A0A077YWD9_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YWD9, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 49 aa.

						>A0A077YWD9_TRITR|A0A077YWD9
MQKSQRSHRPKSNSSYCPVVEQPCSKGILAETEGRLCGTRKRCLIRSSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.9	Very low	47.7	Very low	241 Å²	241	179.5 Å²	179.5	100%	1.187	86%	0.857	S	S	*	*				0	129.6	0	-72	169	150.6	0	0	108.7
2	Q	47	Very low	47.5	Very low	195 Å²	195	171.3 Å²	171.3	91%	0.911	83%	0.832	S	S	*	*			trans	53.5	89.3	170.8	-66.7	171.9	34.8	0	0	119.3	S4	Q2-S4 PolarHBondContact O-N 3.32Å
3	K	44.6	Very low	47.9	Very low	214 Å²	214	169 Å²	169	93%	0.93	83%	0.827	S	S	*	*			trans	-65.7	108.2	160.6	-93.7	170.3	163.5	177.8	0	109.6	Q5	K3-Q5 PolarHBondContact O-N 2.8Å
4	S	49	Very low	48.7	Very low	110 Å²	110	161.8 Å²	161.8	77%	0.769	80%	0.801	S	S	*	*			trans	-74.1	108.3	169.9	-161	0	0	0	0	109.2	Q2 R6	Q2-S4 PolarHBondContact O-N 3.32Å; S4-R6 PolarHBondContact O-N 3.28Å
5	Q	53	Low	50	Low	198 Å²	198	151.9 Å²	151.9	93%	0.925	76%	0.755	S	S	*	*			trans	-69.2	64.1	169.8	-72.7	-164.5	-4.2	0	0	111.2	K3 S7	K3-Q5 PolarHBondContact O-N 2.8Å; Q5-S7 PolarHBondContact O-N 3.24Å
6	R	50.6	Low	51.4	Low	210 Å²	210	150.4 Å²	150.4	79%	0.792	74%	0.739	S	S	*	*			trans	-89.3	88.9	175	-160.8	168	-168.7	175.7	4.1	108.3	S4	S4-R6 PolarHBondContact O-N 3.28Å
7	S	44.5	Very low	52.7	Low	93 Å²	93	141.8 Å²	141.8	65%	0.65	70%	0.697	S	S	*	*			trans	35.5	94.1	155	-152.5	0	0	0	0	114.5	Q5 R9	Q5-S7 PolarHBondContact O-N 3.24Å; S7-R9 PolarHBondContact O-N 2.8Å
8	H	49.8	Very low	53.6	Low	202 Å²	202	139.4 Å²	139.4	94%	0.935	69%	0.694	S	S	*	*			trans	-65.7	31.2	164.1	-96.1	-111.4	0	0	0	112.7	P10	H8-P10 WeakPolarHBondContact O-CD 3.4Å
9	R	48.1	Very low	54.6	Low	205 Å²	205	138 Å²	138	77%	0.774	69%	0.693	S	S	*	*	S	Bend	trans	-69.6	120	156.4	-161.9	-174.6	176.9	-150	-5.1	104.7	S7 K11	S7-R9 PolarHBondContact O-N 2.8Å; R9-K11 PolarHBondContact O-N 2.77Å
10	P	48.5	Very low	55.6	Low	101 Å²	101	132.7 Å²	132.7	66%	0.656	67%	0.668	S	S	*	*			trans	-55.2	114.5	169	24	-30.9	0	0	0	105.4	H8 S12	H8-P10 WeakPolarHBondContact O-CD 3.4Å; P10-S12 PolarHBondContact O-N 2.82Å
11	K	44.6	Very low	56.6	Low	206 Å²	206	133.5 Å²	133.5	90%	0.896	67%	0.67	S	S	*	*			trans	-70.4	48.3	162.4	-146.7	177.7	-174	-173.7	0	107	R9 N13	R9-K11 PolarHBondContact O-N 2.77Å; K11-N13 PolarHBondContact O-N 2.79Å
12	S	45.5	Very low	58.1	Low	80 Å²	80	126.8 Å²	126.8	56%	0.559	64%	0.635	S	S	*	*			trans	-80.3	107.4	174.4	-170.9	0	0	0	0	103.9	P10 S14	P10-S12 PolarHBondContact O-N 2.82Å; S12-S14 PolarHBondContact O-N 3.28Å; S12-S14 VanDerWaalsContact OG-CB 3.27Å; S12-S14 WeakPolarHBondContact OG-CB 3.27Å
13	N	52.9	Low	59.4	Low	142 Å²	142	121.4 Å²	121.4	76%	0.759	62%	0.618	S	S	*	*			trans	-66.5	29.4	171.3	-156.8	27.8	0	0	0	111.4	K11 R35	K11-N13 PolarHBondContact O-N 2.79Å; N13-R35 PolarHBondContact O-NH1 2.01Å; N13-R35 PolarHBondContact O-NH2 2.78Å
14	S	58.4	Low	60.9	Low	68 Å²	68	112 Å²	112	48%	0.476	58%	0.578	S	S	.	*			trans	-101.9	110	-178.5	-163.3	0	0	0	0	107.2	S12 Y16	S12-S14 PolarHBondContact O-N 3.28Å; S12-S14 VanDerWaalsContact OG-CB 3.27Å; S12-S14 WeakPolarHBondContact OG-CB 3.27Å; S14-Y16 PolarHBondContact O-N 2.76Å
15	S	68.7	Low	62.2	Low	14 Å²	14	110.2 Å²	110.2	10%	0.098	57%	0.566	C	S	.	*			trans	-65.2	133.9	175.7	-64	0	0	0	0	107.4	C24 R35 I45	S15-C24 WeakPolarHBondContact CB-SG 3.44Å; S15-C24 WeakPolarHBondContact O-CA 3.09Å; S15-C24 WeakPolarHBondContact O-CB 3.49Å; S15-C24 PolarHBondContact O-N 2.79Å; S15-C24 PolarHBondContact O-SG 3.01Å; S15-R35 VanDerWaalsContact CB-CD 3.44Å; S15-R35 WeakPolarHBondContact OG-CD 3.38Å; S15-R35 PolarHBondContact OG-NH1 2.89Å; S15-I45 WeakPolarHBondContact OG-CD1 3.1Å; S15-I45 WeakPolarHBondContact OG-CG1 3.35Å
16	Y	72.9	Confident	63.5	Low	127 Å²	127	107.8 Å²	107.8	50%	0.498	55%	0.553	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-114.5	137.5	176.1	-175.5	-100.5	0	0	0	107.8	S14 P18 E21 Q22 C24	S14-Y16 PolarHBondContact O-N 2.76Å; Y16-P18 WeakPolarHBondContact O-CD 3.45Å; Y16-E21 WeakPolarHBondContact OH-CA 3.35Å; Y16-E21 WeakPolarHBondContact OH-CB 3.35Å; Y16-E21 PolarHBondContact OH-O 3.38Å; Y16-Q22 WeakPolarHBondContact CD2-O 3.2Å; Y16-C24 VanDerWaalsContact C-SG 3.6Å
17	C	73	Confident	64.8	Low	5 Å²	5	98.7 Å²	98.7	3%	0.034	52%	0.524	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95	107.6	-179.8	-165.6	0	0	0	0	109.5	V19 V20 E21 Q22 C37	C17-V19 PolarHBondContact O-N 3.21Å; C17-V20 HydrophobicContact CB-CG2 3.63Å; C17-V20 PolarHBondContact O-N 2.83Å; C17-E21 WeakPolarHBondContact O-CA 3.44Å; C17-E21 PolarHBondContact O-N 2.69Å; C17-Q22 PolarHBondContact N-O 3Å; C17-Q22 PolarHBondContact O-N 2.96Å; C17-C37 HydrophobicContact CB-CB 3.73Å; C17-C37 WeakPolarHBondContact CB-SG 3.12Å; C17-C37 WeakPolarHBondContact SG-CB 3.32Å; C17-C37 CovalentContact SG-SG 2.01Å; C17-C37 PolarHBondContact SG-SG 3.4Å
18	P	69.7	Low	66.2	Low	98 Å²	98	100 Å²	100	64%	0.636	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.7	-18.1	-176.5	28.9	-35.8	0	0	0	112.9	Y16	Y16-P18 WeakPolarHBondContact O-CD 3.45Å
19	V	71.7	Confident	67.2	Low	113 Å²	113	93.1 Å²	93.1	69%	0.685	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.9	-35.5	-178.8	179.7	0	0	0	0	112.2	C17	C17-V19 PolarHBondContact O-N 3.21Å
20	V	75	Confident	68.4	Low	32 Å²	32	87.2 Å²	87.2	19%	0.194	49%	0.488	C	S	.	.	T	Hydrogen-bonded Turn	trans	-115	3.6	-175.9	-62.9	0	0	0	0	112.3	C17 Q22 C37 T39	C17-V20 HydrophobicContact CB-CG2 3.63Å; C17-V20 PolarHBondContact O-N 2.83Å; V20-Q22 HydrophobicContact CG2-CB 3.93Å; V20-Q22 WeakPolarHBondContact O-CG 3.03Å; V20-Q22 PolarHBondContact O-N 3.21Å; V20-Q22 PolarHBondContact O-NE2 3.45Å; V20-C37 HydrophobicContact CG2-CB 3.8Å; V20-T39 HydrophobicContact CG1-CG2 3.66Å
21	E	76.7	Confident	69.6	Low	149 Å²	149	91.8 Å²	91.8	70%	0.696	50%	0.5	S	S	*	.	T	Hydrogen-bonded Turn	trans	46.6	45	-176.5	-60.2	-164.4	95.3	0	0	113.1	Y16 C17	Y16-E21 WeakPolarHBondContact OH-CA 3.35Å; Y16-E21 WeakPolarHBondContact OH-CB 3.35Å; Y16-E21 PolarHBondContact OH-O 3.38Å; C17-E21 WeakPolarHBondContact O-CA 3.44Å; C17-E21 PolarHBondContact O-N 2.69Å
22	Q	75.5	Confident	70.8	Confident	100 Å²	100	85.5 Å²	85.5	47%	0.467	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.8	152.4	-177.5	-78.6	173.6	78.5	0	0	112.1	Y16 C17 V20	Y16-Q22 WeakPolarHBondContact CD2-O 3.2Å; C17-Q22 PolarHBondContact N-O 3Å; C17-Q22 PolarHBondContact O-N 2.96Å; V20-Q22 HydrophobicContact CG2-CB 3.93Å; V20-Q22 WeakPolarHBondContact O-CG 3.03Å; V20-Q22 PolarHBondContact O-N 3.21Å; V20-Q22 PolarHBondContact O-NE2 3.45Å
23	P	75.3	Confident	72.1	Confident	83 Å²	83	87.5 Å²	87.5	54%	0.539	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-61	140.6	171.4	27.2	-34	0	0	0	110.2
24	C	76.1	Confident	73.2	Confident	15 Å²	15	82.1 Å²	82.1	10%	0.101	46%	0.458	C	S	.	.	P	Polyproline II helix	trans	-74.8	129.7	175.5	-61.5	0	0	0	0	110.4	S15 Y16 R35 L36 C43	S15-C24 WeakPolarHBondContact CB-SG 3.44Å; S15-C24 WeakPolarHBondContact O-CA 3.09Å; S15-C24 WeakPolarHBondContact O-CB 3.49Å; S15-C24 PolarHBondContact O-N 2.79Å; S15-C24 PolarHBondContact O-SG 3.01Å; Y16-C24 VanDerWaalsContact C-SG 3.6Å; C24-R35 HydrophobicContact CB-CB 3.89Å; C24-L36 CarbonylContact C-O 3.56Å; C24-L36 VanDerWaalsContact CA-O 3.28Å; C24-L36 WeakPolarHBondContact CA-O 2.9Å; C24-C43 HydrophobicContact CB-CB 3.84Å; C24-C43 WeakPolarHBondContact CB-SG 3.28Å; C24-C43 WeakPolarHBondContact SG-CB 3.08Å; C24-C43 CovalentContact SG-SG 1.99Å; C24-C43 PolarHBondContact SG-SG 2.86Å
25	S	76.5	Confident	74.1	Confident	74 Å²	74	82.7 Å²	82.7	52%	0.517	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.7	146.3	172.4	-61.8	0	0	0	0	109.9	R35 L36	S25-R35 CarbonylContact O-C 3.53Å; S25-R35 WeakPolarHBondContact O-CA 3.05Å; S25-L36 PolarHBondContact N-O 2.88Å; S25-L36 PolarHBondContact O-N 2.87Å
26	K	79	Confident	74.5	Confident	147 Å²	147	83.1 Å²	83.1	64%	0.639	45%	0.451	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-69.6	134.6	169	-167.2	179.1	180	-168.6	0	108.6	E33	K26-E33 WeakPolarHBondContact CE-OE1 2.91Å; K26-E33 WeakPolarHBondContact CE-OE2 3.4Å; K26-E33 IonicContact NZ-OE1 2.89Å; K26-E33 PolarHBondContact NZ-OE1 2.89Å; K26-E33 IonicContact NZ-OE2 2.76Å; K26-E33 PolarHBondContact NZ-OE2 3.17Å
27	G	77.6	Confident	74.6	Confident	19 Å²	19	77.3 Å²	77.3	20%	0.196	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-164.7	169.8	177.5	0	0	0	0	0	112.4	G34	G27-G34 PolarHBondContact N-O 2.98Å; G27-G34 CarbonylContact O-C 3.55Å; G27-G34 PolarHBondContact O-N 2.74Å
28	I	75.4	Confident	74.5	Confident	121 Å²	121	79.9 Å²	79.9	62%	0.621	46%	0.455	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109	125.9	-178.1	-56.9	171.4	0	0	0	107.6
29	L	70	Confident	74.4	Confident	56 Å²	56	78.8 Å²	78.8	29%	0.293	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	115.3	177.7	-159	120.4	0	0	0	110.5	T32 L36 R40 R42	L29-T32 PolarHBondContact N-O 3.3Å; L29-T32 PolarHBondContact O-N 1.99Å; L29-L36 HydrophobicContact CB-CD1 4.48Å; L29-L36 HydrophobicContact CB-CD2 3.88Å; L29-L36 HydrophobicContact CD1-CD1 4.31Å; L29-L36 HydrophobicContact CD1-CD2 4.05Å; L29-R40 WeakPolarHBondContact CD1-O 3.27Å; L29-R42 HydrophobicContact CD2-CG 4.11Å; L29-R42 PolarHBondContact O-NH2 2.8Å
30	A	73.6	Confident	73.9	Confident	82 Å²	82	83.4 Å²	83.4	68%	0.678	45%	0.452	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.6	58.7	-174	0	0	0	0	0	111.7	T32	A30-T32 PolarHBondContact O-N 2.78Å; A30-T32 PolarHBondContact O-OG1 3.19Å
31	E	72.9	Confident	73.6	Confident	196 Å²	196	88.4 Å²	88.4	92%	0.916	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.7	-0	179.5	-59.8	179.9	87.2	0	0	116.1
32	T	69.8	Low	73.1	Confident	74 Å²	74	87.3 Å²	87.3	45%	0.454	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.9	120.2	175	-47.2	0	0	0	0	110.1	L29 A30 R42	L29-T32 PolarHBondContact N-O 3.3Å; L29-T32 PolarHBondContact O-N 1.99Å; A30-T32 PolarHBondContact O-N 2.78Å; A30-T32 PolarHBondContact O-OG1 3.19Å; T32-R42 PolarHBondContact OG1-NH2 2.76Å
33	E	73.5	Confident	72.9	Confident	123 Å²	123	83.1 Å²	83.1	58%	0.575	44%	0.442	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.3	129	167.9	-172.6	178.5	94.6	0	0	109.8	K26	K26-E33 WeakPolarHBondContact CE-OE1 2.91Å; K26-E33 WeakPolarHBondContact CE-OE2 3.4Å; K26-E33 IonicContact NZ-OE1 2.89Å; K26-E33 PolarHBondContact NZ-OE1 2.89Å; K26-E33 IonicContact NZ-OE2 2.76Å; K26-E33 PolarHBondContact NZ-OE2 3.17Å
34	G	76.1	Confident	72.3	Confident	29 Å²	29	86.2 Å²	86.2	30%	0.299	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-158.4	-174.8	-179.4	0	0	0	0	0	112.7	G27	G27-G34 PolarHBondContact N-O 2.98Å; G27-G34 CarbonylContact O-C 3.55Å; G27-G34 PolarHBondContact O-N 2.74Å
35	R	77.2	Confident	71.4	Confident	79 Å²	79	89.7 Å²	89.7	30%	0.298	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.1	136	169.7	-72.4	-174.2	-174.5	176.1	-6.5	108.4	N13 S15 C24 S25 C43 I45	N13-R35 PolarHBondContact O-NH1 2.01Å; N13-R35 PolarHBondContact O-NH2 2.78Å; S15-R35 VanDerWaalsContact CB-CD 3.44Å; S15-R35 WeakPolarHBondContact OG-CD 3.38Å; S15-R35 PolarHBondContact OG-NH1 2.89Å; C24-R35 HydrophobicContact CB-CB 3.89Å; S25-R35 CarbonylContact O-C 3.53Å; S25-R35 WeakPolarHBondContact O-CA 3.05Å; R35-C43 HydrophobicContact CB-CB 4Å; R35-C43 WeakPolarHBondContact O-CA 3.49Å; R35-C43 VanDerWaalsContact O-CB 3.27Å; R35-C43 WeakPolarHBondContact O-CB 3.4Å; R35-C43 PolarHBondContact O-N 2.75Å; R35-I45 HydrophobicContact CB-CD1 4.31Å; R35-I45 HydrophobicContact CG-CD1 4.43Å
36	L	77.1	Confident	70.2	Confident	24 Å²	24	96.5 Å²	96.5	13%	0.126	49%	0.485	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	144.6	-174.9	-56.2	-178.7	0	0	0	110.1	C24 S25 L29 K41 R42 C43	C24-L36 CarbonylContact C-O 3.56Å; C24-L36 VanDerWaalsContact CA-O 3.28Å; C24-L36 WeakPolarHBondContact CA-O 2.9Å; S25-L36 PolarHBondContact N-O 2.88Å; S25-L36 PolarHBondContact O-N 2.87Å; L29-L36 HydrophobicContact CB-CD1 4.48Å; L29-L36 HydrophobicContact CB-CD2 3.88Å; L29-L36 HydrophobicContact CD1-CD1 4.31Å; L29-L36 HydrophobicContact CD1-CD2 4.05Å; L36-K41 CarbonylContact C-O 3.53Å; L36-K41 WeakPolarHBondContact CA-O 2.96Å; L36-R42 HydrophobicContact CD2-CG 4.26Å; L36-C43 PolarHBondContact O-SG 2.81Å
37	C	74.8	Confident	68.8	Low	5 Å²	5	94.2 Å²	94.2	3%	0.034	49%	0.487	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.3	149.9	165.3	-46.6	0	0	0	0	108.1	C17 V20 T39 R40 K41 C43	C17-C37 HydrophobicContact CB-CB 3.73Å; C17-C37 WeakPolarHBondContact CB-SG 3.12Å; C17-C37 WeakPolarHBondContact SG-CB 3.32Å; C17-C37 CovalentContact SG-SG 2.01Å; C17-C37 PolarHBondContact SG-SG 3.4Å; V20-C37 HydrophobicContact CG2-CB 3.8Å; C37-T39 PolarHBondContact O-N 3.44Å; C37-R40 PolarHBondContact O-N 3.22Å; C37-K41 PolarHBondContact N-O 2.78Å; C37-C43 PolarHBondContact N-SG 3.33Å; C37-C43 PolarHBondContact SG-SG 3.4Å
38	G	70.3	Confident	67.5	Low	58 Å²	58	98 Å²	98	60%	0.598	51%	0.51	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.7	-17.6	-178.2	0	0	0	0	0	115.5	R40	G38-R40 VanDerWaalsContact C-N 3.28Å; G38-R40 PolarHBondContact O-N 3.32Å
39	T	68.1	Low	65.8	Low	76 Å²	76	101.5 Å²	101.5	47%	0.466	55%	0.546	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82.7	17.7	174.8	51.4	0	0	0	0	115.1	V20 C37 K41	V20-T39 HydrophobicContact CG1-CG2 3.66Å; C37-T39 PolarHBondContact O-N 3.44Å; T39-K41 PolarHBondContact O-N 3.25Å; T39-K41 VanDerWaalsContact O-N 3.11Å
40	R	62.5	Low	65.6	Low	210 Å²	210	103.8 Å²	103.8	79%	0.792	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	55.9	20.1	-171.4	-62.4	-174	174.9	-176.4	-0.9	113.9	L29 C37 G38	L29-R40 WeakPolarHBondContact CD1-O 3.27Å; C37-R40 PolarHBondContact O-N 3.22Å; G38-R40 VanDerWaalsContact C-N 3.28Å; G38-R40 PolarHBondContact O-N 3.32Å
41	K	66.8	Low	65.2	Low	136 Å²	136	104.9 Å²	104.9	59%	0.591	55%	0.552	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-90	144.9	171.4	-67.6	-171.2	177.7	-177.5	0	109.2	L36 C37 T39 C43	L36-K41 CarbonylContact C-O 3.53Å; L36-K41 WeakPolarHBondContact CA-O 2.96Å; C37-K41 PolarHBondContact N-O 2.78Å; T39-K41 PolarHBondContact O-N 3.25Å; T39-K41 VanDerWaalsContact O-N 3.11Å; K41-C43 PolarHBondContact O-N 2.98Å
42	R	66.2	Low	64.8	Low	127 Å²	127	99.9 Å²	99.9	48%	0.479	53%	0.532	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-57.5	128.6	171	-74.2	-176.6	175.8	177.9	-3.2	108.2	L29 T32 L36 L44	L29-R42 HydrophobicContact CD2-CG 4.11Å; L29-R42 PolarHBondContact O-NH2 2.8Å; T32-R42 PolarHBondContact OG1-NH2 2.76Å; L36-R42 HydrophobicContact CD2-CG 4.26Å; R42-L44 PolarHBondContact O-N 3.35Å
43	C	71.1	Confident	64.5	Low	11 Å²	11	101.4 Å²	101.4	7%	0.074	54%	0.537	C	S	.	.			trans	-63.4	109.6	162.9	-85.4	0	0	0	0	106.5	C24 R35 L36 C37 K41 I45	C24-C43 HydrophobicContact CB-CB 3.84Å; C24-C43 WeakPolarHBondContact CB-SG 3.28Å; C24-C43 WeakPolarHBondContact SG-CB 3.08Å; C24-C43 CovalentContact SG-SG 1.99Å; C24-C43 PolarHBondContact SG-SG 2.86Å; R35-C43 HydrophobicContact CB-CB 4Å; R35-C43 WeakPolarHBondContact O-CA 3.49Å; R35-C43 VanDerWaalsContact O-CB 3.27Å; R35-C43 WeakPolarHBondContact O-CB 3.4Å; R35-C43 PolarHBondContact O-N 2.75Å; L36-C43 PolarHBondContact O-SG 2.81Å; C37-C43 PolarHBondContact N-SG 3.33Å; C37-C43 PolarHBondContact SG-SG 3.4Å; K41-C43 PolarHBondContact O-N 2.98Å; C43-I45 PolarHBondContact O-N 3.23Å
44	L	63	Low	63.9	Low	149 Å²	149	100.1 Å²	100.1	78%	0.78	53%	0.534	S	S	*	.			trans	-64.7	83.2	162.1	-61.8	174.1	0	0	0	105.4	R42 R46	R42-L44 PolarHBondContact O-N 3.35Å; L44-R46 VanDerWaalsContact C-N 3.3Å; L44-R46 PolarHBondContact O-N 2.97Å
45	I	57.7	Low	63.1	Low	88 Å²	88	104.8 Å²	104.8	45%	0.451	55%	0.55	S	S	.	*			trans	-56.1	112.2	156.7	-48.6	-175.6	0	0	0	101.9	S15 R35 C43 S47	S15-I45 WeakPolarHBondContact OG-CD1 3.1Å; S15-I45 WeakPolarHBondContact OG-CG1 3.35Å; R35-I45 HydrophobicContact CB-CD1 4.31Å; R35-I45 HydrophobicContact CG-CD1 4.43Å; C43-I45 PolarHBondContact O-N 3.23Å; I45-S47 PolarHBondContact O-N 3.36Å
46	R	52	Low	62.1	Low	217 Å²	217	106.6 Å²	106.6	82%	0.819	57%	0.568	S	S	*	*			trans	-64	84.6	164.1	-164.9	172.7	94.8	167.8	7.7	104.5	L44 S48	L44-R46 VanDerWaalsContact C-N 3.3Å; L44-R46 PolarHBondContact O-N 2.97Å; R46-S48 PolarHBondContact O-N 3.11Å
47	S	49	Very low	60.9	Low	98 Å²	98	113 Å²	113	69%	0.685	60%	0.602	S	S	*	*			trans	-54.6	101.2	159.2	-63.9	0	0	0	0	102.9	I45 S49	I45-S47 PolarHBondContact O-N 3.36Å; S47-S49 PolarHBondContact O-N 2.88Å
48	S	50.8	Low	59.8	Low	98 Å²	98	122 Å²	122	69%	0.685	65%	0.649	S	S	*	*			trans	-61.2	122.3	163.1	-56.9	0	0	0	0	103.4	R46	R46-S48 PolarHBondContact O-N 3.11Å
49	S	39.8	Very low	58.8	Low	196 Å²	196	127.8 Å²	127.8	100%	1.371	65%	0.654	S	S	*	*			trans	-32.3	0	-171.3	-61.2	0	0	0	0	115.6	S47	S47-S49 PolarHBondContact O-N 2.88Å

Retrieved 49 of 49 residues in 146.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).