A0A077YWU0_TRITR Loading...

Alpha 1,6 mannosyltransferase

AlphaFold DB , UniProt , Accession A0A077YWU0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 134 aa.

						>A0A077YWU0_TRITR|A0A077YWU0
MFCWASDWPDGDILVESVRLEGTRKLPFSLHSKVSGSYLVNQSTPSRTRGSIWDLLVLMMPAFLLATCCRLQHCEQIAPPRRQVHQVTAVGVSLAAKAGQTHRGKRLTEDATNLQKAGDQGQRSFRISLPEDSE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.1	Very low	38	Very low	221 Å²	221	154.5 Å²	154.5	100%	1.089	82%	0.824	S	S	*	*				0	98.6	0	-165	171.6	-170.3	0	0	106.5
2	F	36	Very low	37.8	Very low	196 Å²	196	155.3 Å²	155.3	86%	0.86	83%	0.828	S	S	*	*			trans	-126.1	103.1	177.2	-80.9	-79.2	0	0	0	107.2
3	C	34.3	Very low	37.8	Very low	113 Å²	113	155.1 Å²	155.1	76%	0.764	82%	0.824	S	S	*	*			trans	-85.9	114.8	172.1	-67.5	0	0	0	0	107.8
4	W	41.7	Very low	37.3	Very low	235 Å²	235	155 Å²	155	89%	0.89	82%	0.823	S	S	*	*			trans	-100.5	94.6	164.3	-73.9	32.9	0	0	0	105.5
5	A	36.9	Very low	37.3	Very low	91 Å²	91	153.4 Å²	153.4	75%	0.752	82%	0.821	S	S	*	*			trans	-71.9	133.6	170.6	0	0	0	0	0	108.5	D7	A5-D7 PolarHBondContact O-N 2.84Å
6	S	35.4	Very low	37.1	Very low	106 Å²	106	153.9 Å²	153.9	74%	0.741	82%	0.817	S	S	*	*			trans	-67	103.7	178.6	-52.9	0	0	0	0	111.2
7	D	39.8	Very low	37.1	Very low	160 Å²	160	150.9 Å²	150.9	86%	0.856	81%	0.811	S	S	*	*			trans	-103.6	87.4	158.1	-82.3	-29.6	0	0	0	108.1	A5	A5-D7 PolarHBondContact O-N 2.84Å
8	W	43.1	Very low	37	Very low	233 Å²	233	149.3 Å²	149.3	88%	0.883	81%	0.807	S	S	*	*			trans	-93.5	122.5	159.7	-78.8	82	0	0	0	107	D10	W8-D10 PolarHBondContact O-N 3.26Å
9	P	42.1	Very low	36.9	Very low	116 Å²	116	152 Å²	152	75%	0.753	81%	0.805	S	S	*	*			trans	-73.1	120.7	176.9	28.3	-29.8	0	0	0	109	G11	P9-G11 VanDerWaalsContact C-N 3.28Å; P9-G11 PolarHBondContact O-N 3.06Å
10	D	37.6	Very low	36.9	Very low	179 Å²	179	152.4 Å²	152.4	96%	0.957	81%	0.806	S	S	*	*			trans	-56.2	94.8	156.6	-77.2	-49.2	0	0	0	107.8	W8	W8-D10 PolarHBondContact O-N 3.26Å
11	G	34.5	Very low	36.9	Very low	50 Å²	50	152.8 Å²	152.8	52%	0.515	80%	0.804	S	S	.	*			trans	-136.6	109.5	178.9	0	0	0	0	0	109	P9 I13	P9-G11 VanDerWaalsContact C-N 3.28Å; P9-G11 PolarHBondContact O-N 3.06Å; G11-I13 PolarHBondContact O-N 3.29Å
12	D	34.9	Very low	36.8	Very low	163 Å²	163	144.7 Å²	144.7	87%	0.872	78%	0.776	S	S	*	*			trans	-48.2	102.9	169.8	-76.7	-48.3	0	0	0	110.3	L14	D12-L14 PolarHBondContact O-N 3.2Å
13	I	37.5	Very low	36.8	Very low	153 Å²	153	142.6 Å²	142.6	79%	0.785	78%	0.78	S	S	*	*			trans	-78.4	86.4	170.8	-53.2	177.7	0	0	0	106.7	G11 V15	G11-I13 PolarHBondContact O-N 3.29Å; I13-V15 PolarHBondContact O-N 3.23Å
14	L	31.8	Very low	37.1	Very low	154 Å²	154	148.3 Å²	148.3	81%	0.806	79%	0.785	S	S	*	*			trans	-54.2	106	155.4	-106.9	131.7	0	0	0	107.1	D12 E16	D12-L14 PolarHBondContact O-N 3.2Å; L14-E16 PolarHBondContact O-N 2.89Å
15	V	37	Very low	37	Very low	131 Å²	131	147.1 Å²	147.1	79%	0.794	79%	0.787	S	S	*	*			trans	-71.1	83.1	165.2	-179.5	0	0	0	0	106.1	I13 S17	I13-V15 PolarHBondContact O-N 3.23Å; V15-S17 PolarHBondContact O-N 3.44Å; V15-S17 VanDerWaalsContact O-N 3.16Å
16	E	33.5	Very low	37.3	Very low	162 Å²	162	149.2 Å²	149.2	76%	0.757	78%	0.784	S	S	*	*			trans	-65.8	112.2	168.3	-155.7	173.6	-160.1	0	0	106.4	L14 V18	L14-E16 PolarHBondContact O-N 2.89Å; E16-V18 VanDerWaalsContact C-N 3.34Å; E16-V18 PolarHBondContact O-N 3.34Å
17	S	37.1	Very low	37.5	Very low	102 Å²	102	150.1 Å²	150.1	71%	0.713	79%	0.788	S	S	*	*			trans	-59.5	101.1	171.2	54.1	0	0	0	0	107.3	V15 R19	V15-S17 PolarHBondContact O-N 3.44Å; V15-S17 VanDerWaalsContact O-N 3.16Å; S17-R19 VanDerWaalsContact C-N 3.26Å; S17-R19 PolarHBondContact O-N 2.86Å
18	V	36.2	Very low	37.6	Very low	123 Å²	123	149 Å²	149	75%	0.745	78%	0.775	S	S	*	*			trans	-62.2	96.2	170.2	178.1	0	0	0	0	106.7	E16 L20	E16-V18 VanDerWaalsContact C-N 3.34Å; E16-V18 PolarHBondContact O-N 3.34Å; V18-L20 PolarHBondContact O-N 3.48Å
19	R	35.6	Very low	37.1	Very low	200 Å²	200	143.3 Å²	143.3	76%	0.755	77%	0.772	S	S	*	*			trans	-57.5	106.3	158.5	-91.8	-172.7	176.7	179.7	3.4	105.9	S17 E21	S17-R19 VanDerWaalsContact C-N 3.26Å; S17-R19 PolarHBondContact O-N 2.86Å; R19-E21 HydrophobicContact CB-CG 4.44Å; R19-E21 IonicContact NH1-OE1 3.46Å; R19-E21 PolarHBondContact NH1-OE1 3Å; R19-E21 PolarHBondContact O-N 2.99Å
20	L	36.9	Very low	37.1	Very low	159 Å²	159	145.2 Å²	145.2	83%	0.832	78%	0.775	S	S	*	*			trans	-68.7	73.6	161.3	-84.6	156.8	0	0	0	108.1	V18 G22	V18-L20 PolarHBondContact O-N 3.48Å; L20-G22 PolarHBondContact O-N 3.36Å
21	E	35.4	Very low	36.8	Very low	162 Å²	162	145.1 Å²	145.1	76%	0.757	77%	0.768	S	S	*	*			trans	-71.6	77.1	156.3	-78.7	179.4	-167.2	0	0	106.9	R19	R19-E21 HydrophobicContact CB-CG 4.44Å; R19-E21 IonicContact NH1-OE1 3.46Å; R19-E21 PolarHBondContact NH1-OE1 3Å; R19-E21 PolarHBondContact O-N 2.99Å
22	G	36.3	Very low	36.9	Very low	50 Å²	50	147.1 Å²	147.1	52%	0.515	77%	0.774	S	S	.	*			trans	-140.9	84.8	179.8	0	0	0	0	0	108.5	L20 R24	L20-G22 PolarHBondContact O-N 3.36Å; G22-R24 PolarHBondContact O-N 3.22Å
23	T	35.4	Very low	36.8	Very low	153 Å²	153	148.8 Å²	148.8	94%	0.939	77%	0.774	S	S	*	*			trans	-62	72.1	169	38.1	0	0	0	0	110.6
24	R	40.6	Very low	36.9	Very low	232 Å²	232	146.6 Å²	146.6	88%	0.875	77%	0.767	S	S	*	*			trans	-100.4	100.3	164.7	-76.4	-169.1	175.9	-169.8	0.3	108.5	G22 L26	G22-R24 PolarHBondContact O-N 3.22Å; R24-L26 PolarHBondContact O-N 3.48Å; R24-L26 VanDerWaalsContact O-N 3.16Å
25	K	39	Very low	36.9	Very low	211 Å²	211	145.5 Å²	145.5	92%	0.917	77%	0.772	S	S	*	*			trans	-44	114.6	169.9	-75.6	174.9	173.3	176.3	0	110.2
26	L	42.8	Very low	36.9	Very low	134 Å²	134	140.9 Å²	140.9	70%	0.702	75%	0.751	S	S	*	*			trans	-75.8	134.2	164.8	-80.9	147.6	0	0	0	108.9	R24 F28	R24-L26 PolarHBondContact O-N 3.48Å; R24-L26 VanDerWaalsContact O-N 3.16Å; L26-F28 HydrophobicContact CD2-CE1 4.16Å; L26-F28 HydrophobicContact CD2-CZ 4.41Å; L26-F28 PolarHBondContact O-N 3.41Å
27	P	39.6	Very low	36.9	Very low	125 Å²	125	138.9 Å²	138.9	81%	0.812	76%	0.755	S	S	*	*	S	Bend	trans	-84.8	37.8	-172	36.2	-36.3	0	0	0	113.2
28	F	42.7	Very low	37.1	Very low	136 Å²	136	143.4 Å²	143.4	60%	0.596	76%	0.758	S	S	*	*			trans	-152.2	130.4	169	54.1	-87.2	0	0	0	110.8	L26 L30	L26-F28 HydrophobicContact CD2-CE1 4.16Å; L26-F28 HydrophobicContact CD2-CZ 4.41Å; L26-F28 PolarHBondContact O-N 3.41Å; F28-L30 HydrophobicContact CD2-CD1 4.5Å; F28-L30 HydrophobicContact CE2-CD1 4.31Å
29	S	33.7	Very low	37.3	Very low	115 Å²	115	145.4 Å²	145.4	80%	0.804	76%	0.763	S	S	*	*			trans	-90.3	103.8	178.6	-63.7	0	0	0	0	109	H31	S29-H31 PolarHBondContact O-N 3.38Å
30	L	40.3	Very low	37.5	Very low	156 Å²	156	142.1 Å²	142.1	82%	0.817	77%	0.766	S	S	*	*			trans	-79.4	84.9	162.1	-89.1	161.5	0	0	0	108.2	F28 S32	F28-L30 HydrophobicContact CD2-CD1 4.5Å; F28-L30 HydrophobicContact CE2-CD1 4.31Å; L30-S32 PolarHBondContact O-N 3.03Å; L30-S32 VanDerWaalsContact O-N 3.15Å
31	H	31.5	Very low	37.5	Very low	177 Å²	177	141.4 Å²	141.4	82%	0.819	76%	0.763	S	S	*	*			trans	-74	93.6	171.7	-135.1	-122	0	0	0	108	S29	S29-H31 PolarHBondContact O-N 3.38Å
32	S	36.8	Very low	37.7	Very low	92 Å²	92	142 Å²	142	64%	0.643	77%	0.766	S	S	*	*			trans	-134.3	98.6	165.9	135.7	0	0	0	0	108.2	L30 V34	L30-S32 PolarHBondContact O-N 3.03Å; L30-S32 VanDerWaalsContact O-N 3.15Å; S32-V34 PolarHBondContact O-N 2.88Å
33	K	33	Very low	37.9	Very low	198 Å²	198	143.8 Å²	143.8	86%	0.861	77%	0.77	S	S	*	*			trans	-57.2	100.1	165.5	-77.4	173.3	172.9	175.5	0	108.2
34	V	39.3	Very low	38.1	Very low	106 Å²	106	142.4 Å²	142.4	64%	0.642	76%	0.762	S	S	*	*			trans	-117	91.7	156.2	-177.2	0	0	0	0	106.4	S32 G36	S32-V34 PolarHBondContact O-N 2.88Å; V34-G36 PolarHBondContact O-N 3.49Å; V34-G36 VanDerWaalsContact O-N 3.12Å
35	S	31.9	Very low	38.3	Very low	131 Å²	131	137.2 Å²	137.2	92%	0.916	76%	0.758	S	S	*	*			trans	-61.2	105.7	161.4	-162.1	0	0	0	0	106.3
36	G	36.6	Very low	38.3	Very low	34 Å²	34	131.9 Å²	131.9	35%	0.351	75%	0.747	S	S	.	*			trans	-146.2	91.2	-178.3	0	0	0	0	0	108	V34 Y38	V34-G36 PolarHBondContact O-N 3.49Å; V34-G36 VanDerWaalsContact O-N 3.12Å; G36-Y38 VanDerWaalsContact C-N 3.31Å; G36-Y38 WeakPolarHBondContact O-CD2 3.1Å; G36-Y38 PolarHBondContact O-N 3.42Å
37	S	33.3	Very low	38.2	Very low	121 Å²	121	136 Å²	136	85%	0.846	75%	0.753	S	S	*	*			trans	-67.1	90	168.2	49.1	0	0	0	0	108.6
38	Y	41.9	Very low	38.5	Very low	196 Å²	196	136 Å²	136	77%	0.769	75%	0.752	S	S	*	*			trans	-93.8	105.9	170.7	-60.5	-74.8	0	0	0	108.4	G36 V40	G36-Y38 VanDerWaalsContact C-N 3.31Å; G36-Y38 WeakPolarHBondContact O-CD2 3.1Å; G36-Y38 PolarHBondContact O-N 3.42Å; Y38-V40 PolarHBondContact O-N 2.87Å
39	L	41.8	Very low	38.4	Very low	165 Å²	165	140.1 Å²	140.1	86%	0.864	76%	0.763	S	S	*	*			trans	-42.5	128.1	164.9	-72.8	158.3	0	0	0	109.4	N41	L39-N41 VanDerWaalsContact C-N 3.25Å; L39-N41 PolarHBondContact O-N 3.04Å
40	V	39.9	Very low	39.4	Very low	132 Å²	132	137 Å²	137	80%	0.8	75%	0.75	S	S	*	*			trans	-59.8	91.2	170.2	175	0	0	0	0	107.6	Y38 Q42	Y38-V40 PolarHBondContact O-N 2.87Å; V40-Q42 HydrophobicContact CG1-CG 4.04Å; V40-Q42 PolarHBondContact O-N 3.4Å
41	N	36	Very low	40.1	Very low	144 Å²	144	131.9 Å²	131.9	77%	0.77	73%	0.727	S	S	*	*			trans	-81.4	100.1	168.2	-148.2	-4	0	0	0	105.7	L39 S43	L39-N41 VanDerWaalsContact C-N 3.25Å; L39-N41 PolarHBondContact O-N 3.04Å; N41-S43 PolarHBondContact O-N 3.34Å
42	Q	39	Very low	41.6	Very low	175 Å²	175	130 Å²	130	82%	0.818	72%	0.721	S	S	*	*			trans	-68.3	64.8	168.7	-70.2	-174.9	-5.4	0	0	109.1	V40 T44	V40-Q42 HydrophobicContact CG1-CG 4.04Å; V40-Q42 PolarHBondContact O-N 3.4Å; Q42-T44 PolarHBondContact O-N 3.16Å
43	S	39.9	Very low	42.8	Very low	87 Å²	87	133.9 Å²	133.9	61%	0.608	72%	0.722	S	S	*	*			trans	-79.5	100.8	162.8	58.5	0	0	0	0	106.5	N41	N41-S43 PolarHBondContact O-N 3.34Å
44	T	40.6	Very low	44	Very low	124 Å²	124	128.7 Å²	128.7	76%	0.761	70%	0.703	S	S	*	*			trans	-31.5	124	164.6	46.3	0	0	0	0	110.7	Q42 S46	Q42-T44 PolarHBondContact O-N 3.16Å; T44-S46 PolarHBondContact O-N 3.36Å
45	P	44.1	Very low	45	Very low	122 Å²	122	129.3 Å²	129.3	79%	0.792	70%	0.702	S	S	*	*			trans	-64.7	108.5	172.2	26.2	-30.3	0	0	0	106.6	R47	P45-R47 PolarHBondContact O-N 3.39Å
46	S	40.1	Very low	46.5	Very low	100 Å²	100	127 Å²	127	70%	0.699	68%	0.679	S	S	*	*			trans	-49.5	110.9	163.9	48.7	0	0	0	0	106.6	T44 T48	T44-S46 PolarHBondContact O-N 3.36Å; S46-T48 PolarHBondContact O-N 2.9Å
47	R	40.5	Very low	47.9	Very low	219 Å²	219	130.1 Å²	130.1	83%	0.826	69%	0.691	S	S	*	*			trans	-62.7	75.6	-179.5	-166.4	-179.3	-167.9	-180	4.2	109	P45 R49	P45-R47 PolarHBondContact O-N 3.39Å; R47-R49 VanDerWaalsContact C-N 3.26Å; R47-R49 PolarHBondContact O-N 3.05Å
48	T	44.7	Very low	49.3	Very low	127 Å²	127	130.7 Å²	130.7	78%	0.779	68%	0.684	S	S	*	*			trans	-65.9	98	158.2	42.1	0	0	0	0	105.2	S46 G50	S46-T48 PolarHBondContact O-N 2.9Å; T48-G50 PolarHBondContact O-N 2.88Å
49	R	41.8	Very low	50.2	Low	221 Å²	221	126.6 Å²	126.6	83%	0.834	67%	0.673	S	S	*	*			trans	-58.6	78.8	159.6	-91.7	177.9	161.1	167	-5.8	106.5	R47 S51	R47-R49 VanDerWaalsContact C-N 3.26Å; R47-R49 PolarHBondContact O-N 3.05Å; R49-S51 PolarHBondContact O-N 3.38Å
50	G	53.9	Low	51.2	Low	51 Å²	51	123.2 Å²	123.2	53%	0.526	66%	0.655	S	S	.	*			trans	-58	116.8	157.9	0	0	0	0	0	105.1	T48	T48-G50 PolarHBondContact O-N 2.88Å
51	S	54.7	Low	52.2	Low	48 Å²	48	120.2 Å²	120.2	34%	0.336	64%	0.638	S	S	.	*			trans	-60.1	145	-178.8	-172.3	0	0	0	0	107.9	R49 W53 D54 L55	R49-S51 PolarHBondContact O-N 3.38Å; S51-W53 PolarHBondContact O-N 3.11Å; S51-W53 WeakPolarHBondContact OG-CB 3.22Å; S51-D54 PolarHBondContact N-OD2 3.29Å; S51-D54 WeakPolarHBondContact O-CB 3.44Å; S51-D54 PolarHBondContact O-N 3.15Å; S51-L55 PolarHBondContact O-N 3.44Å
52	I	63.7	Low	53.4	Low	136 Å²	136	116.1 Å²	116.1	70%	0.697	62%	0.624	S	S	*	*	H	α-helix	trans	-51.1	-29.4	169.8	-69.8	166.1	0	0	0	109.8	L55 L56	I52-L55 PolarHBondContact O-N 3.48Å; I52-L56 WeakPolarHBondContact O-CB 3.44Å; I52-L56 PolarHBondContact O-N 3.13Å
53	W	61.7	Low	54.3	Low	174 Å²	174	114.1 Å²	114.1	66%	0.659	61%	0.612	S	S	*	*	H	α-helix	trans	-61.1	-35.7	171.5	-61.6	107.2	0	0	0	114.5	S51 L56 V57	S51-W53 PolarHBondContact O-N 3.11Å; S51-W53 WeakPolarHBondContact OG-CB 3.22Å; W53-L56 HydrophobicContact CE3-CD2 4.47Å; W53-L56 HydrophobicContact CZ3-CD2 4.4Å; W53-L56 PolarHBondContact O-N 2.68Å; W53-V57 WeakPolarHBondContact O-CB 3.22Å; W53-V57 WeakPolarHBondContact O-CG2 3.39Å; W53-V57 PolarHBondContact O-N 2.86Å
54	D	59.5	Low	55.2	Low	89 Å²	89	115 Å²	115	48%	0.476	61%	0.61	S	S	.	*	H	α-helix	trans	-68.6	-41.5	177	-65.7	-39.6	0	0	0	111.2	S51 L58	S51-D54 PolarHBondContact N-OD2 3.29Å; S51-D54 WeakPolarHBondContact O-CB 3.44Å; S51-D54 PolarHBondContact O-N 3.15Å; D54-L58 WeakPolarHBondContact O-CB 3.46Å; D54-L58 VanDerWaalsContact O-CG 3.32Å; D54-L58 WeakPolarHBondContact O-CG 3.42Å; D54-L58 PolarHBondContact O-N 3.23Å
55	L	59.2	Low	56.1	Low	119 Å²	119	114.5 Å²	114.5	62%	0.623	60%	0.602	S	S	*	*	H	α-helix	trans	-63.9	-41.3	172.3	-88.6	155	0	0	0	111.2	S51 I52 L58 M59	S51-L55 PolarHBondContact O-N 3.44Å; I52-L55 PolarHBondContact O-N 3.48Å; L55-L58 PolarHBondContact O-N 3.23Å; L55-M59 WeakPolarHBondContact O-CB 3.43Å; L55-M59 WeakPolarHBondContact O-CG 3.31Å; L55-M59 PolarHBondContact O-N 3.15Å
56	L	63.4	Low	56.7	Low	83 Å²	83	111.5 Å²	111.5	44%	0.435	59%	0.587	S	S	.	*	H	α-helix	trans	-67.3	-41.5	179.5	-147.9	108.8	0	0	0	111.8	I52 W53 L58 M59 M60	I52-L56 WeakPolarHBondContact O-CB 3.44Å; I52-L56 PolarHBondContact O-N 3.13Å; W53-L56 HydrophobicContact CE3-CD2 4.47Å; W53-L56 HydrophobicContact CZ3-CD2 4.4Å; W53-L56 PolarHBondContact O-N 2.68Å; L56-L58 VanDerWaalsContact C-N 3.34Å; L56-L58 PolarHBondContact O-N 3.27Å; L56-M59 PolarHBondContact O-N 3.25Å; L56-M60 VanDerWaalsContact O-CG 3.25Å; L56-M60 WeakPolarHBondContact O-CG 3.41Å; L56-M60 PolarHBondContact O-N 3.06Å
57	V	65.3	Low	57.6	Low	99 Å²	99	109.4 Å²	109.4	60%	0.6	57%	0.571	S	S	*	*	H	α-helix	trans	-66.2	-35	177.2	168.6	0	0	0	0	111.5	W53 P61	W53-V57 WeakPolarHBondContact O-CB 3.22Å; W53-V57 WeakPolarHBondContact O-CG2 3.39Å; W53-V57 PolarHBondContact O-N 2.86Å; V57-P61 WeakPolarHBondContact O-CD 3.49Å
58	L	62.5	Low	58.1	Low	133 Å²	133	102.2 Å²	102.2	70%	0.696	55%	0.553	S	S	*	*	H	α-helix	trans	-74.6	-31.2	174.6	-73.7	168.3	0	0	0	113	D54 L55 L56	D54-L58 WeakPolarHBondContact O-CB 3.46Å; D54-L58 VanDerWaalsContact O-CG 3.32Å; D54-L58 WeakPolarHBondContact O-CG 3.42Å; D54-L58 PolarHBondContact O-N 3.23Å; L55-L58 PolarHBondContact O-N 3.23Å; L56-L58 VanDerWaalsContact C-N 3.34Å; L56-L58 PolarHBondContact O-N 3.27Å
59	M	62	Low	58.4	Low	110 Å²	110	99.9 Å²	99.9	54%	0.542	54%	0.541	S	S	.	.	H	α-helix	trans	-79.4	-29.5	179.8	-74.8	-68.6	-61.3	0	0	113.3	L55 L56 A62 F63	L55-M59 WeakPolarHBondContact O-CB 3.43Å; L55-M59 WeakPolarHBondContact O-CG 3.31Å; L55-M59 PolarHBondContact O-N 3.15Å; L56-M59 PolarHBondContact O-N 3.25Å; M59-A62 PolarHBondContact O-N 3.42Å; M59-F63 WeakPolarHBondContact O-CB 3.3Å; M59-F63 PolarHBondContact O-N 3.4Å
60	M	62.9	Low	58.8	Low	95 Å²	95	99 Å²	99	47%	0.468	54%	0.538	S	S	.	.	H	α-helix	trans	-60.2	-47.3	-177.2	-80.7	-70	114.3	0	0	114.6	L56 A62 F63 L64	L56-M60 VanDerWaalsContact O-CG 3.25Å; L56-M60 WeakPolarHBondContact O-CG 3.41Å; L56-M60 PolarHBondContact O-N 3.06Å; M60-A62 PolarHBondContact O-N 3.32Å; M60-F63 PolarHBondContact O-N 3.09Å; M60-L64 WeakPolarHBondContact O-CB 3.41Å; M60-L64 PolarHBondContact O-N 3.02Å
61	P	60.9	Low	58.6	Low	69 Å²	69	102.2 Å²	102.2	45%	0.448	54%	0.542	S	S	.	.	H	α-helix	trans	-65.5	-39.4	177.5	-8.3	15.8	0	0	0	112.2	V57 L64 L65	V57-P61 WeakPolarHBondContact O-CD 3.49Å; P61-L64 PolarHBondContact O-N 2.93Å; P61-L65 VanDerWaalsContact O-CB 3.29Å; P61-L65 WeakPolarHBondContact O-CB 3.32Å; P61-L65 WeakPolarHBondContact O-CD1 3.15Å; P61-L65 WeakPolarHBondContact O-CG 3.43Å; P61-L65 PolarHBondContact O-N 3.35Å
62	A	60.2	Low	58.3	Low	57 Å²	57	106.4 Å²	106.4	47%	0.471	56%	0.556	S	S	.	*	H	α-helix	trans	-67.7	-38.5	179.1	0	0	0	0	0	111.9	M59 M60 A66	M59-A62 PolarHBondContact O-N 3.42Å; M60-A62 PolarHBondContact O-N 3.32Å; A62-A66 VanDerWaalsContact O-CB 3.23Å; A62-A66 WeakPolarHBondContact O-CB 3.29Å; A62-A66 PolarHBondContact O-N 3.47Å
63	F	59.1	Low	57.3	Low	133 Å²	133	108.4 Å²	108.4	58%	0.583	56%	0.562	S	S	*	*	H	α-helix	trans	-68.6	-44.3	176.1	-158.4	-93.3	0	0	0	111.2	M59 M60 A66 T67	M59-F63 WeakPolarHBondContact O-CB 3.3Å; M59-F63 PolarHBondContact O-N 3.4Å; M60-F63 PolarHBondContact O-N 3.09Å; F63-A66 PolarHBondContact O-N 2.76Å; F63-T67 HydrophobicContact CE1-CG2 4.28Å; F63-T67 PolarHBondContact O-N 3.44Å; F63-T67 PolarHBondContact O-OG1 3.17Å
64	L	59	Low	56.2	Low	106 Å²	106	104.4 Å²	104.4	56%	0.555	56%	0.56	S	S	*	*	H	α-helix	trans	-60	-47.6	174.6	-86.6	157.1	0	0	0	112	M60 P61 T67 C68	M60-L64 WeakPolarHBondContact O-CB 3.41Å; M60-L64 PolarHBondContact O-N 3.02Å; P61-L64 PolarHBondContact O-N 2.93Å; L64-T67 WeakPolarHBondContact CA-OG1 3.4Å; L64-T67 PolarHBondContact O-N 3.29Å; L64-T67 PolarHBondContact O-OG1 3.33Å; L64-C68 WeakPolarHBondContact O-CB 3.34Å; L64-C68 PolarHBondContact O-N 3.45Å; L64-C68 PolarHBondContact O-SG 2.7Å; L64-C68 VanDerWaalsContact O-SG 3.32Å
65	L	58.5	Low	55.4	Low	114 Å²	114	107.7 Å²	107.7	60%	0.597	57%	0.572	S	S	*	*	H	α-helix	trans	-62	-42.7	175.9	-82.6	156	0	0	0	112	P61 T67 C68 C69	P61-L65 VanDerWaalsContact O-CB 3.29Å; P61-L65 WeakPolarHBondContact O-CB 3.32Å; P61-L65 WeakPolarHBondContact O-CD1 3.15Å; P61-L65 WeakPolarHBondContact O-CG 3.43Å; P61-L65 PolarHBondContact O-N 3.35Å; L65-T67 PolarHBondContact O-N 3.33Å; L65-C68 PolarHBondContact O-N 3.27Å; L65-C69 WeakPolarHBondContact O-CB 3.05Å; L65-C69 PolarHBondContact O-N 3.47Å; L65-C69 PolarHBondContact O-SG 3.5Å
66	A	57.6	Low	54.5	Low	58 Å²	58	111 Å²	111	48%	0.479	59%	0.585	S	S	.	*	H	α-helix	trans	-65	-38.5	177.7	0	0	0	0	0	112.5	A62 F63 R70	A62-A66 VanDerWaalsContact O-CB 3.23Å; A62-A66 WeakPolarHBondContact O-CB 3.29Å; A62-A66 PolarHBondContact O-N 3.47Å; F63-A66 PolarHBondContact O-N 2.76Å; A66-R70 WeakPolarHBondContact O-CB 3.39Å; A66-R70 WeakPolarHBondContact O-CG 3.44Å; A66-R70 PolarHBondContact O-N 3.17Å; A66-R70 VanDerWaalsContact O-N 3.09Å
67	T	57.8	Low	53.6	Low	57 Å²	57	114.2 Å²	114.2	35%	0.35	60%	0.601	S	S	.	*	H	α-helix	trans	-70.6	-36.9	173.4	37.7	0	0	0	0	112.9	F63 L64 L65 R70 L71	F63-T67 HydrophobicContact CE1-CG2 4.28Å; F63-T67 PolarHBondContact O-N 3.44Å; F63-T67 PolarHBondContact O-OG1 3.17Å; L64-T67 WeakPolarHBondContact CA-OG1 3.4Å; L64-T67 PolarHBondContact O-N 3.29Å; L64-T67 PolarHBondContact O-OG1 3.33Å; L65-T67 PolarHBondContact O-N 3.33Å; T67-R70 PolarHBondContact O-N 3.38Å; T67-L71 WeakPolarHBondContact O-CB 3.41Å; T67-L71 WeakPolarHBondContact O-CD1 3.46Å; T67-L71 WeakPolarHBondContact O-CG 3.32Å; T67-L71 PolarHBondContact O-N 3.5Å
68	C	52.3	Low	52.4	Low	67 Å²	67	113.6 Å²	113.6	45%	0.453	61%	0.606	S	S	.	*	H	α-helix	trans	-66.6	-41.3	175	-74.2	0	0	0	0	111.9	L64 L65 R70 L71 Q72	L64-C68 WeakPolarHBondContact O-CB 3.34Å; L64-C68 PolarHBondContact O-N 3.45Å; L64-C68 PolarHBondContact O-SG 2.7Å; L64-C68 VanDerWaalsContact O-SG 3.32Å; L65-C68 PolarHBondContact O-N 3.27Å; C68-R70 VanDerWaalsContact C-N 3.33Å; C68-R70 PolarHBondContact O-N 3.26Å; C68-L71 PolarHBondContact O-N 3.13Å; C68-Q72 PolarHBondContact O-N 3.12Å
69	C	50.8	Low	51.2	Low	79 Å²	79	112.6 Å²	112.6	53%	0.534	61%	0.608	S	S	.	*	H	α-helix	trans	-67.7	-31.5	175.8	-68	0	0	0	0	112.8	L65	L65-C69 WeakPolarHBondContact O-CB 3.05Å; L65-C69 PolarHBondContact O-N 3.47Å; L65-C69 PolarHBondContact O-SG 3.5Å
70	R	49.8	Very low	50.4	Low	202 Å²	202	111.7 Å²	111.7	76%	0.762	61%	0.61	S	S	*	*	H	α-helix	trans	-72.2	-31.5	172.5	-78.8	-89.9	-178.8	159.7	-2.2	112.6	A66 T67 C68 C74	A66-R70 WeakPolarHBondContact O-CB 3.39Å; A66-R70 WeakPolarHBondContact O-CG 3.44Å; A66-R70 PolarHBondContact O-N 3.17Å; A66-R70 VanDerWaalsContact O-N 3.09Å; T67-R70 PolarHBondContact O-N 3.38Å; C68-R70 VanDerWaalsContact C-N 3.33Å; C68-R70 PolarHBondContact O-N 3.26Å; R70-C74 PolarHBondContact O-SG 2.92Å
71	L	49.4	Very low	49.5	Very low	118 Å²	118	118 Å²	118	62%	0.618	63%	0.629	S	S	*	*	H	α-helix	trans	-79.5	-38.2	179.2	-77.3	162.5	0	0	0	112.7	T67 C68 H73 C74 E75	T67-L71 WeakPolarHBondContact O-CB 3.41Å; T67-L71 WeakPolarHBondContact O-CD1 3.46Å; T67-L71 WeakPolarHBondContact O-CG 3.32Å; T67-L71 PolarHBondContact O-N 3.5Å; C68-L71 PolarHBondContact O-N 3.13Å; L71-H73 VanDerWaalsContact C-N 3.27Å; L71-H73 PolarHBondContact O-N 3.48Å; L71-C74 PolarHBondContact O-N 2.88Å; L71-E75 PolarHBondContact O-N 3.38Å
72	Q	48.3	Very low	48.9	Very low	137 Å²	137	125.6 Å²	125.6	64%	0.64	65%	0.648	S	S	*	*	H	α-helix	trans	-66.6	-24.9	177.2	-87.7	179.6	-59	0	0	113.8	C68	C68-Q72 PolarHBondContact O-N 3.12Å
73	H	43.4	Very low	48.3	Very low	177 Å²	177	129.4 Å²	129.4	82%	0.819	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.6	-11.4	173	-106.4	59.7	0	0	0	113.9	L71	L71-H73 VanDerWaalsContact C-N 3.27Å; L71-H73 PolarHBondContact O-N 3.48Å
74	C	38.8	Very low	47.7	Very low	90 Å²	90	128.2 Å²	128.2	61%	0.608	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.6	-4.2	175.2	-67.5	0	0	0	0	112.8	R70 L71 Q76 I77	R70-C74 PolarHBondContact O-SG 2.92Å; L71-C74 PolarHBondContact O-N 2.88Å; C74-Q76 PolarHBondContact O-N 3.27Å; C74-Q76 VanDerWaalsContact O-N 3.16Å; C74-I77 PolarHBondContact O-N 3.33Å
75	E	41.6	Very low	46.9	Very low	158 Å²	158	130 Å²	130	74%	0.738	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.9	4	-173.4	-143.9	179.7	162.2	0	0	114.5	L71	L71-E75 PolarHBondContact O-N 3.38Å
76	Q	40.7	Very low	46.4	Very low	190 Å²	190	131.5 Å²	131.5	89%	0.888	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.8	2.8	175.5	-145.9	167.4	14.2	0	0	113.6	C74	C74-Q76 PolarHBondContact O-N 3.27Å; C74-Q76 VanDerWaalsContact O-N 3.16Å
77	I	43.5	Very low	46.1	Very low	149 Å²	149	134.2 Å²	134.2	76%	0.764	68%	0.68	S	S	*	*	S	Bend	trans	-140	94.5	-178.6	-49.8	175.6	0	0	0	110.5	C74	C74-I77 PolarHBondContact O-N 3.33Å
78	A	40.3	Very low	45.7	Very low	87 Å²	87	135.2 Å²	135.2	72%	0.719	69%	0.685	S	S	*	*			trans	66	139.4	162	0	0	0	0	0	119.3	P80	A78-P80 WeakPolarHBondContact O-CD 3.29Å
79	P	37.2	Very low	45.5	Very low	112 Å²	112	134.8 Å²	134.8	73%	0.727	69%	0.687	S	S	*	*			trans	-91.8	125.6	-168.9	34.4	-31.9	0	0	0	113.9
80	P	45.2	Very low	45.5	Very low	91 Å²	91	135.2 Å²	135.2	59%	0.591	69%	0.687	S	S	*	*			trans	-104.1	75.3	164.8	36.1	-26.3	0	0	0	110.4	A78 R82	A78-P80 WeakPolarHBondContact O-CD 3.29Å; P80-R82 PolarHBondContact O-N 3.31Å
81	R	44.8	Very low	45.3	Very low	228 Å²	228	127.7 Å²	127.7	86%	0.86	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.9	13.2	180	-81.9	-170.7	176.5	174.4	0.5	116
82	R	49	Very low	45.4	Very low	227 Å²	227	126.9 Å²	126.9	86%	0.857	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-118.7	-15.4	-175	-73.5	-172.7	175.2	173.2	-0.4	116	P80	P80-R82 PolarHBondContact O-N 3.31Å
83	Q	46.3	Very low	45.6	Very low	138 Å²	138	123.6 Å²	123.6	65%	0.645	66%	0.664	S	S	*	*	S	Bend	trans	-93.1	-19.8	-176.1	-81.2	179.4	-25	0	0	114.6	H85 Q86	Q83-H85 VanDerWaalsContact C-N 3.26Å; Q83-H85 PolarHBondContact O-N 2.89Å; Q83-Q86 PolarHBondContact O-N 3.48Å
84	V	46.7	Very low	45.9	Very low	108 Å²	108	121 Å²	121	66%	0.655	66%	0.656	S	S	*	*	H	α-helix	trans	-68	-26.1	-177.2	-177.3	0	0	0	0	112.4	T88	V84-T88 PolarHBondContact O-OG1 3.38Å
85	H	43.4	Very low	46.5	Very low	144 Å²	144	119.8 Å²	119.8	67%	0.667	65%	0.652	S	S	*	*	H	α-helix	trans	-74	-26	178.9	-75.2	-59.3	0	0	0	114.5	Q83 T88 A89	Q83-H85 VanDerWaalsContact C-N 3.26Å; Q83-H85 PolarHBondContact O-N 2.89Å; H85-T88 PolarHBondContact O-OG1 3.09Å; H85-A89 WeakPolarHBondContact O-CB 3.23Å; H85-A89 PolarHBondContact O-N 3.22Å
86	Q	46.9	Very low	46.9	Very low	144 Å²	144	115.7 Å²	115.7	67%	0.673	65%	0.645	S	S	*	*	H	α-helix	trans	-77.9	-34.1	-179.5	-78.5	-177.5	-20.4	0	0	112.2	Q83 V90	Q83-Q86 PolarHBondContact O-N 3.48Å; Q86-V90 WeakPolarHBondContact O-CG2 3.41Å; Q86-V90 PolarHBondContact O-N 2.97Å
87	V	51	Low	47.3	Very low	116 Å²	116	115.3 Å²	115.3	70%	0.703	64%	0.64	S	S	*	*	H	α-helix	trans	-73.9	-35.3	179.9	-175.5	0	0	0	0	111.4	G91	V87-G91 PolarHBondContact O-N 3.33Å
88	T	50.3	Low	47.6	Very low	77 Å²	77	111.6 Å²	111.6	47%	0.472	63%	0.632	S	S	.	*	H	α-helix	trans	-71	-35.8	174.8	22.9	0	0	0	0	112.5	V84 H85 V90 G91 V92	V84-T88 PolarHBondContact O-OG1 3.38Å; H85-T88 PolarHBondContact O-OG1 3.09Å; T88-V90 VanDerWaalsContact C-N 3.34Å; T88-V90 PolarHBondContact O-N 3.46Å; T88-G91 PolarHBondContact O-N 3.16Å; T88-V92 VanDerWaalsContact O-CG2 3.3Å; T88-V92 WeakPolarHBondContact O-CG2 3.18Å; T88-V92 PolarHBondContact O-N 3.17Å
89	A	48.5	Very low	47.8	Very low	58 Å²	58	109 Å²	109	48%	0.479	61%	0.613	S	S	.	*	H	α-helix	trans	-64.8	-35.9	177.7	0	0	0	0	0	113.1	H85 S93	H85-A89 WeakPolarHBondContact O-CB 3.23Å; H85-A89 PolarHBondContact O-N 3.22Å; A89-S93 WeakPolarHBondContact O-CB 3.35Å; A89-S93 PolarHBondContact O-N 2.98Å; A89-S93 PolarHBondContact O-OG 3.4Å
90	V	51	Low	48.4	Very low	88 Å²	88	112.5 Å²	112.5	53%	0.533	62%	0.62	S	S	.	*	H	α-helix	trans	-72.6	-37.9	176.2	179	0	0	0	0	111.4	Q86 T88 S93 L94	Q86-V90 WeakPolarHBondContact O-CG2 3.41Å; Q86-V90 PolarHBondContact O-N 2.97Å; T88-V90 VanDerWaalsContact C-N 3.34Å; T88-V90 PolarHBondContact O-N 3.46Å; V90-S93 WeakPolarHBondContact CA-OG 3.32Å; V90-S93 PolarHBondContact O-N 3.46Å; V90-S93 PolarHBondContact O-OG 3.41Å; V90-S93 VanDerWaalsContact O-OG 3.12Å; V90-L94 HydrophobicContact CG1-CD1 3.92Å; V90-L94 WeakPolarHBondContact O-CD1 3.44Å; V90-L94 PolarHBondContact O-N 3.05Å; V90-L94 VanDerWaalsContact O-N 3.13Å
91	G	45.2	Very low	48.6	Very low	45 Å²	45	112.8 Å²	112.8	46%	0.464	62%	0.62	S	S	.	*	H	α-helix	trans	-65.7	-41.1	176.1	0	0	0	0	0	113.4	V87 T88 A95	V87-G91 PolarHBondContact O-N 3.33Å; T88-G91 PolarHBondContact O-N 3.16Å; G91-A95 WeakPolarHBondContact O-CB 3.25Å; G91-A95 PolarHBondContact O-N 3.5Å; G91-A95 VanDerWaalsContact O-N 3.09Å
92	V	51.5	Low	49	Very low	100 Å²	100	111 Å²	111	61%	0.606	62%	0.621	S	S	*	*	H	α-helix	trans	-71.6	-34.3	179.1	175.6	0	0	0	0	111.7	T88 A95 A96	T88-V92 VanDerWaalsContact O-CG2 3.3Å; T88-V92 WeakPolarHBondContact O-CG2 3.18Å; T88-V92 PolarHBondContact O-N 3.17Å; V92-A95 PolarHBondContact O-N 2.85Å; V92-A96 VanDerWaalsContact O-CB 3.29Å; V92-A96 WeakPolarHBondContact O-CB 3.36Å; V92-A96 PolarHBondContact O-N 2.98Å
93	S	51.4	Low	48.9	Very low	68 Å²	68	110.5 Å²	110.5	48%	0.476	62%	0.62	S	S	.	*	H	α-helix	trans	-75	-30.3	178.1	47.8	0	0	0	0	113.6	A89 V90 K97	A89-S93 WeakPolarHBondContact O-CB 3.35Å; A89-S93 PolarHBondContact O-N 2.98Å; A89-S93 PolarHBondContact O-OG 3.4Å; V90-S93 WeakPolarHBondContact CA-OG 3.32Å; V90-S93 PolarHBondContact O-N 3.46Å; V90-S93 PolarHBondContact O-OG 3.41Å; V90-S93 VanDerWaalsContact O-OG 3.12Å; S93-K97 PolarHBondContact O-N 3.01Å
94	L	49.9	Very low	48.8	Very low	124 Å²	124	104.5 Å²	104.5	65%	0.649	60%	0.595	S	S	*	*	H	α-helix	trans	-72.8	-37.3	168.7	-94.2	93.1	0	0	0	112.6	V90 K97 A98	V90-L94 HydrophobicContact CG1-CD1 3.92Å; V90-L94 WeakPolarHBondContact O-CD1 3.44Å; V90-L94 PolarHBondContact O-N 3.05Å; V90-L94 VanDerWaalsContact O-N 3.13Å; L94-K97 PolarHBondContact O-N 2.89Å; L94-A98 PolarHBondContact O-N 3.29Å
95	A	51.3	Low	48.9	Very low	63 Å²	63	106.6 Å²	106.6	52%	0.521	60%	0.595	S	S	.	*	H	α-helix	trans	-67.2	-36.9	175.4	0	0	0	0	0	112.5	G91 V92 K97 A98 G99	G91-A95 WeakPolarHBondContact O-CB 3.25Å; G91-A95 PolarHBondContact O-N 3.5Å; G91-A95 VanDerWaalsContact O-N 3.09Å; V92-A95 PolarHBondContact O-N 2.85Å; A95-K97 VanDerWaalsContact C-N 3.26Å; A95-K97 PolarHBondContact O-N 2.92Å; A95-A98 PolarHBondContact O-N 3.34Å; A95-G99 PolarHBondContact O-N 3.44Å
96	A	51.2	Low	49.3	Very low	72 Å²	72	109.2 Å²	109.2	60%	0.595	60%	0.599	S	S	*	*	H	α-helix	trans	-65.7	-26.6	176.1	0	0	0	0	0	113.1	V92	V92-A96 VanDerWaalsContact O-CB 3.29Å; V92-A96 WeakPolarHBondContact O-CB 3.36Å; V92-A96 PolarHBondContact O-N 2.98Å
97	K	49	Very low	49.6	Very low	182 Å²	182	108.4 Å²	108.4	79%	0.791	60%	0.599	S	S	*	*	H	α-helix	trans	-88.7	-26.9	179	-150.3	167	-175.9	178.3	0	113.1	S93 L94 A95	S93-K97 PolarHBondContact O-N 3.01Å; L94-K97 PolarHBondContact O-N 2.89Å; A95-K97 VanDerWaalsContact C-N 3.26Å; A95-K97 PolarHBondContact O-N 2.92Å
98	A	49.3	Very low	49.8	Very low	72 Å²	72	107.1 Å²	107.1	60%	0.595	59%	0.591	S	S	*	*	H	α-helix	trans	-81.9	-18.3	172.4	0	0	0	0	0	113.5	L94 A95 Q100	L94-A98 PolarHBondContact O-N 3.29Å; A95-A98 PolarHBondContact O-N 3.34Å; A98-Q100 PolarHBondContact O-N 2.96Å
99	G	43.8	Very low	49.9	Very low	31 Å²	31	109.2 Å²	109.2	32%	0.32	60%	0.595	S	S	.	*	T	Hydrogen-bonded Turn	trans	-82.5	7.4	-174.7	0	0	0	0	0	117.1	A95 T101	A95-G99 PolarHBondContact O-N 3.44Å; G99-T101 PolarHBondContact O-N 2.88Å
100	Q	49.6	Very low	50.2	Low	187 Å²	187	111.1 Å²	111.1	87%	0.874	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.2	5.3	177.8	-85.9	-168.5	-15.1	0	0	114.8	A98	A98-Q100 PolarHBondContact O-N 2.96Å
101	T	51.2	Low	50.3	Low	97 Å²	97	109.6 Å²	109.6	60%	0.595	59%	0.594	S	S	*	*	S	Bend	trans	-83	144.4	165.4	55.7	0	0	0	0	108.7	G99 R103 G104	G99-T101 PolarHBondContact O-N 2.88Å; T101-R103 PolarHBondContact O-N 2.82Å; T101-G104 PolarHBondContact O-N 2.94Å
102	H	53.1	Low	50.8	Low	190 Å²	190	111.1 Å²	111.1	88%	0.88	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53	-3.5	-175.7	-126.5	-80.9	0	0	0	115.9
103	R	47	Very low	51.1	Low	217 Å²	217	110.9 Å²	110.9	82%	0.819	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.9	-19.9	172.2	-107.3	178	175.8	175.6	-1.7	115	T101	T101-R103 PolarHBondContact O-N 2.82Å
104	G	44.3	Very low	51.3	Low	12 Å²	12	113.8 Å²	113.8	12%	0.124	60%	0.6	C	S	.	*	H	α-helix	trans	-73.6	-25.7	-175.2	0	0	0	0	0	115	T101 R106 L107 T108	T101-G104 PolarHBondContact O-N 2.94Å; G104-R106 VanDerWaalsContact C-N 3.31Å; G104-R106 PolarHBondContact O-N 3.49Å; G104-L107 PolarHBondContact O-N 3.34Å; G104-T108 PolarHBondContact O-N 2.94Å; G104-T108 PolarHBondContact O-OG1 2.99Å
105	K	47.2	Very low	51.5	Low	151 Å²	151	114.7 Å²	114.7	66%	0.657	60%	0.6	S	S	*	*	H	α-helix	trans	-63.2	-33.2	-179.8	-75.1	-173.6	175.4	-177.7	0	113.5	T108 E109	K105-T108 PolarHBondContact O-OG1 3.2Å; K105-E109 WeakPolarHBondContact O-CG 3.35Å; K105-E109 PolarHBondContact O-N 2.76Å
106	R	52.7	Low	51.6	Low	200 Å²	200	118.1 Å²	118.1	76%	0.755	60%	0.604	S	S	*	*	H	α-helix	trans	-73.8	-35.9	177.7	-73.5	-168.1	176.5	-156.9	-0.8	112.7	G104 E109 D110	G104-R106 VanDerWaalsContact C-N 3.31Å; G104-R106 PolarHBondContact O-N 3.49Å; R106-E109 PolarHBondContact O-N 2.98Å; R106-D110 PolarHBondContact O-N 3.33Å; R106-D110 VanDerWaalsContact O-N 3.16Å
107	L	53.3	Low	51.7	Low	127 Å²	127	117.4 Å²	117.4	67%	0.665	60%	0.598	S	S	*	*	H	α-helix	trans	-71.7	-30.1	179.3	-79.8	159.7	0	0	0	112.6	G104 A111	G104-L107 PolarHBondContact O-N 3.34Å; L107-A111 WeakPolarHBondContact O-CB 3.41Å; L107-A111 PolarHBondContact O-N 2.92Å; L107-A111 VanDerWaalsContact O-N 3.15Å
108	T	54.8	Low	51.9	Low	89 Å²	89	110.6 Å²	110.6	55%	0.546	58%	0.579	S	S	.	*	H	α-helix	trans	-72.2	-34.3	172.9	42.2	0	0	0	0	112.9	G104 K105 A111 T112	G104-T108 PolarHBondContact O-N 2.94Å; G104-T108 PolarHBondContact O-OG1 2.99Å; K105-T108 PolarHBondContact O-OG1 3.2Å; T108-A111 PolarHBondContact O-N 3.07Å; T108-T112 WeakPolarHBondContact O-CG2 3.47Å; T108-T112 PolarHBondContact O-N 3.45Å; T108-T112 VanDerWaalsContact O-N 3.11Å; T108-T112 PolarHBondContact O-OG1 3.15Å
109	E	53.2	Low	52.1	Low	120 Å²	120	111.9 Å²	111.9	56%	0.561	58%	0.576	S	S	*	*	H	α-helix	trans	-67.5	-43.3	175.8	-74.9	170.6	179.7	0	0	111	K105 R106 A111 T112 N113	K105-E109 WeakPolarHBondContact O-CG 3.35Å; K105-E109 PolarHBondContact O-N 2.76Å; R106-E109 PolarHBondContact O-N 2.98Å; E109-A111 VanDerWaalsContact C-N 3.35Å; E109-A111 PolarHBondContact O-N 2.96Å; E109-T112 PolarHBondContact O-N 3.03Å; E109-T112 PolarHBondContact O-OG1 2.8Å; E109-N113 PolarHBondContact O-N 2.79Å; E109-N113 PolarHBondContact O-ND2 3.27Å
110	D	53.2	Low	52.4	Low	99 Å²	99	117.5 Å²	117.5	53%	0.529	59%	0.594	S	S	.	*	H	α-helix	trans	-64	-37.4	175.9	-75	-17.3	0	0	0	112.6	R106 N113 L114	R106-D110 PolarHBondContact O-N 3.33Å; R106-D110 VanDerWaalsContact O-N 3.16Å; D110-N113 PolarHBondContact O-N 2.84Å; D110-L114 WeakPolarHBondContact O-CG 3.45Å; D110-L114 PolarHBondContact O-N 2.73Å
111	A	53	Low	52.3	Low	55 Å²	55	110.2 Å²	110.2	46%	0.455	57%	0.569	S	S	.	*	H	α-helix	trans	-66.6	-39.3	176	0	0	0	0	0	112.6	L107 T108 E109 L114 Q115	L107-A111 WeakPolarHBondContact O-CB 3.41Å; L107-A111 PolarHBondContact O-N 2.92Å; L107-A111 VanDerWaalsContact O-N 3.15Å; T108-A111 PolarHBondContact O-N 3.07Å; E109-A111 VanDerWaalsContact C-N 3.35Å; E109-A111 PolarHBondContact O-N 2.96Å; A111-L114 PolarHBondContact O-N 3.23Å; A111-Q115 PolarHBondContact O-N 2.72Å; A111-Q115 VanDerWaalsContact O-N 3.15Å
112	T	57.7	Low	51.9	Low	77 Å²	77	112.6 Å²	112.6	47%	0.472	57%	0.573	S	S	.	*	H	α-helix	trans	-70.9	-30.3	176.4	59.9	0	0	0	0	113.1	T108 E109 K116	T108-T112 WeakPolarHBondContact O-CG2 3.47Å; T108-T112 PolarHBondContact O-N 3.45Å; T108-T112 VanDerWaalsContact O-N 3.11Å; T108-T112 PolarHBondContact O-OG1 3.15Å; E109-T112 PolarHBondContact O-N 3.03Å; E109-T112 PolarHBondContact O-OG1 2.8Å; T112-K116 PolarHBondContact O-N 3.06Å; T112-K116 VanDerWaalsContact O-N 3.13Å
113	N	55.9	Low	51.4	Low	96 Å²	96	113.8 Å²	113.8	51%	0.513	57%	0.57	S	S	.	*	H	α-helix	trans	-72.6	-37.3	175.1	-79.1	-30.8	0	0	0	112.3	E109 D110 Q115 K116 A117	E109-N113 PolarHBondContact O-N 2.79Å; E109-N113 PolarHBondContact O-ND2 3.27Å; D110-N113 PolarHBondContact O-N 2.84Å; N113-Q115 VanDerWaalsContact C-N 3.33Å; N113-K116 PolarHBondContact O-N 2.91Å; N113-A117 VanDerWaalsContact O-CB 3.31Å; N113-A117 WeakPolarHBondContact O-CB 3.44Å; N113-A117 PolarHBondContact O-N 3Å
114	L	56.8	Low	51.2	Low	129 Å²	129	106.8 Å²	106.8	68%	0.675	56%	0.555	S	S	*	*	H	α-helix	trans	-66.8	-34.1	173.5	-73.8	168	0	0	0	112.4	D110 A111 A117 G118	D110-L114 WeakPolarHBondContact O-CG 3.45Å; D110-L114 PolarHBondContact O-N 2.73Å; A111-L114 PolarHBondContact O-N 3.23Å; L114-A117 PolarHBondContact O-N 3.06Å; L114-G118 PolarHBondContact O-N 3.12Å
115	Q	52.7	Low	51.1	Low	142 Å²	142	115.5 Å²	115.5	66%	0.664	59%	0.589	S	S	*	*	H	α-helix	trans	-70.8	-38.8	176	-167.1	161.8	-6.8	0	0	112.2	A111 N113 G118 D119	A111-Q115 PolarHBondContact O-N 2.72Å; A111-Q115 VanDerWaalsContact O-N 3.15Å; N113-Q115 VanDerWaalsContact C-N 3.33Å; Q115-G118 PolarHBondContact O-N 3.27Å; Q115-D119 PolarHBondContact O-N 3.16Å
116	K	54.2	Low	50.7	Low	136 Å²	136	119.5 Å²	119.5	59%	0.591	60%	0.6	S	S	*	*	H	α-helix	trans	-68.1	-35.6	171.9	-73.9	178.4	-179.9	175.8	0	112.7	T112 N113 Q120	T112-K116 PolarHBondContact O-N 3.06Å; T112-K116 VanDerWaalsContact O-N 3.13Å; N113-K116 PolarHBondContact O-N 2.91Å; K116-Q120 WeakPolarHBondContact O-CB 3.42Å; K116-Q120 PolarHBondContact O-N 3.02Å
117	A	54	Low	50.3	Low	57 Å²	57	115.7 Å²	115.7	47%	0.471	59%	0.593	S	S	.	*	H	α-helix	trans	-68.7	-35.6	174.4	0	0	0	0	0	112.1	N113 L114 G121	N113-A117 VanDerWaalsContact O-CB 3.31Å; N113-A117 WeakPolarHBondContact O-CB 3.44Å; N113-A117 PolarHBondContact O-N 3Å; L114-A117 PolarHBondContact O-N 3.06Å; A117-G121 PolarHBondContact O-N 3.3Å
118	G	53.7	Low	49.7	Very low	39 Å²	39	114.3 Å²	114.3	40%	0.402	59%	0.594	S	S	.	*	H	α-helix	trans	-64.2	-46.6	172.2	0	0	0	0	0	112.6	L114 Q115 Q120 G121 Q122	L114-G118 PolarHBondContact O-N 3.12Å; Q115-G118 PolarHBondContact O-N 3.27Å; G118-Q120 PolarHBondContact O-N 2.92Å; G118-G121 PolarHBondContact O-N 3.16Å; G118-Q122 WeakPolarHBondContact O-CB 3.41Å; G118-Q122 PolarHBondContact O-N 3.35Å
119	D	52.5	Low	49.2	Very low	98 Å²	98	118.2 Å²	118.2	52%	0.524	61%	0.611	S	S	.	*	H	α-helix	trans	-68.9	-31.2	177.8	-84.3	-22.3	0	0	0	113.1	Q115 R123	Q115-D119 PolarHBondContact O-N 3.16Å; D119-R123 PolarHBondContact O-N 2.81Å
120	Q	51.1	Low	48.9	Very low	149 Å²	149	117.2 Å²	117.2	70%	0.696	62%	0.615	S	S	*	*	H	α-helix	trans	-74.6	-38.6	171.7	-87.1	179.5	-26.8	0	0	112.6	K116 G118 Q122 R123 S124	K116-Q120 WeakPolarHBondContact O-CB 3.42Å; K116-Q120 PolarHBondContact O-N 3.02Å; G118-Q120 PolarHBondContact O-N 2.92Å; Q120-Q122 VanDerWaalsContact C-N 3.31Å; Q120-Q122 PolarHBondContact O-N 2.92Å; Q120-R123 PolarHBondContact O-N 2.8Å; Q120-S124 WeakPolarHBondContact O-CB 3.44Å; Q120-S124 PolarHBondContact O-N 2.87Å
121	G	45.8	Very low	48.4	Very low	34 Å²	34	121.3 Å²	121.3	35%	0.351	63%	0.631	S	S	.	*	H	α-helix	trans	-65.3	-34.3	172.9	0	0	0	0	0	112.7	A117 G118 S124 F125	A117-G121 PolarHBondContact O-N 3.3Å; G118-G121 PolarHBondContact O-N 3.16Å; G121-S124 PolarHBondContact O-N 2.75Å; G121-F125 PolarHBondContact O-N 3.02Å
122	Q	42.7	Very low	48.1	Very low	147 Å²	147	125.9 Å²	125.9	69%	0.687	65%	0.648	S	S	*	*	H	α-helix	trans	-76.5	-23.3	178.6	-163.1	166.4	1.3	0	0	113.1	G118 Q120	G118-Q122 WeakPolarHBondContact O-CB 3.41Å; G118-Q122 PolarHBondContact O-N 3.35Å; Q120-Q122 VanDerWaalsContact C-N 3.31Å; Q120-Q122 PolarHBondContact O-N 2.92Å
123	R	43.8	Very low	47.5	Very low	215 Å²	215	127.2 Å²	127.2	81%	0.811	66%	0.66	S	S	*	*	H	α-helix	trans	-81.9	-27.6	166.9	-76.4	-177.9	176.9	-178.3	-0	113	D119 Q120	D119-R123 PolarHBondContact O-N 2.81Å; Q120-R123 PolarHBondContact O-N 2.8Å
124	S	41.8	Very low	47	Very low	71 Å²	71	135.8 Å²	135.8	50%	0.497	70%	0.697	S	S	.	*	H	α-helix	trans	-81.6	-10.5	178.9	-167.2	0	0	0	0	114.5	Q120 G121 I127	Q120-S124 WeakPolarHBondContact O-CB 3.44Å; Q120-S124 PolarHBondContact O-N 2.87Å; G121-S124 PolarHBondContact O-N 2.75Å; S124-I127 WeakPolarHBondContact O-CD1 3.33Å; S124-I127 WeakPolarHBondContact O-CG1 3.45Å
125	F	42.4	Very low	46.5	Very low	194 Å²	194	136.1 Å²	136.1	85%	0.851	70%	0.698	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.1	2.3	171.6	-98.9	-85.4	0	0	0	114	G121 I127	G121-F125 PolarHBondContact O-N 3.02Å; F125-I127 PolarHBondContact O-N 2.85Å
126	R	38.6	Very low	46.2	Very low	236 Å²	236	135.8 Å²	135.8	89%	0.891	70%	0.7	S	S	*	*			trans	-86.1	59.8	157.6	-84.8	-171.2	174.7	168.3	-1.6	109.4
127	I	46	Very low	45.8	Very low	119 Å²	119	135.8 Å²	135.8	61%	0.61	71%	0.706	S	S	*	*			trans	-101.8	106.8	165.2	-68.4	168.4	0	0	0	105.5	S124 F125	S124-I127 WeakPolarHBondContact O-CD1 3.33Å; S124-I127 WeakPolarHBondContact O-CG1 3.45Å; F125-I127 PolarHBondContact O-N 2.85Å
128	S	40	Very low	45.3	Very low	98 Å²	98	140.4 Å²	140.4	69%	0.685	72%	0.72	S	S	*	*			trans	51.4	86.1	144.1	-33.8	0	0	0	0	116.5	P130	S128-P130 WeakPolarHBondContact O-CD 3.17Å
129	L	44.7	Very low	44.8	Very low	172 Å²	172	146.8 Å²	146.8	90%	0.901	74%	0.74	S	S	*	*			trans	-69.4	123.1	144.5	-92.4	93.7	0	0	0	106.6
130	P	47	Very low	44.3	Very low	99 Å²	99	150 Å²	150	64%	0.643	75%	0.754	S	S	*	*			trans	-63.5	141.4	172.7	27.1	-31.5	0	0	0	109.8	S128 D132	S128-P130 WeakPolarHBondContact O-CD 3.17Å; P130-D132 PolarHBondContact O-N 2.95Å
131	E	41.8	Very low	43.8	Very low	184 Å²	184	150.1 Å²	150.1	86%	0.86	76%	0.758	S	S	*	*			trans	-64	97.2	166.7	-66.7	-177.6	123	0	0	109.1	S133	E131-S133 PolarHBondContact O-N 2.96Å; E131-S133 PolarHBondContact O-OG 3.46Å
132	D	47.8	Very low	43.6	Very low	152 Å²	152	159 Å²	159	81%	0.813	79%	0.79	S	S	*	*			trans	-69.4	97.6	152.8	-62.3	-37.1	0	0	0	104.9	P130	P130-D132 PolarHBondContact O-N 2.95Å
133	S	43.5	Very low	43.7	Very low	105 Å²	105	160 Å²	160	73%	0.734	80%	0.798	S	S	*	*				53	72.6	64.9	-56.8	0	0	0	0	112.8	E131	E131-S133 PolarHBondContact O-N 2.96Å; E131-S133 PolarHBondContact O-OG 3.46Å
134	E	46.9	Very low	43.7	Very low	275 Å²	275	155 Å²	155	100%	1.285	80%	0.797	S	S	*	*			trans	-172.6	0	133.4	-101.1	-178.4	140.1	0	0	111.7

Retrieved 134 of 134 residues in 371.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).