A0A077YWR3_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YWR3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 94 aa.

						>A0A077YWR3_TRITR|A0A077YWR3
MSNGAIASPGLALFSQYDAFAFKRYAKSSSRAGNGAIASPGLALFSQYDAFAFKRYACSTSSIARQLEQHWVDEPKSHSKFLRSSADLAVEVDA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.4	Very low	49.1	Very low	244 Å²	244	112.7 Å²	112.7	100%	1.202	72%	0.715	S	S	*	*				0	128.6	0	-70.8	172.6	176.1	0	0	107.2
2	S	39.3	Very low	49.2	Very low	115 Å²	115	106.7 Å²	106.7	80%	0.804	68%	0.683	S	S	*	*			trans	-82.6	126.4	-169.9	129.3	0	0	0	0	110.2	G4	S2-G4 PolarHBondContact O-N 3.46Å
3	N	42.9	Very low	49.6	Very low	167 Å²	167	107.1 Å²	107.1	89%	0.893	68%	0.676	S	S	*	*			trans	-83.4	98.7	168.7	-78	-16.8	0	0	0	107.6	A5	N3-A5 PolarHBondContact O-N 3.15Å
4	G	47.1	Very low	49.6	Very low	61 Å²	61	110.1 Å²	110.1	63%	0.629	67%	0.674	S	S	*	*			trans	-60.2	118.5	170.1	0	0	0	0	0	109.5	S2 I6	S2-G4 PolarHBondContact O-N 3.46Å; G4-I6 PolarHBondContact O-N 3.28Å; G4-I6 VanDerWaalsContact O-N 3.07Å
5	A	52.9	Low	50.1	Low	101 Å²	101	108 Å²	108	84%	0.835	67%	0.666	S	S	*	*			trans	-59.2	113.8	172.1	0	0	0	0	0	108.6	N3 A7	N3-A5 PolarHBondContact O-N 3.15Å; A5-A7 PolarHBondContact O-N 3.38Å
6	I	50.2	Low	50.5	Low	162 Å²	162	109.4 Å²	109.4	83%	0.831	66%	0.662	S	S	*	*			trans	-69.4	98.8	171.6	-60.9	168.8	0	0	0	105.9	G4 S8	G4-I6 PolarHBondContact O-N 3.28Å; G4-I6 VanDerWaalsContact O-N 3.07Å; I6-S8 PolarHBondContact O-N 3.13Å
7	A	50.7	Low	50.8	Low	77 Å²	77	113.5 Å²	113.5	64%	0.636	67%	0.665	S	S	*	*			trans	-61.1	120	167.7	0	0	0	0	0	107.5	A5	A5-A7 PolarHBondContact O-N 3.38Å
8	S	56.5	Low	51.3	Low	60 Å²	60	112.3 Å²	112.3	42%	0.42	66%	0.655	S	S	.	*			trans	-60.4	137.1	-178.8	67	0	0	0	0	109.6	I6 G10 L11 A12	I6-S8 PolarHBondContact O-N 3.13Å; S8-G10 PolarHBondContact O-N 3.42Å; S8-G10 VanDerWaalsContact O-N 3.07Å; S8-L11 PolarHBondContact O-N 3.48Å; S8-A12 PolarHBondContact O-N 2.88Å; S8-A12 VanDerWaalsContact O-N 3.15Å
9	P	51.3	Low	51.9	Low	98 Å²	98	108.7 Å²	108.7	64%	0.636	64%	0.64	S	S	*	*	H	α-helix	trans	-57	-28.2	-176.7	15.3	-27.1	0	0	0	112.8	A12 L13	P9-A12 PolarHBondContact O-N 3.28Å; P9-L13 VanDerWaalsContact O-CG 3.3Å; P9-L13 WeakPolarHBondContact O-CG 3.43Å; P9-L13 PolarHBondContact O-N 2.95Å
10	G	55	Low	52.6	Low	33 Å²	33	109.4 Å²	109.4	34%	0.34	63%	0.634	S	S	.	*	H	α-helix	trans	-60.8	-50	170.8	0	0	0	0	0	112.8	S8 A12 L13 F14	S8-G10 PolarHBondContact O-N 3.42Å; S8-G10 VanDerWaalsContact O-N 3.07Å; G10-A12 VanDerWaalsContact C-N 3.28Å; G10-A12 PolarHBondContact O-N 3.02Å; G10-L13 PolarHBondContact O-N 3.13Å; G10-F14 WeakPolarHBondContact O-CD2 3.45Å; G10-F14 PolarHBondContact O-N 3.38Å
11	L	53.1	Low	53.3	Low	122 Å²	122	106.4 Å²	106.4	64%	0.639	62%	0.623	S	S	*	*	H	α-helix	trans	-64.6	-32.8	178.8	-121.6	123.7	0	0	0	112.4	S8 S15	S8-L11 PolarHBondContact O-N 3.48Å; L11-S15 VanDerWaalsContact O-CB 3.23Å; L11-S15 WeakPolarHBondContact O-CB 3.42Å; L11-S15 PolarHBondContact O-N 3.04Å
12	A	49.8	Very low	54.1	Low	40 Å²	40	101.1 Å²	101.1	33%	0.331	59%	0.593	S	S	.	*	H	α-helix	trans	-67.8	-40.9	174.9	0	0	0	0	0	112.1	S8 P9 G10 S15 Q16	S8-A12 PolarHBondContact O-N 2.88Å; S8-A12 VanDerWaalsContact O-N 3.15Å; P9-A12 PolarHBondContact O-N 3.28Å; G10-A12 VanDerWaalsContact C-N 3.28Å; G10-A12 PolarHBondContact O-N 3.02Å; A12-S15 PolarHBondContact O-N 2.81Å; A12-Q16 VanDerWaalsContact O-CG 3.32Å; A12-Q16 WeakPolarHBondContact O-CG 3.48Å; A12-Q16 PolarHBondContact O-N 3.11Å
13	L	54.3	Low	55.2	Low	112 Å²	112	103 Å²	103	59%	0.586	59%	0.587	S	S	*	*	H	α-helix	trans	-69.2	-40.5	177.4	-70.9	169.1	0	0	0	112.4	P9 G10 S15 Q16 Y17	P9-L13 VanDerWaalsContact O-CG 3.3Å; P9-L13 WeakPolarHBondContact O-CG 3.43Å; P9-L13 PolarHBondContact O-N 2.95Å; G10-L13 PolarHBondContact O-N 3.13Å; L13-S15 VanDerWaalsContact C-N 3.34Å; L13-S15 PolarHBondContact O-N 2.87Å; L13-Q16 PolarHBondContact O-N 3.44Å; L13-Y17 PolarHBondContact O-N 3.24Å
14	F	50.4	Low	56.1	Low	150 Å²	150	103.3 Å²	103.3	66%	0.658	58%	0.576	S	S	*	*	H	α-helix	trans	-65.3	-37.7	173.6	-73.4	-70.5	0	0	0	112.1	G10 Y17 D18	G10-F14 WeakPolarHBondContact O-CD2 3.45Å; G10-F14 PolarHBondContact O-N 3.38Å; F14-Y17 PolarHBondContact O-N 3.17Å; F14-D18 PolarHBondContact O-N 2.97Å; F14-D18 VanDerWaalsContact O-N 3.13Å
15	S	56.4	Low	56.5	Low	78 Å²	78	107.4 Å²	107.4	55%	0.545	57%	0.573	S	S	.	*	H	α-helix	trans	-65.6	-37.7	174.6	-178.5	0	0	0	0	112.7	L11 A12 L13 A19	L11-S15 VanDerWaalsContact O-CB 3.23Å; L11-S15 WeakPolarHBondContact O-CB 3.42Å; L11-S15 PolarHBondContact O-N 3.04Å; A12-S15 PolarHBondContact O-N 2.81Å; L13-S15 VanDerWaalsContact C-N 3.34Å; L13-S15 PolarHBondContact O-N 2.87Å; S15-A19 VanDerWaalsContact O-CB 3.28Å; S15-A19 WeakPolarHBondContact O-CB 3.27Å; S15-A19 PolarHBondContact O-N 3.39Å
16	Q	56.2	Low	56.7	Low	130 Å²	130	105.1 Å²	105.1	61%	0.607	56%	0.555	S	S	*	*	H	α-helix	trans	-69	-38.7	176.3	-75.3	179.1	4.1	0	0	112.8	A12 L13 A19 F20	A12-Q16 VanDerWaalsContact O-CG 3.32Å; A12-Q16 WeakPolarHBondContact O-CG 3.48Å; A12-Q16 PolarHBondContact O-N 3.11Å; L13-Q16 PolarHBondContact O-N 3.44Å; Q16-A19 PolarHBondContact O-N 3.28Å; Q16-F20 WeakPolarHBondContact O-CB 3.42Å; Q16-F20 PolarHBondContact O-N 3.04Å
17	Y	55.8	Low	56.9	Low	180 Å²	180	105.2 Å²	105.2	71%	0.706	55%	0.549	S	S	*	.	H	α-helix	trans	-64.8	-44.1	176.8	-169.1	-94.4	0	0	0	111.4	L13 F14 F20 A21	L13-Y17 PolarHBondContact O-N 3.24Å; F14-Y17 PolarHBondContact O-N 3.17Å; Y17-F20 PolarHBondContact O-N 3.08Å; Y17-A21 PolarHBondContact O-N 3.33Å
18	D	59.7	Low	57	Low	91 Å²	91	105.1 Å²	105.1	49%	0.487	54%	0.543	S	S	.	.	H	α-helix	trans	-64.2	-45.9	177.2	-161.4	30.9	0	0	0	111.1	F14 F20 A21 F22	F14-D18 PolarHBondContact O-N 2.97Å; F14-D18 VanDerWaalsContact O-N 3.13Å; D18-F20 VanDerWaalsContact C-N 3.29Å; D18-F20 PolarHBondContact O-N 3.05Å; D18-A21 PolarHBondContact O-N 3.39Å; D18-A21 VanDerWaalsContact O-N 3.16Å; D18-F22 WeakPolarHBondContact O-CD2 3.4Å; D18-F22 PolarHBondContact O-N 3.19Å; D18-F22 WeakPolarHBondContact OD1-CE2 3.45Å; D18-F22 WeakPolarHBondContact OD2-CE2 3.45Å
19	A	62.6	Low	56.7	Low	45 Å²	45	104.8 Å²	104.8	37%	0.372	54%	0.541	S	S	.	.	H	α-helix	trans	-61.4	-34.1	175.7	0	0	0	0	0	113.4	S15 Q16 K23	S15-A19 VanDerWaalsContact O-CB 3.28Å; S15-A19 WeakPolarHBondContact O-CB 3.27Å; S15-A19 PolarHBondContact O-N 3.39Å; Q16-A19 PolarHBondContact O-N 3.28Å; A19-K23 WeakPolarHBondContact O-CB 3.35Å; A19-K23 WeakPolarHBondContact O-CG 3.28Å; A19-K23 PolarHBondContact O-N 3.16Å
20	F	67.5	Low	56.7	Low	121 Å²	121	104.6 Å²	104.6	53%	0.531	54%	0.542	S	S	.	.	H	α-helix	trans	-67.9	-44.9	174.3	179.1	-101.8	0	0	0	111.7	Q16 Y17 D18 K23 R24	Q16-F20 WeakPolarHBondContact O-CB 3.42Å; Q16-F20 PolarHBondContact O-N 3.04Å; Y17-F20 PolarHBondContact O-N 3.08Å; D18-F20 VanDerWaalsContact C-N 3.29Å; D18-F20 PolarHBondContact O-N 3.05Å; F20-K23 PolarHBondContact O-N 3.07Å; F20-R24 HydrophobicContact CE1-CG 4.33Å; F20-R24 HydrophobicContact CZ-CG 4.3Å; F20-R24 PolarHBondContact O-N 3.3Å
21	A	65.4	Low	56.6	Low	47 Å²	47	114.2 Å²	114.2	39%	0.388	57%	0.568	S	S	.	*	H	α-helix	trans	-61.2	-46.5	176	0	0	0	0	0	111.7	Y17 D18 K23 R24 Y25	Y17-A21 PolarHBondContact O-N 3.33Å; D18-A21 PolarHBondContact O-N 3.39Å; D18-A21 VanDerWaalsContact O-N 3.16Å; A21-K23 PolarHBondContact O-N 3.25Å; A21-R24 PolarHBondContact O-N 3.24Å; A21-Y25 PolarHBondContact O-N 2.76Å
22	F	59.7	Low	56.5	Low	134 Å²	134	111 Å²	111	59%	0.588	56%	0.559	S	S	*	*	H	α-helix	trans	-60.7	-41.5	175.4	-84.7	-70.3	0	0	0	112.8	D18 R24 Y25 A26	D18-F22 WeakPolarHBondContact O-CD2 3.4Å; D18-F22 PolarHBondContact O-N 3.19Å; D18-F22 WeakPolarHBondContact OD1-CE2 3.45Å; D18-F22 WeakPolarHBondContact OD2-CE2 3.45Å; F22-R24 PolarHBondContact O-N 3.04Å; F22-Y25 PolarHBondContact O-N 3.25Å; F22-A26 VanDerWaalsContact O-CB 3.31Å; F22-A26 WeakPolarHBondContact O-CB 3.49Å; F22-A26 PolarHBondContact O-N 3.44Å
23	K	62.4	Low	56.3	Low	153 Å²	153	112.5 Å²	112.5	67%	0.665	58%	0.578	S	S	*	*	H	α-helix	trans	-64.4	-37.8	176.7	-81.8	178.6	-179.3	177.4	0	112.6	A19 F20 A21 K27	A19-K23 WeakPolarHBondContact O-CB 3.35Å; A19-K23 WeakPolarHBondContact O-CG 3.28Å; A19-K23 PolarHBondContact O-N 3.16Å; F20-K23 PolarHBondContact O-N 3.07Å; A21-K23 PolarHBondContact O-N 3.25Å; K23-K27 VanDerWaalsContact O-CB 3.26Å; K23-K27 WeakPolarHBondContact O-CB 3.21Å; K23-K27 PolarHBondContact O-N 3.48Å
24	R	62.2	Low	55.9	Low	174 Å²	174	115.7 Å²	115.7	66%	0.657	60%	0.596	S	S	*	*	H	α-helix	trans	-66.2	-42.9	175	-71.1	-171.6	73.2	171.5	3.5	111.3	F20 A21 F22 K27 S28	F20-R24 HydrophobicContact CE1-CG 4.33Å; F20-R24 HydrophobicContact CZ-CG 4.3Å; F20-R24 PolarHBondContact O-N 3.3Å; A21-R24 PolarHBondContact O-N 3.24Å; F22-R24 PolarHBondContact O-N 3.04Å; R24-K27 PolarHBondContact O-N 3.27Å; R24-S28 PolarHBondContact O-N 3.46Å
25	Y	54.4	Low	55.6	Low	147 Å²	147	111.4 Å²	111.4	58%	0.576	59%	0.594	S	S	*	*	H	α-helix	trans	-65.8	-47	178.5	-166.4	-102.4	0	0	0	111.8	A21 F22 K27 S28 S29 L42	A21-Y25 PolarHBondContact O-N 2.76Å; F22-Y25 PolarHBondContact O-N 3.25Å; Y25-K27 VanDerWaalsContact C-N 3.28Å; Y25-K27 PolarHBondContact O-N 2.98Å; Y25-S28 WeakPolarHBondContact O-CB 3.35Å; Y25-S28 PolarHBondContact O-N 3.3Å; Y25-S28 PolarHBondContact O-OG 3.49Å; Y25-S29 PolarHBondContact O-N 3.37Å; Y25-S29 VanDerWaalsContact O-N 3.07Å; Y25-L42 HydrophobicContact CE1-CD1 4.48Å
26	A	57.9	Low	55	Low	54 Å²	54	111.3 Å²	111.3	45%	0.446	60%	0.598	S	S	.	*	H	α-helix	trans	-62.3	-31.8	176.5	0	0	0	0	0	113.4	F22 S28 S29 S30	F22-A26 VanDerWaalsContact O-CB 3.31Å; F22-A26 WeakPolarHBondContact O-CB 3.49Å; F22-A26 PolarHBondContact O-N 3.44Å; A26-S28 VanDerWaalsContact C-N 3.32Å; A26-S29 WeakPolarHBondContact CA-OG 3.46Å; A26-S29 PolarHBondContact O-N 2.77Å; A26-S29 PolarHBondContact O-OG 3.22Å; A26-S30 PolarHBondContact O-N 3.41Å
27	K	54.1	Low	54.4	Low	164 Å²	164	112.6 Å²	112.6	71%	0.713	61%	0.608	S	S	*	*	H	α-helix	trans	-75.1	-21.6	175.2	-163.2	171.6	-175.9	178.8	0	112.8	K23 R24 Y25 S30	K23-K27 VanDerWaalsContact O-CB 3.26Å; K23-K27 WeakPolarHBondContact O-CB 3.21Å; K23-K27 PolarHBondContact O-N 3.48Å; R24-K27 PolarHBondContact O-N 3.27Å; Y25-K27 VanDerWaalsContact C-N 3.28Å; Y25-K27 PolarHBondContact O-N 2.98Å; K27-S30 PolarHBondContact O-OG 2.76Å
28	S	52.2	Low	54	Low	74 Å²	74	108 Å²	108	52%	0.517	61%	0.606	S	S	.	*	H	α-helix	trans	-80.5	-30	169.4	75.3	0	0	0	0	112.5	R24 Y25 A26	R24-S28 PolarHBondContact O-N 3.46Å; Y25-S28 WeakPolarHBondContact O-CB 3.35Å; Y25-S28 PolarHBondContact O-N 3.3Å; Y25-S28 PolarHBondContact O-OG 3.49Å; A26-S28 VanDerWaalsContact C-N 3.32Å
29	S	50.3	Low	53.6	Low	54 Å²	54	106.5 Å²	106.5	38%	0.378	60%	0.603	S	S	.	*	H	α-helix	trans	-77.6	-21.3	177.1	68.7	0	0	0	0	113.5	Y25 A26 R31 A32	Y25-S29 PolarHBondContact O-N 3.37Å; Y25-S29 VanDerWaalsContact O-N 3.07Å; A26-S29 WeakPolarHBondContact CA-OG 3.46Å; A26-S29 PolarHBondContact O-N 2.77Å; A26-S29 PolarHBondContact O-OG 3.22Å; S29-R31 VanDerWaalsContact C-N 3.28Å; S29-R31 PolarHBondContact O-N 3.33Å; S29-A32 PolarHBondContact O-N 2.87Å
30	S	52.1	Low	52.8	Low	93 Å²	93	109.1 Å²	109.1	65%	0.65	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75	-12.1	177.1	71	0	0	0	0	114.7	A26 K27	A26-S30 PolarHBondContact O-N 3.41Å; K27-S30 PolarHBondContact O-OG 2.76Å
31	R	52.4	Low	51.9	Low	235 Å²	235	104.7 Å²	104.7	89%	0.887	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.9	-11.6	168.2	-64.4	-170.4	99.1	171.9	6	113	S29	S29-R31 VanDerWaalsContact C-N 3.28Å; S29-R31 PolarHBondContact O-N 3.33Å
32	A	49.8	Very low	51.1	Low	55 Å²	55	106.9 Å²	106.9	46%	0.455	61%	0.609	S	S	.	*	S	Bend	trans	-90.6	103	173.9	0	0	0	0	0	108.7	S29	S29-A32 PolarHBondContact O-N 2.87Å
33	G	46.4	Very low	50.4	Low	71 Å²	71	103.3 Å²	103.3	73%	0.732	60%	0.604	S	S	*	*			trans	-52.9	139.2	179.3	0	0	0	0	0	113	G35	G33-G35 PolarHBondContact O-N 3.47Å; G33-G35 VanDerWaalsContact O-N 3.15Å
34	N	46.2	Very low	49.8	Very low	180 Å²	180	101.5 Å²	101.5	96%	0.963	60%	0.602	S	S	*	*	S	Bend	trans	14.3	82.3	162.1	-86.1	-15.3	0	0	0	116.9
35	G	43.7	Very low	48.8	Very low	60 Å²	60	99.7 Å²	99.7	62%	0.619	60%	0.599	S	S	*	*			trans	143.1	22.7	159.7	0	0	0	0	0	116.9	G33 I37	G33-G35 PolarHBondContact O-N 3.47Å; G33-G35 VanDerWaalsContact O-N 3.15Å; G35-I37 PolarHBondContact O-N 2.95Å
36	A	44.6	Very low	48.6	Very low	75 Å²	75	96.2 Å²	96.2	62%	0.62	60%	0.596	S	S	*	*			trans	-42.6	103	175.7	0	0	0	0	0	110.9	A38	A36-A38 PolarHBondContact O-N 2.71Å
37	I	43.9	Very low	48	Very low	158 Å²	158	100.2 Å²	100.2	81%	0.81	61%	0.605	S	S	*	*			trans	-60.7	102.3	175.8	-60.5	169.6	0	0	0	104.7	G35 S39	G35-I37 PolarHBondContact O-N 2.95Å; I37-S39 PolarHBondContact O-N 2.92Å
38	A	47.4	Very low	47.7	Very low	82 Å²	82	100.6 Å²	100.6	68%	0.678	60%	0.603	S	S	*	*			trans	-60	96.6	167.3	0	0	0	0	0	105.8	A36	A36-A38 PolarHBondContact O-N 2.71Å
39	S	49.8	Very low	47.8	Very low	61 Å²	61	101.8 Å²	101.8	43%	0.427	60%	0.604	S	S	.	*			trans	-58.8	141.2	-176.5	73.3	0	0	0	0	108	I37 G41 L42	I37-S39 PolarHBondContact O-N 2.92Å; S39-G41 PolarHBondContact O-N 3.3Å; S39-L42 WeakPolarHBondContact O-CB 3.36Å; S39-L42 PolarHBondContact O-N 2.83Å
40	P	46.3	Very low	47.9	Very low	100 Å²	100	101.6 Å²	101.6	65%	0.649	61%	0.606	S	S	*	*	H	α-helix	trans	-55.2	-15.6	176.8	17.1	-28.6	0	0	0	113.3	A43 L44	P40-A43 PolarHBondContact O-N 2.95Å; P40-L44 WeakPolarHBondContact O-CG 3.18Å; P40-L44 PolarHBondContact O-N 2.8Å; P40-L44 VanDerWaalsContact O-N 3.11Å
41	G	48	Very low	48	Very low	27 Å²	27	102.7 Å²	102.7	28%	0.278	60%	0.599	S	S	.	*	H	α-helix	trans	-56.6	-48.1	165.4	0	0	0	0	0	112.8	S39 A43 L44 F45	S39-G41 PolarHBondContact O-N 3.3Å; G41-A43 VanDerWaalsContact C-N 3.29Å; G41-A43 PolarHBondContact O-N 3.02Å; G41-L44 PolarHBondContact O-N 3.45Å; G41-L44 VanDerWaalsContact O-N 3.15Å; G41-F45 WeakPolarHBondContact O-CD2 3.24Å; G41-F45 PolarHBondContact O-N 3.14Å
42	L	48.9	Very low	48.3	Very low	93 Å²	93	93.6 Å²	93.6	49%	0.487	57%	0.574	S	S	.	*	H	α-helix	trans	-64.5	-31.6	-178.6	-138.8	105.8	0	0	0	112.9	Y25 S39 S46	Y25-L42 HydrophobicContact CE1-CD1 4.48Å; S39-L42 WeakPolarHBondContact O-CB 3.36Å; S39-L42 PolarHBondContact O-N 2.83Å; L42-S46 PolarHBondContact O-N 2.87Å
43	A	46.3	Very low	48.4	Very low	59 Å²	59	97.7 Å²	97.7	49%	0.488	58%	0.582	S	S	.	*	H	α-helix	trans	-77.2	-30.3	176	0	0	0	0	0	112.8	P40 G41 S46	P40-A43 PolarHBondContact O-N 2.95Å; G41-A43 VanDerWaalsContact C-N 3.29Å; G41-A43 PolarHBondContact O-N 3.02Å; A43-S46 PolarHBondContact O-OG 3.02Å
44	L	48.5	Very low	49	Very low	116 Å²	116	101.8 Å²	101.8	61%	0.607	58%	0.58	S	S	*	*	H	α-helix	trans	-76.9	-33.6	173.6	-74.8	166.2	0	0	0	112.2	P40 G41 Q47 Y48	P40-L44 WeakPolarHBondContact O-CG 3.18Å; P40-L44 PolarHBondContact O-N 2.8Å; P40-L44 VanDerWaalsContact O-N 3.11Å; G41-L44 PolarHBondContact O-N 3.45Å; G41-L44 VanDerWaalsContact O-N 3.15Å; L44-Q47 PolarHBondContact O-N 3.46Å; L44-Y48 PolarHBondContact O-N 3.32Å
45	F	42.5	Very low	49.5	Very low	136 Å²	136	101.4 Å²	101.4	60%	0.596	57%	0.565	S	S	*	*	H	α-helix	trans	-64.7	-37.9	172.8	-75.1	-68.2	0	0	0	112.1	G41 Q47 Y48 D49	G41-F45 WeakPolarHBondContact O-CD2 3.24Å; G41-F45 PolarHBondContact O-N 3.14Å; F45-Q47 VanDerWaalsContact C-N 3.3Å; F45-Q47 PolarHBondContact O-N 2.74Å; F45-Y48 PolarHBondContact O-N 3.39Å; F45-D49 VanDerWaalsContact O-CB 3.32Å; F45-D49 WeakPolarHBondContact O-CB 3.42Å; F45-D49 PolarHBondContact O-N 2.93Å
46	S	48.4	Very low	50	Low	73 Å²	73	105.3 Å²	105.3	51%	0.51	56%	0.562	S	S	.	*	H	α-helix	trans	-64.7	-31.2	179	77.9	0	0	0	0	113.8	L42 A43 A50	L42-S46 PolarHBondContact O-N 2.87Å; A43-S46 PolarHBondContact O-OG 3.02Å; S46-A50 VanDerWaalsContact O-CB 3.26Å; S46-A50 WeakPolarHBondContact O-CB 3.03Å; S46-A50 PolarHBondContact O-N 3.35Å
47	Q	46.1	Very low	50.5	Low	139 Å²	139	103.6 Å²	103.6	65%	0.65	55%	0.547	S	S	*	.	H	α-helix	trans	-77.5	-38.5	175.1	-67.7	-172.4	-2.3	0	0	112.1	L44 F45 A50 F51	L44-Q47 PolarHBondContact O-N 3.46Å; F45-Q47 VanDerWaalsContact C-N 3.3Å; F45-Q47 PolarHBondContact O-N 2.74Å; Q47-A50 PolarHBondContact O-N 2.93Å; Q47-F51 WeakPolarHBondContact O-CB 3.24Å; Q47-F51 PolarHBondContact O-N 3.07Å
48	Y	48.3	Very low	51.1	Low	171 Å²	171	100 Å²	100	67%	0.671	54%	0.536	S	S	*	.	H	α-helix	trans	-67.4	-40.9	176.1	-154.5	-93.2	0	0	0	111.1	L44 F45 F51 A52	L44-Y48 PolarHBondContact O-N 3.32Å; F45-Y48 PolarHBondContact O-N 3.39Å; Y48-F51 PolarHBondContact O-N 3.43Å; Y48-A52 VanDerWaalsContact O-CB 3.22Å; Y48-A52 WeakPolarHBondContact O-CB 3.48Å; Y48-A52 PolarHBondContact O-N 3.23Å
49	D	53.6	Low	51.7	Low	99 Å²	99	99 Å²	99	53%	0.529	52%	0.524	S	S	.	.	H	α-helix	trans	-66.6	-40.2	174.3	-73.7	-22.8	0	0	0	111.3	F45 F51 A52 F53	F45-D49 VanDerWaalsContact O-CB 3.32Å; F45-D49 WeakPolarHBondContact O-CB 3.42Å; F45-D49 PolarHBondContact O-N 2.93Å; D49-F51 VanDerWaalsContact C-N 3.34Å; D49-F51 PolarHBondContact O-N 3.5Å; D49-A52 PolarHBondContact O-N 3.21Å; D49-F53 WeakPolarHBondContact O-CA 3.31Å; D49-F53 WeakPolarHBondContact O-CB 3.45Å; D49-F53 PolarHBondContact O-N 3.03Å
50	A	53.1	Low	52.1	Low	51 Å²	51	98.5 Å²	98.5	42%	0.421	52%	0.518	S	S	.	.	H	α-helix	trans	-65.6	-36.6	175.4	0	0	0	0	0	112.7	S46 Q47 K54	S46-A50 VanDerWaalsContact O-CB 3.26Å; S46-A50 WeakPolarHBondContact O-CB 3.03Å; S46-A50 PolarHBondContact O-N 3.35Å; Q47-A50 PolarHBondContact O-N 2.93Å; A50-K54 WeakPolarHBondContact O-CB 3.45Å; A50-K54 VanDerWaalsContact O-CG 3.31Å; A50-K54 WeakPolarHBondContact O-CG 3.38Å; A50-K54 PolarHBondContact O-N 3.05Å
51	F	54.6	Low	52.8	Low	116 Å²	116	96.6 Å²	96.6	51%	0.509	51%	0.507	S	S	.	.	H	α-helix	trans	-72.1	-45.7	176.2	-175.3	-97.4	0	0	0	111.9	Q47 Y48 D49 F53 K54 R55	Q47-F51 WeakPolarHBondContact O-CB 3.24Å; Q47-F51 PolarHBondContact O-N 3.07Å; Y48-F51 PolarHBondContact O-N 3.43Å; D49-F51 VanDerWaalsContact C-N 3.34Å; D49-F51 PolarHBondContact O-N 3.5Å; F51-F53 VanDerWaalsContact C-N 3.34Å; F51-K54 PolarHBondContact O-N 3.15Å; F51-R55 HydrophobicContact CD1-CG 4.46Å; F51-R55 HydrophobicContact CE1-CG 4.15Å; F51-R55 HydrophobicContact CZ-CG 4.39Å; F51-R55 VanDerWaalsContact CZ-NE 3.31Å; F51-R55 PolarHBondContact O-N 2.83Å
52	A	57.4	Low	53.6	Low	44 Å²	44	98.2 Å²	98.2	36%	0.364	51%	0.514	S	S	.	.	H	α-helix	trans	-62.2	-41.9	175	0	0	0	0	0	111	Y48 D49 R55 Y56	Y48-A52 VanDerWaalsContact O-CB 3.22Å; Y48-A52 WeakPolarHBondContact O-CB 3.48Å; Y48-A52 PolarHBondContact O-N 3.23Å; D49-A52 PolarHBondContact O-N 3.21Å; A52-R55 PolarHBondContact O-N 2.75Å; A52-Y56 WeakPolarHBondContact O-CB 3.3Å; A52-Y56 PolarHBondContact O-N 3.31Å
53	F	52.7	Low	54.3	Low	141 Å²	141	97.5 Å²	97.5	62%	0.618	51%	0.51	S	S	*	.	H	α-helix	trans	-66.4	-38.8	175.7	-165.5	-89.3	0	0	0	111.7	D49 F51 A57	D49-F53 WeakPolarHBondContact O-CA 3.31Å; D49-F53 WeakPolarHBondContact O-CB 3.45Å; D49-F53 PolarHBondContact O-N 3.03Å; F51-F53 VanDerWaalsContact C-N 3.34Å; F53-A57 WeakPolarHBondContact O-CA 3.35Å; F53-A57 WeakPolarHBondContact O-CB 3.45Å; F53-A57 PolarHBondContact O-N 2.87Å
54	K	57.8	Low	55.1	Low	156 Å²	156	96.6 Å²	96.6	68%	0.678	50%	0.503	S	S	*	.	H	α-helix	trans	-64.8	-41.9	172.7	-82.2	179.4	-178.8	180	0	112.3	A50 F51 C58	A50-K54 WeakPolarHBondContact O-CB 3.45Å; A50-K54 VanDerWaalsContact O-CG 3.31Å; A50-K54 WeakPolarHBondContact O-CG 3.38Å; A50-K54 PolarHBondContact O-N 3.05Å; F51-K54 PolarHBondContact O-N 3.15Å; K54-C58 WeakPolarHBondContact O-CB 3.31Å; K54-C58 PolarHBondContact O-N 2.73Å
55	R	57.7	Low	55.8	Low	173 Å²	173	99.7 Å²	99.7	65%	0.653	51%	0.506	S	S	*	.	H	α-helix	trans	-68.2	-42.2	176.5	-74.2	-144.4	176.9	-160.2	-0.4	112	F51 A52 C58 S59	F51-R55 HydrophobicContact CD1-CG 4.46Å; F51-R55 HydrophobicContact CE1-CG 4.15Å; F51-R55 HydrophobicContact CZ-CG 4.39Å; F51-R55 VanDerWaalsContact CZ-NE 3.31Å; F51-R55 PolarHBondContact O-N 2.83Å; A52-R55 PolarHBondContact O-N 2.75Å; R55-C58 PolarHBondContact O-N 3.47Å; R55-S59 VanDerWaalsContact O-CB 3.24Å; R55-S59 WeakPolarHBondContact O-CB 3.2Å; R55-S59 PolarHBondContact O-N 3.16Å
56	Y	53.9	Low	56.8	Low	142 Å²	142	98.8 Å²	98.8	56%	0.557	50%	0.504	S	S	*	.	H	α-helix	trans	-62.2	-50.9	173.9	-176.3	-103.1	0	0	0	110.1	A52 C58 S59 T60	A52-Y56 WeakPolarHBondContact O-CB 3.3Å; A52-Y56 PolarHBondContact O-N 3.31Å; Y56-C58 VanDerWaalsContact C-N 3.33Å; Y56-C58 PolarHBondContact O-N 3.3Å; Y56-S59 CarbonylContact O-C 3.55Å; Y56-S59 PolarHBondContact O-N 3.04Å; Y56-S59 VanDerWaalsContact O-N 3.14Å; Y56-T60 HydrophobicContact CD1-CG2 3.93Å; Y56-T60 HydrophobicContact CD2-CG2 4.25Å; Y56-T60 HydrophobicContact CE1-CG2 3.59Å; Y56-T60 HydrophobicContact CE2-CG2 3.92Å; Y56-T60 HydrophobicContact CG-CG2 4.25Å; Y56-T60 WeakPolarHBondContact O-CB 3.22Å; Y56-T60 VanDerWaalsContact O-CG2 3.31Å; Y56-T60 WeakPolarHBondContact O-CG2 3.48Å; Y56-T60 PolarHBondContact O-N 2.95Å; Y56-T60 PolarHBondContact O-OG1 3.28Å; Y56-T60 VanDerWaalsContact O-OG1 3.05Å
57	A	56.2	Low	57.3	Low	38 Å²	38	98.6 Å²	98.6	31%	0.314	50%	0.497	S	S	.	.	H	α-helix	trans	-58.3	-41.2	177.4	0	0	0	0	0	112.8	F53 T60 S61	F53-A57 WeakPolarHBondContact O-CA 3.35Å; F53-A57 WeakPolarHBondContact O-CB 3.45Å; F53-A57 PolarHBondContact O-N 2.87Å; A57-T60 VanDerWaalsContact C-OG1 3.31Å; A57-T60 WeakPolarHBondContact CA-OG1 3.36Å; A57-T60 PolarHBondContact O-OG1 3.45Å; A57-S61 WeakPolarHBondContact O-CB 3.01Å; A57-S61 PolarHBondContact O-N 3.06Å; A57-S61 PolarHBondContact O-OG 2.93Å
58	C	56.6	Low	58	Low	84 Å²	84	97.7 Å²	97.7	57%	0.568	49%	0.492	S	S	*	.	H	α-helix	trans	-70	-39.2	176.7	-164	0	0	0	0	112	K54 R55 Y56 S61 S62	K54-C58 WeakPolarHBondContact O-CB 3.31Å; K54-C58 PolarHBondContact O-N 2.73Å; R55-C58 PolarHBondContact O-N 3.47Å; Y56-C58 VanDerWaalsContact C-N 3.33Å; Y56-C58 PolarHBondContact O-N 3.3Å; C58-S61 PolarHBondContact O-N 3.32Å; C58-S61 PolarHBondContact O-OG 2.91Å; C58-S62 WeakPolarHBondContact O-CB 3.19Å; C58-S62 PolarHBondContact O-N 3.29Å
59	S	58.3	Low	58.5	Low	60 Å²	60	95.7 Å²	95.7	42%	0.42	49%	0.489	S	S	.	.	H	α-helix	trans	-66.5	-43.5	173.1	179.7	0	0	0	0	111.1	R55 Y56 S61 S62 I63	R55-S59 VanDerWaalsContact O-CB 3.24Å; R55-S59 WeakPolarHBondContact O-CB 3.2Å; R55-S59 PolarHBondContact O-N 3.16Å; Y56-S59 CarbonylContact O-C 3.55Å; Y56-S59 PolarHBondContact O-N 3.04Å; Y56-S59 VanDerWaalsContact O-N 3.14Å; S59-S61 VanDerWaalsContact C-N 3.33Å; S59-S61 PolarHBondContact O-N 3.07Å; S59-S62 PolarHBondContact O-N 3.33Å; S59-I63 WeakPolarHBondContact O-CB 3.32Å; S59-I63 WeakPolarHBondContact O-CD1 3.21Å; S59-I63 WeakPolarHBondContact O-CG1 3.21Å; S59-I63 PolarHBondContact O-N 3.29Å
60	T	59.5	Low	58.5	Low	50 Å²	50	95.7 Å²	95.7	31%	0.307	49%	0.486	S	S	.	.	H	α-helix	trans	-67.6	-31.4	177	55.9	0	0	0	0	112.1	Y56 A57 A64	Y56-T60 HydrophobicContact CD1-CG2 3.93Å; Y56-T60 HydrophobicContact CD2-CG2 4.25Å; Y56-T60 HydrophobicContact CE1-CG2 3.59Å; Y56-T60 HydrophobicContact CE2-CG2 3.92Å; Y56-T60 HydrophobicContact CG-CG2 4.25Å; Y56-T60 WeakPolarHBondContact O-CB 3.22Å; Y56-T60 VanDerWaalsContact O-CG2 3.31Å; Y56-T60 WeakPolarHBondContact O-CG2 3.48Å; Y56-T60 PolarHBondContact O-N 2.95Å; Y56-T60 PolarHBondContact O-OG1 3.28Å; Y56-T60 VanDerWaalsContact O-OG1 3.05Å; A57-T60 VanDerWaalsContact C-OG1 3.31Å; A57-T60 WeakPolarHBondContact CA-OG1 3.36Å; A57-T60 PolarHBondContact O-OG1 3.45Å; T60-A64 WeakPolarHBondContact O-CA 3.05Å; T60-A64 WeakPolarHBondContact O-CB 3.23Å; T60-A64 PolarHBondContact O-N 3.43Å
61	S	60.4	Low	58.6	Low	61 Å²	61	97.3 Å²	97.3	43%	0.427	48%	0.481	S	S	.	.	H	α-helix	trans	-74.5	-35.6	174.9	68.4	0	0	0	0	111.8	A57 C58 S59 R65	A57-S61 WeakPolarHBondContact O-CB 3.01Å; A57-S61 PolarHBondContact O-N 3.06Å; A57-S61 PolarHBondContact O-OG 2.93Å; C58-S61 PolarHBondContact O-N 3.32Å; C58-S61 PolarHBondContact O-OG 2.91Å; S59-S61 VanDerWaalsContact C-N 3.33Å; S59-S61 PolarHBondContact O-N 3.07Å; S61-R65 WeakPolarHBondContact O-CB 3.18Å; S61-R65 PolarHBondContact O-N 3.5Å
62	S	64.3	Low	58.8	Low	60 Å²	60	97.3 Å²	97.3	42%	0.42	49%	0.49	S	S	.	.	H	α-helix	trans	-65.7	-45.1	170.8	-171.2	0	0	0	0	111.6	C58 S59 R65 Q66	C58-S62 WeakPolarHBondContact O-CB 3.19Å; C58-S62 PolarHBondContact O-N 3.29Å; S59-S62 PolarHBondContact O-N 3.33Å; S62-R65 PolarHBondContact O-N 2.9Å; S62-Q66 WeakPolarHBondContact O-CG 3.41Å; S62-Q66 PolarHBondContact O-N 2.99Å
63	I	64.5	Low	58.8	Low	78 Å²	78	101.3 Å²	101.3	40%	0.4	51%	0.506	S	S	.	.	H	α-helix	trans	-66.7	-40.1	176.4	-67.8	164.1	0	0	0	110.1	S59 R65 Q66 L67	S59-I63 WeakPolarHBondContact O-CB 3.32Å; S59-I63 WeakPolarHBondContact O-CD1 3.21Å; S59-I63 WeakPolarHBondContact O-CG1 3.21Å; S59-I63 PolarHBondContact O-N 3.29Å; I63-R65 PolarHBondContact O-N 2.97Å; I63-Q66 PolarHBondContact O-N 3.13Å; I63-L67 HydrophobicContact CG2-CD1 3.83Å; I63-L67 HydrophobicContact CG2-CG 4.22Å; I63-L67 WeakPolarHBondContact O-CB 3Å; I63-L67 VanDerWaalsContact O-CG 3.28Å; I63-L67 WeakPolarHBondContact O-CG 3.45Å; I63-L67 PolarHBondContact O-N 2.97Å
64	A	62.4	Low	59	Low	41 Å²	41	99.6 Å²	99.6	34%	0.339	50%	0.5	S	S	.	.	H	α-helix	trans	-62.9	-41.9	175.6	0	0	0	0	0	111.3	T60 L67 E68	T60-A64 WeakPolarHBondContact O-CA 3.05Å; T60-A64 WeakPolarHBondContact O-CB 3.23Å; T60-A64 PolarHBondContact O-N 3.43Å; A64-L67 PolarHBondContact O-N 3.23Å; A64-E68 WeakPolarHBondContact O-CB 3.45Å; A64-E68 VanDerWaalsContact O-CG 3.31Å; A64-E68 WeakPolarHBondContact O-CG 2.9Å; A64-E68 PolarHBondContact O-N 2.73Å
65	R	62.7	Low	59	Low	181 Å²	181	96.6 Å²	96.6	68%	0.683	50%	0.496	S	S	*	.	H	α-helix	trans	-63.3	-41	172.5	-84.5	-178.5	167.8	176.9	-3.4	112.8	S61 S62 I63 L67 E68 Q69	S61-R65 WeakPolarHBondContact O-CB 3.18Å; S61-R65 PolarHBondContact O-N 3.5Å; S62-R65 PolarHBondContact O-N 2.9Å; I63-R65 PolarHBondContact O-N 2.97Å; R65-L67 VanDerWaalsContact C-N 3.34Å; R65-E68 PolarHBondContact O-N 3.18Å; R65-Q69 WeakPolarHBondContact O-CG 3.32Å; R65-Q69 PolarHBondContact O-N 3.03Å
66	Q	63.3	Low	59	Low	117 Å²	117	97.3 Å²	97.3	55%	0.547	50%	0.504	S	S	.	.	H	α-helix	trans	-65.8	-38.9	175.8	-75.8	175.6	-20.1	0	0	111.6	S62 I63 Q69 H70	S62-Q66 WeakPolarHBondContact O-CG 3.41Å; S62-Q66 PolarHBondContact O-N 2.99Å; I63-Q66 PolarHBondContact O-N 3.13Å; Q66-Q69 PolarHBondContact O-N 3.07Å; Q66-H70 VanDerWaalsContact O-CB 3.27Å; Q66-H70 WeakPolarHBondContact O-CB 3.36Å; Q66-H70 PolarHBondContact O-N 3.31Å
67	L	59.7	Low	59	Low	69 Å²	69	93 Å²	93	36%	0.361	49%	0.494	S	S	.	.	H	α-helix	trans	-68	-42	174.1	-74.5	170.9	0	0	0	111.1	I63 A64 R65 Q69 H70 W71	I63-L67 HydrophobicContact CG2-CD1 3.83Å; I63-L67 HydrophobicContact CG2-CG 4.22Å; I63-L67 WeakPolarHBondContact O-CB 3Å; I63-L67 VanDerWaalsContact O-CG 3.28Å; I63-L67 WeakPolarHBondContact O-CG 3.45Å; I63-L67 PolarHBondContact O-N 2.97Å; A64-L67 PolarHBondContact O-N 3.23Å; R65-L67 VanDerWaalsContact C-N 3.34Å; L67-Q69 VanDerWaalsContact C-N 3.34Å; L67-Q69 PolarHBondContact O-N 2.81Å; L67-H70 CarbonylContact O-C 3.59Å; L67-H70 PolarHBondContact O-N 3.44Å; L67-W71 HydrophobicContact CB-CD2 4.3Å; L67-W71 HydrophobicContact CB-CH2 4.22Å; L67-W71 HydrophobicContact CB-CZ2 3.91Å; L67-W71 HydrophobicContact CD1-CH2 4.47Å; L67-W71 HydrophobicContact CD1-CZ2 4.16Å; L67-W71 HydrophobicContact CD2-CZ2 4.07Å; L67-W71 HydrophobicContact CG-CZ2 4.28Å; L67-W71 WeakPolarHBondContact O-CB 3.44Å; L67-W71 VanDerWaalsContact O-CD1 3.3Å; L67-W71 VanDerWaalsContact O-CD2 3.29Å; L67-W71 PolarHBondContact O-N 3.49Å
68	E	60.1	Low	58.8	Low	119 Å²	119	94.2 Å²	94.2	56%	0.556	49%	0.494	S	S	*	.	H	α-helix	trans	-59.1	-44.7	173.5	-79.2	174.3	-178.3	0	0	111.2	A64 R65 W71 V72	A64-E68 WeakPolarHBondContact O-CB 3.45Å; A64-E68 VanDerWaalsContact O-CG 3.31Å; A64-E68 WeakPolarHBondContact O-CG 2.9Å; A64-E68 PolarHBondContact O-N 2.73Å; R65-E68 PolarHBondContact O-N 3.18Å; E68-W71 PolarHBondContact O-N 3.35Å; E68-V72 VanDerWaalsContact O-CG2 3.24Å; E68-V72 WeakPolarHBondContact O-CG2 3.31Å; E68-V72 PolarHBondContact O-N 3.44Å
69	Q	59	Low	58.8	Low	130 Å²	130	92.6 Å²	92.6	61%	0.607	48%	0.483	S	S	*	.	H	α-helix	trans	-63.1	-47.6	174.3	-76.3	177.6	-21.3	0	0	111.7	R65 Q66 L67 W71 V72 D73	R65-Q69 WeakPolarHBondContact O-CG 3.32Å; R65-Q69 PolarHBondContact O-N 3.03Å; Q66-Q69 PolarHBondContact O-N 3.07Å; L67-Q69 VanDerWaalsContact C-N 3.34Å; L67-Q69 PolarHBondContact O-N 2.81Å; Q69-W71 VanDerWaalsContact C-N 3.26Å; Q69-W71 PolarHBondContact O-N 2.99Å; Q69-V72 PolarHBondContact O-N 3.02Å; Q69-D73 PolarHBondContact O-N 2.94Å; Q69-D73 VanDerWaalsContact O-N 3.07Å
70	H	54	Low	58.8	Low	98 Å²	98	97.3 Å²	97.3	45%	0.454	50%	0.496	S	S	.	.	H	α-helix	trans	-63.3	-31.5	177.8	-167.9	-55.5	0	0	0	112.6	Q66 L67 E74	Q66-H70 VanDerWaalsContact O-CB 3.27Å; Q66-H70 WeakPolarHBondContact O-CB 3.36Å; Q66-H70 PolarHBondContact O-N 3.31Å; L67-H70 CarbonylContact O-C 3.59Å; L67-H70 PolarHBondContact O-N 3.44Å; H70-E74 IonicContact CE1-OE2 3.63Å; H70-E74 PolarHBondContact O-N 3.44Å
71	W	56.3	Low	59	Low	85 Å²	85	100.9 Å²	100.9	32%	0.322	51%	0.507	S	S	.	.	H	α-helix	trans	-81.4	-26	179.4	-64.4	-12.5	0	0	0	112.9	L67 E68 Q69	L67-W71 HydrophobicContact CB-CD2 4.3Å; L67-W71 HydrophobicContact CB-CH2 4.22Å; L67-W71 HydrophobicContact CB-CZ2 3.91Å; L67-W71 HydrophobicContact CD1-CH2 4.47Å; L67-W71 HydrophobicContact CD1-CZ2 4.16Å; L67-W71 HydrophobicContact CD2-CZ2 4.07Å; L67-W71 HydrophobicContact CG-CZ2 4.28Å; L67-W71 WeakPolarHBondContact O-CB 3.44Å; L67-W71 VanDerWaalsContact O-CD1 3.3Å; L67-W71 VanDerWaalsContact O-CD2 3.29Å; L67-W71 PolarHBondContact O-N 3.49Å; E68-W71 PolarHBondContact O-N 3.35Å; Q69-W71 VanDerWaalsContact C-N 3.26Å; Q69-W71 PolarHBondContact O-N 2.99Å
72	V	57.2	Low	59.1	Low	116 Å²	116	102.6 Å²	102.6	70%	0.703	51%	0.511	S	S	*	.	H	α-helix	trans	-69.2	-40.9	168.5	169.1	0	0	0	0	110.5	E68 Q69	E68-V72 VanDerWaalsContact O-CG2 3.24Å; E68-V72 WeakPolarHBondContact O-CG2 3.31Å; E68-V72 PolarHBondContact O-N 3.44Å; Q69-V72 PolarHBondContact O-N 3.02Å
73	D	59.3	Low	59.1	Low	129 Å²	129	107.3 Å²	107.3	69%	0.69	52%	0.52	S	S	*	.	H	α-helix	trans	-76.6	-29	-178.5	-67.6	-26.1	0	0	0	112.9	Q69	Q69-D73 PolarHBondContact O-N 2.94Å; Q69-D73 VanDerWaalsContact O-N 3.07Å
74	E	56.9	Low	58.7	Low	104 Å²	104	107.2 Å²	107.2	49%	0.486	53%	0.526	S	S	.	.			trans	-133.4	72.8	179.5	-66.4	-166.4	168.8	0	0	114.1	H70 K76 S77	H70-E74 IonicContact CE1-OE2 3.63Å; H70-E74 PolarHBondContact O-N 3.44Å; E74-K76 PolarHBondContact O-N 2.67Å; E74-K76 VanDerWaalsContact O-N 3.08Å; E74-S77 WeakPolarHBondContact O-CB 3.5Å; E74-S77 PolarHBondContact O-N 3.02Å
75	P	56.2	Low	58.4	Low	93 Å²	93	107.9 Å²	107.9	60%	0.604	53%	0.528	S	S	*	.	H	α-helix	trans	-62.5	-23.8	-177.5	22.8	-33.2	0	0	0	113.7	S77	P75-S77 VanDerWaalsContact C-N 3.35Å
76	K	58.1	Low	58.2	Low	188 Å²	188	101.8 Å²	101.8	82%	0.817	52%	0.517	S	S	*	.	H	α-helix	trans	-71.3	-28.5	177.2	-66.7	-174.5	-178.7	177.5	0	112.8	E74 S79	E74-K76 PolarHBondContact O-N 2.67Å; E74-K76 VanDerWaalsContact O-N 3.08Å; K76-S79 PolarHBondContact O-OG 3.07Å
77	S	55.1	Low	58.1	Low	51 Å²	51	101.3 Å²	101.3	36%	0.357	52%	0.518	S	S	.	.	H	α-helix	trans	-72.5	-34.1	-177.3	-169.6	0	0	0	0	112.3	E74 P75 S79 K80 F81	E74-S77 WeakPolarHBondContact O-CB 3.5Å; E74-S77 PolarHBondContact O-N 3.02Å; P75-S77 VanDerWaalsContact C-N 3.35Å; S77-S79 PolarHBondContact O-N 3.3Å; S77-K80 PolarHBondContact O-N 3.31Å; S77-K80 VanDerWaalsContact O-N 3.17Å; S77-F81 PolarHBondContact O-N 3.18Å; S77-F81 VanDerWaalsContact O-N 3.11Å
78	H	50.7	Low	57.8	Low	65 Å²	65	103.4 Å²	103.4	30%	0.301	53%	0.529	S	S	.	.	H	α-helix	trans	-58.8	-45.8	179.3	-174.8	-178.2	0	0	0	112.8	K80 F81 L82	H78-K80 PolarHBondContact O-N 3.03Å; H78-F81 PolarHBondContact O-N 3.4Å; H78-L82 VanDerWaalsContact NE2-CD1 3.35Å; H78-L82 WeakPolarHBondContact NE2-CD1 3.4Å; H78-L82 PolarHBondContact O-N 3.25Å
79	S	56.4	Low	57.5	Low	49 Å²	49	100.8 Å²	100.8	34%	0.343	53%	0.527	S	S	.	.	H	α-helix	trans	-65.4	-26.5	-179.1	76.7	0	0	0	0	113.4	K76 S77 R83	K76-S79 PolarHBondContact O-OG 3.07Å; S77-S79 PolarHBondContact O-N 3.3Å; S79-R83 WeakPolarHBondContact O-CB 3.31Å; S79-R83 WeakPolarHBondContact O-CG 3.28Å; S79-R83 PolarHBondContact O-N 3.04Å; S79-R83 PolarHBondContact O-NE 2.86Å; S79-R83 PolarHBondContact OG-NH2 3.23Å
80	K	59.1	Low	57.4	Low	160 Å²	160	99.4 Å²	99.4	70%	0.696	53%	0.528	S	S	*	.	H	α-helix	trans	-79.5	-41.2	177.8	-171.6	178.6	178.8	-177	0	110.8	S77 H78 R83 S84	S77-K80 PolarHBondContact O-N 3.31Å; S77-K80 VanDerWaalsContact O-N 3.17Å; H78-K80 PolarHBondContact O-N 3.03Å; K80-R83 PolarHBondContact O-N 3.44Å; K80-S84 WeakPolarHBondContact O-CB 3.48Å; K80-S84 PolarHBondContact O-N 3.37Å
81	F	62.8	Low	57.1	Low	124 Å²	124	101.7 Å²	101.7	54%	0.544	54%	0.539	S	S	.	.	H	α-helix	trans	-62.7	-44.2	176	-178.5	-100.2	0	0	0	112.4	S77 H78 S84 S85	S77-F81 PolarHBondContact O-N 3.18Å; S77-F81 VanDerWaalsContact O-N 3.11Å; H78-F81 PolarHBondContact O-N 3.4Å; F81-S84 PolarHBondContact O-N 3.31Å; F81-S85 WeakPolarHBondContact O-CB 3.33Å; F81-S85 PolarHBondContact O-N 3.46Å; F81-S85 PolarHBondContact O-OG 3.48Å
82	L	63.5	Low	57.1	Low	97 Å²	97	103.4 Å²	103.4	51%	0.508	56%	0.558	S	S	.	*	H	α-helix	trans	-65.3	-40.9	177.5	-72.8	178.5	0	0	0	112.6	H78 S85 A86	H78-L82 VanDerWaalsContact NE2-CD1 3.35Å; H78-L82 WeakPolarHBondContact NE2-CD1 3.4Å; H78-L82 PolarHBondContact O-N 3.25Å; L82-S85 PolarHBondContact O-N 2.8Å; L82-A86 WeakPolarHBondContact O-CB 3.43Å; L82-A86 PolarHBondContact O-N 2.92Å
83	R	63.1	Low	56.4	Low	160 Å²	160	105.1 Å²	105.1	60%	0.604	56%	0.564	S	S	*	*	H	α-helix	trans	-66	-46.1	176.9	-81	-179.9	-81.6	177.3	-6.9	111.9	S79 K80 S85 A86 D87	S79-R83 WeakPolarHBondContact O-CB 3.31Å; S79-R83 WeakPolarHBondContact O-CG 3.28Å; S79-R83 PolarHBondContact O-N 3.04Å; S79-R83 PolarHBondContact O-NE 2.86Å; S79-R83 PolarHBondContact OG-NH2 3.23Å; K80-R83 PolarHBondContact O-N 3.44Å; R83-S85 VanDerWaalsContact C-N 3.25Å; R83-S85 PolarHBondContact O-N 3.15Å; R83-A86 PolarHBondContact O-N 3.02Å; R83-A86 VanDerWaalsContact O-N 3.13Å; R83-D87 VanDerWaalsContact O-CG 3.3Å; R83-D87 PolarHBondContact O-N 3.03Å
84	S	56.2	Low	55.8	Low	76 Å²	76	105.7 Å²	105.7	53%	0.531	59%	0.586	S	S	.	*	H	α-helix	trans	-62.1	-32.7	176.7	-172	0	0	0	0	113.1	K80 F81 L88	K80-S84 WeakPolarHBondContact O-CB 3.48Å; K80-S84 PolarHBondContact O-N 3.37Å; F81-S84 PolarHBondContact O-N 3.31Å; S84-L88 WeakPolarHBondContact O-CB 3.26Å; S84-L88 PolarHBondContact O-N 3.18Å; S84-L88 VanDerWaalsContact O-N 3.13Å
85	S	56	Low	55.7	Low	54 Å²	54	105.8 Å²	105.8	38%	0.378	59%	0.591	S	S	.	*	H	α-helix	trans	-75.2	-32.1	177.1	-55.1	0	0	0	0	112.1	F81 L82 R83 A89	F81-S85 WeakPolarHBondContact O-CB 3.33Å; F81-S85 PolarHBondContact O-N 3.46Å; F81-S85 PolarHBondContact O-OG 3.48Å; L82-S85 PolarHBondContact O-N 2.8Å; R83-S85 VanDerWaalsContact C-N 3.25Å; R83-S85 PolarHBondContact O-N 3.15Å; S85-A89 PolarHBondContact O-N 2.91Å
86	A	58.8	Low	55.7	Low	54 Å²	54	106.4 Å²	106.4	45%	0.446	59%	0.59	S	S	.	*	H	α-helix	trans	-71.7	-41.8	173.4	0	0	0	0	0	111.4	L82 R83 L88 A89 V90	L82-A86 WeakPolarHBondContact O-CB 3.43Å; L82-A86 PolarHBondContact O-N 2.92Å; R83-A86 PolarHBondContact O-N 3.02Å; R83-A86 VanDerWaalsContact O-N 3.13Å; A86-L88 VanDerWaalsContact C-N 3.35Å; A86-L88 PolarHBondContact O-N 2.89Å; A86-A89 PolarHBondContact O-N 3.11Å; A86-V90 WeakPolarHBondContact O-CG2 3.43Å; A86-V90 PolarHBondContact O-N 2.81Å; A86-V90 VanDerWaalsContact O-N 3.16Å
87	D	62.7	Low	55.5	Low	107 Å²	107	101.9 Å²	101.9	57%	0.572	58%	0.577	S	S	*	*	H	α-helix	trans	-61.6	-43.9	176.5	-67.8	-23.9	0	0	0	110.9	R83 A89 V90 E91	R83-D87 VanDerWaalsContact O-CG 3.3Å; R83-D87 PolarHBondContact O-N 3.03Å; D87-A89 VanDerWaalsContact C-N 3.32Å; D87-A89 PolarHBondContact O-N 3.33Å; D87-V90 PolarHBondContact O-N 3.27Å; D87-E91 PolarHBondContact O-N 3.15Å; D87-E91 VanDerWaalsContact O-N 3.15Å
88	L	53.4	Low	55.6	Low	113 Å²	113	104.9 Å²	104.9	59%	0.592	59%	0.59	S	S	*	*	H	α-helix	trans	-64.1	-34.9	177.3	-166.6	76.6	0	0	0	112.8	S84 A86 V92	S84-L88 WeakPolarHBondContact O-CB 3.26Å; S84-L88 PolarHBondContact O-N 3.18Å; S84-L88 VanDerWaalsContact O-N 3.13Å; A86-L88 VanDerWaalsContact C-N 3.35Å; A86-L88 PolarHBondContact O-N 2.89Å; L88-V92 WeakPolarHBondContact O-CG2 3.26Å; L88-V92 PolarHBondContact O-N 3.37Å
89	A	53.7	Low	55.9	Low	63 Å²	63	107.4 Å²	107.4	52%	0.521	61%	0.609	S	S	.	*	H	α-helix	trans	-70.9	-33.6	178.8	0	0	0	0	0	112.3	S85 A86 D87 D93	S85-A89 PolarHBondContact O-N 2.91Å; A86-A89 PolarHBondContact O-N 3.11Å; D87-A89 VanDerWaalsContact C-N 3.32Å; D87-A89 PolarHBondContact O-N 3.33Å; A89-D93 PolarHBondContact O-N 3.19Å
90	V	55.9	Low	55.8	Low	102 Å²	102	111.3 Å²	111.3	62%	0.618	63%	0.626	S	S	*	*	H	α-helix	trans	-72.8	-35.2	176.8	175.7	0	0	0	0	111.4	A86 D87 V92 D93 A94	A86-V90 WeakPolarHBondContact O-CG2 3.43Å; A86-V90 PolarHBondContact O-N 2.81Å; A86-V90 VanDerWaalsContact O-N 3.16Å; D87-V90 PolarHBondContact O-N 3.27Å; V90-V92 VanDerWaalsContact C-N 3.28Å; V90-V92 PolarHBondContact O-N 2.88Å; V90-D93 PolarHBondContact O-N 3.4Å; V90-A94 PolarHBondContact O-N 2.79Å
91	E	49	Very low	55.6	Low	146 Å²	146	107.8 Å²	107.8	68%	0.682	62%	0.621	S	S	*	*	H	α-helix	trans	-68.1	-23.7	176.8	-74.8	-175.4	169.6	0	0	114.1	D87	D87-E91 PolarHBondContact O-N 3.15Å; D87-E91 VanDerWaalsContact O-N 3.15Å
92	V	55.4	Low	55.1	Low	121 Å²	121	106.5 Å²	106.5	73%	0.733	63%	0.627	S	S	*	*	H	α-helix	trans	-89.7	-16.7	177.7	178.5	0	0	0	0	112.2	L88 V90	L88-V92 WeakPolarHBondContact O-CG2 3.26Å; L88-V92 PolarHBondContact O-N 3.37Å; V90-V92 VanDerWaalsContact C-N 3.28Å; V90-V92 PolarHBondContact O-N 2.88Å
93	D	42.4	Very low	54.4	Low	152 Å²	152	107.3 Å²	107.3	81%	0.813	64%	0.637	S	S	*	*	H	α-helix	trans	-91.2	-14.8	177.1	-164.8	57.4	0	0	0	113.2	A89 V90	A89-D93 PolarHBondContact O-N 3.19Å; V90-D93 PolarHBondContact O-N 3.4Å
94	A	45.7	Very low	53.6	Low	140 Å²	140	102.5 Å²	102.5	100%	1.157	64%	0.64	S	S	*	*			trans	-89.1	0	172.9	0	0	0	0	0	112.3	V90	V90-A94 PolarHBondContact O-N 2.79Å

Retrieved 94 of 94 residues in 77.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).