	-169.6	0	0	0	0	107.3	Q8 F12	Q8-V10 PolarHBondContact O-N 3.36Å; V10-F12 PolarHBondContact O-N 3.23Å
11	P	55.4	Low	51	Low	98 Å²	98	136.9 Å²	136.9	64%	0.636	74%	0.737	S	S	*	*			trans	-71.2	118.1	174.7	27.6	-30.2	0	0	0	109.1	Q13	P11-Q13 PolarHBondContact O-N 2.78Å
12	F	52.6	Low	51.7	Low	192 Å²	192	133.5 Å²	133.5	84%	0.842	72%	0.716	S	S	*	*			trans	-73.4	70.7	172.1	-150.1	-91.6	0	0	0	108.4	V10	V10-F12 PolarHBondContact O-N 3.23Å
13	Q	53.3	Low	52	Low	144 Å²	144	130.8 Å²	130.8	67%	0.673	71%	0.708	S	S	*	*			trans	-98.1	-8	-174.4	-169.2	61.3	71.6	0	0	112.7	P11	P11-Q13 PolarHBondContact O-N 2.78Å
14	E	49.6	Very low	52.2	Low	174 Å²	174	129.8 Å²	129.8	81%	0.813	70%	0.7	S	S	*	*	S	Bend	trans	-99.2	127.6	-178.9	-59.6	-175.8	120.4	0	0	109.2
15	S	51.6	Low	52.4	Low	67 Å²	67	123 Å²	123	47%	0.469	69%	0.694	S	S	.	*			trans	97.7	35.2	178.1	-151.4	0	0	0	0	117.5	S18	S15-S18 WeakPolarHBondContact OG-CB 3.47Å; S15-S18 PolarHBondContact OG-OG 3.05Å
16	F	46.4	Very low	53	Low	129 Å²	129	122.5 Å²	122.5	57%	0.566	69%	0.688	S	S	*	*	S	Bend	trans	-81.5	-28.5	158.1	-87	-85.2	0	0	0	112.9	S18 L19	F16-S18 PolarHBondContact O-N 2.77Å; F16-L19 HydrophobicContact CD1-CD1 4.36Å; F16-L19 PolarHBondContact O-N 3.11Å
17	D	48	Very low	53.5	Low	145 Å²	145	124.9 Å²	124.9	78%	0.775	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.2	-26.5	179.4	-67.8	-44.5	0	0	0	112.9
18	S	48.1	Very low	53.8	Low	57 Å²	57	127.9 Å²	127.9	40%	0.399	70%	0.7	S	S	.	*	T	Hydrogen-bonded Turn	trans	-79	-30.9	177.1	-42.9	0	0	0	0	112.1	S15 F16 L20 L21 F22	S15-S18 WeakPolarHBondContact OG-CB 3.47Å; S15-S18 PolarHBondContact OG-OG 3.05Å; F16-S18 PolarHBondContact O-N 2.77Å; S18-L20 PolarHBondContact O-N 3.45Å; S18-L21 PolarHBondContact O-N 2.94Å; S18-F22 WeakPolarHBondContact O-CD2 3.24Å; S18-F22 VanDerWaalsContact O-CD2 3.24Å
19	L	51.2	Low	54.3	Low	111 Å²	111	123.1 Å²	123.1	58%	0.581	70%	0.699	S	S	*	*	H	α-helix	trans	-72.1	-31	-175.8	-76.9	167.4	0	0	0	113.2	F16 L21 F22	F16-L19 HydrophobicContact CD1-CD1 4.36Å; F16-L19 PolarHBondContact O-N 3.11Å; L19-L21 PolarHBondContact O-N 3.11Å; L19-F22 PolarHBondContact O-N 3.07Å
20	L	51.1	Low	54.9	Low	143 Å²	143	122.6 Å²	122.6	75%	0.749	69%	0.694	S	S	*	*	H	α-helix	trans	-67.4	-21	177.9	-68.6	171.5	0	0	0	112.7	S18	S18-L20 PolarHBondContact O-N 3.45Å
21	L	52.4	Low	55.6	Low	147 Å²	147	126 Å²	126	77%	0.77	70%	0.699	S	S	*	*	H	α-helix	trans	-91.3	-27.3	-178.6	-160	69.4	0	0	0	113.6	S18 L19	S18-L21 PolarHBondContact O-N 2.94Å; L19-L21 PolarHBondContact O-N 3.11Å
22	F	56.5	Low	56.2	Low	175 Å²	175	129 Å²	129	77%	0.768	70%	0.704	S	S	*	*	H	α-helix	trans	-91.2	-10	-176.9	-76.6	-78.3	0	0	0	114.8	S18 L19	S18-F22 WeakPolarHBondContact O-CD2 3.24Å; S18-F22 VanDerWaalsContact O-CD2 3.24Å; L19-F22 PolarHBondContact O-N 3.07Å
23	G	57.4	Low	57.1	Low	72 Å²	72	126 Å²	126	74%	0.742	71%	0.705	S	S	*	*	S	Bend	trans	-92.3	-11.1	-177.6	0	0	0	0	0	116.2
24	A	55.2	Low	58	Low	81 Å²	81	125.1 Å²	125.1	67%	0.669	70%	0.704	S	S	*	*			trans	-101.9	30.4	-169	0	0	0	0	0	114.2	Q26	A24-Q26 PolarHBondContact O-N 3.2Å
25	A	60.2	Low	59.2	Low	94 Å²	94	126 Å²	126	78%	0.777	71%	0.706	S	S	*	*			trans	-75.7	13.3	-172.1	0	0	0	0	0	116
26	Q	58.3	Low	59.9	Low	126 Å²	126	127.3 Å²	127.3	59%	0.589	71%	0.711	S	S	*	*			trans	-137.1	127.5	171.2	-74.9	-171.2	8.9	0	0	111.8	A24 H28	A24-Q26 PolarHBondContact O-N 3.2Å; Q26-H28 PolarHBondContact O-N 3.45Å; Q26-H28 VanDerWaalsContact O-N 3.11Å
27	P	64.7	Low	60.9	Low	130 Å²	130	125.8 Å²	125.8	84%	0.844	72%	0.716	S	S	*	*	S	Bend	trans	-72.4	0	-177.4	30	-35.8	0	0	0	113.7
28	H	56.3	Low	61.4	Low	156 Å²	156	129 Å²	129	72%	0.722	72%	0.724	S	S	*	*	S	Bend	trans	-125.7	132.4	177.9	-73.1	29.9	0	0	0	107.6	Q26 H30	Q26-H28 PolarHBondContact O-N 3.45Å; Q26-H28 VanDerWaalsContact O-N 3.11Å; H28-H30 PolarHBondContact O-N 3.02Å
29	G	62.4	Low	62.1	Low	81 Å²	81	130 Å²	130	84%	0.835	74%	0.742	S	S	*	*			trans	-57.6	93.8	-176.6	0	0	0	0	0	111.5
30	H	65.7	Low	62.6	Low	129 Å²	129	135.2 Å²	135.2	60%	0.597	75%	0.754	S	S	*	*			trans	-98.5	115.8	176	-176.3	-86.2	0	0	0	108.6	H28 Q32	H28-H30 PolarHBondContact O-N 3.02Å; H30-Q32 PolarHBondContact O-N 3.23Å
31	F	70.9	Confident	63.2	Low	196 Å²	196	136.9 Å²	136.9	86%	0.86	76%	0.758	S	S	*	*			trans	-77.6	112.4	170.1	-64.8	-86	0	0	0	108.6	C33	F31-C33 PolarHBondContact O-N 3.22Å
32	Q	68.2	Low	63.7	Low	161 Å²	161	134.5 Å²	134.5	75%	0.752	75%	0.752	S	S	*	*			trans	-88.3	106.1	171.6	-168.3	170.8	60.4	0	0	109.2	H30	H30-Q32 PolarHBondContact O-N 3.23Å
33	C	72.3	Confident	64.3	Low	127 Å²	127	134.4 Å²	134.4	86%	0.858	76%	0.758	S	S	*	*			trans	-82.4	114	167.7	-175.7	0	0	0	0	108.6	F31	F31-C33 PolarHBondContact O-N 3.22Å
34	L	71.2	Confident	64.3	Low	126 Å²	126	136.8 Å²	136.8	66%	0.66	75%	0.754	S	S	*	*			trans	-98	125.5	171.2	-157.3	97.2	0	0	0	109	V36	L34-V36 PolarHBondContact O-N 3.19Å; L34-V36 VanDerWaalsContact O-N 3.11Å
35	K	74.1	Confident	64.2	Low	193 Å²	193	137.1 Å²	137.1	84%	0.839	76%	0.756	S	S	*	*			trans	-70.3	105.8	168.5	-172.8	174.2	-177.1	176.1	0	108.3	S37	K35-S37 PolarHBondContact O-N 2.94Å
36	V	67.9	Low	64.2	Low	94 Å²	94	140.6 Å²	140.6	57%	0.57	75%	0.754	S	S	*	*			trans	-75.7	109.3	175.4	-173.3	0	0	0	0	108.3	L34 F38	L34-V36 PolarHBondContact O-N 3.19Å; L34-V36 VanDerWaalsContact O-N 3.11Å; V36-F38 PolarHBondContact O-N 2.77Å
37	S	66.3	Low	64	Low	98 Å²	98	145.1 Å²	145.1	69%	0.685	77%	0.766	S	S	*	*			trans	-65.3	125.6	169.1	-46.4	0	0	0	0	108.6	K35 G39	K35-S37 PolarHBondContact O-N 2.94Å; S37-G39 PolarHBondContact O-N 2.94Å
38	F	59.9	Low	63.8	Low	212 Å²	212	146.1 Å²	146.1	93%	0.93	76%	0.763	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.6	7.2	-175.8	-72.7	-85.2	0	0	0	116.5	V36	V36-F38 PolarHBondContact O-N 2.77Å
39	G	62.3	Low	63.9	Low	77 Å²	77	144.2 Å²	144.2	79%	0.794	77%	0.765	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.8	-12.3	177.8	0	0	0	0	0	114.9	S37	S37-G39 PolarHBondContact O-N 2.94Å
40	R	60.6	Low	63.7	Low	221 Å²	221	148.7 Å²	148.7	83%	0.834	76%	0.761	S	S	*	*	S	Bend	trans	-130	101.3	173.8	-67	-173.3	178.5	169.8	-0	108.6
41	Q	63.7	Low	63.4	Low	178 Å²	178	148.2 Å²	148.2	83%	0.832	76%	0.763	S	S	*	*			trans	-61.8	128.7	166.4	-79.4	-177.7	14.4	0	0	107.8	L43	Q41-L43 PolarHBondContact O-N 3.17Å
42	P	64.5	Low	62.8	Low	97 Å²	97	144 Å²	144	63%	0.63	75%	0.749	S	S	*	*			trans	-59.7	127.7	168.1	25.7	-31.2	0	0	0	107.6	L44	P42-L44 HydrophobicContact CB-CD1 4.1Å; P42-L44 HydrophobicContact CG-CD1 4.01Å; P42-L44 PolarHBondContact O-N 3.49Å
43	L	67.2	Low	62.5	Low	173 Å²	173	146.7 Å²	146.7	91%	0.906	75%	0.753	S	S	*	*			trans	-66.1	82.7	171.3	-80.7	159	0	0	0	108.1	Q41 A45	Q41-L43 PolarHBondContact O-N 3.17Å; L43-A45 PolarHBondContact O-N 3.35Å
44	L	58.5	Low	61.9	Low	123 Å²	123	151.3 Å²	151.3	64%	0.644	77%	0.767	S	S	*	*			trans	-72.9	78.4	165.6	-104	83.4	0	0	0	107.8	P42 F46	P42-L44 HydrophobicContact CB-CD1 4.1Å; P42-L44 HydrophobicContact CG-CD1 4.01Å; P42-L44 PolarHBondContact O-N 3.49Å; L44-F46 HydrophobicContact CB-CD2 4.09Å; L44-F46 HydrophobicContact CB-CE2 4.3Å; L44-F46 HydrophobicContact CD2-CD2 3.69Å; L44-F46 HydrophobicContact CD2-CE2 3.42Å; L44-F46 VanDerWaalsContact CD2-CE2 3.42Å; L44-F46 HydrophobicContact CG-CD2 3.84Å; L44-F46 HydrophobicContact CG-CE2 3.55Å; L44-F46 PolarHBondContact O-N 3.5Å
45	A	53.1	Low	61.4	Low	88 Å²	88	152.6 Å²	152.6	73%	0.727	77%	0.772	S	S	*	*			trans	-82.3	61.4	171.6	0	0	0	0	0	110.3	L43 R47	L43-A45 PolarHBondContact O-N 3.35Å; A45-R47 PolarHBondContact O-N 3.19Å
46	F	59.7	Low	60.8	Low	167 Å²	167	150.5 Å²	150.5	73%	0.732	77%	0.768	S	S	*	*			trans	-79.6	94.4	163.4	-65.8	-72.2	0	0	0	107.7	L44 L48	L44-F46 HydrophobicContact CB-CD2 4.09Å; L44-F46 HydrophobicContact CB-CE2 4.3Å; L44-F46 HydrophobicContact CD2-CD2 3.69Å; L44-F46 HydrophobicContact CD2-CE2 3.42Å; L44-F46 VanDerWaalsContact CD2-CE2 3.42Å; L44-F46 HydrophobicContact CG-CD2 3.84Å; L44-F46 HydrophobicContact CG-CE2 3.55Å; L44-F46 PolarHBondContact O-N 3.5Å; F46-L48 PolarHBondContact O-N 3.29Å; F46-L48 VanDerWaalsContact O-N 3.11Å
47	R	54.9	Low	60.4	Low	221 Å²	221	153.6 Å²	153.6	83%	0.834	78%	0.78	S	S	*	*			trans	-70.1	103.9	162.3	-71.4	-165.6	-176.7	-156.9	3	107	A45	A45-R47 PolarHBondContact O-N 3.19Å
48	L	60.8	Low	60	Low	151 Å²	151	156.9 Å²	156.9	79%	0.791	79%	0.785	S	S	*	*			trans	-57.1	134.4	165	-69.7	166.7	0	0	0	107.7	F46 K50	F46-L48 PolarHBondContact O-N 3.29Å; F46-L48 VanDerWaalsContact O-N 3.11Å; L48-K50 PolarHBondContact O-N 3.28Å
49	P	57.9	Low	60	Low	116 Å²	116	153.4 Å²	153.4	75%	0.753	78%	0.776	S	S	*	*			trans	-58.3	112.3	169.6	23.5	-29.4	0	0	0	106.7	D51	P49-D51 PolarHBondContact O-N 2.84Å
50	K	58	Low	59.9	Low	175 Å²	175	158.5 Å²	158.5	76%	0.761	78%	0.775	S	S	*	*			trans	-69.3	96.2	167.7	-162.5	-177.6	178.6	-126.5	0	104.7	L48 D52	L48-K50 PolarHBondContact O-N 3.28Å; K50-D52 WeakPolarHBondContact CE-OD2 3.48Å; K50-D52 IonicContact NZ-OD2 2.77Å; K50-D52 PolarHBondContact NZ-OD2 2.85Å; K50-D52 PolarHBondContact O-N 3.27Å
51	D	60.2	Low	59.8	Low	119 Å²	119	154.1 Å²	154.1	64%	0.636	77%	0.771	S	S	*	*			trans	-65.7	86.9	171.4	-151	-70.4	0	0	0	106.4	P49 R53	P49-D51 PolarHBondContact O-N 2.84Å; D51-R53 PolarHBondContact O-N 3.48Å; D51-R53 VanDerWaalsContact OD1-CD 3.27Å; D51-R53 WeakPolarHBondContact OD1-CD 3.19Å; D51-R53 WeakPolarHBondContact OD1-CG 3.27Å; D51-R53 IonicContact OD1-NE 3.48Å; D51-R53 PolarHBondContact OD1-NE 3.21Å
52	D	58.6	Low	59.5	Low	106 Å²	106	152.2 Å²	152.2	57%	0.567	77%	0.766	S	S	*	*			trans	-87	67.1	175.5	-131.3	-82.2	0	0	0	106.7	K50	K50-D52 WeakPolarHBondContact CE-OD2 3.48Å; K50-D52 IonicContact NZ-OD2 2.77Å; K50-D52 PolarHBondContact NZ-OD2 2.85Å; K50-D52 PolarHBondContact O-N 3.27Å
53	R	60.3	Low	59.1	Low	219 Å²	219	156.8 Å²	156.8	83%	0.826	78%	0.777	S	S	*	*			trans	-89.1	100.6	165.9	-80.9	-179.2	-170.8	-145.5	0.9	108.5	D51	D51-R53 PolarHBondContact O-N 3.48Å; D51-R53 VanDerWaalsContact OD1-CD 3.27Å; D51-R53 WeakPolarHBondContact OD1-CD 3.19Å; D51-R53 WeakPolarHBondContact OD1-CG 3.27Å; D51-R53 IonicContact OD1-NE 3.48Å; D51-R53 PolarHBondContact OD1-NE 3.21Å
54	I	60.2	Low	58.4	Low	224 Å²	224	155.4 Å²	155.4	100%	1.149	77%	0.766	S	S	*	*			trans	-70.2	0	157.4	-61.8	172.7	0	0	0	108.6

Retrieved 54 of 54 residues in 23.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).