A0A077YXE7_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YXE7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 98 aa.

						>A0A077YXE7_TRITR|A0A077YXE7
MTASGWAAAAESEREHVSGKKVLQDVHHSGAATTNPSEPDELNSNWSRKAVAVSARRTGMRVEQRRKKNATSVAMHGDRFSLRSIDRDTCQCITYLLK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.3	Low	54.8	Low	253 Å²	253	139.8 Å²	139.8	100%	1.246	88%	0.876	S	S	*	*				0	107.9	0	-79.4	175.3	174.1	0	0	107.8
2	T	66.3	Low	54.3	Low	138 Å²	138	137.1 Å²	137.1	85%	0.847	87%	0.865	S	S	*	*			trans	-93.5	123	179.8	9.9	0	0	0	0	108.1	S4	T2-S4 PolarHBondContact O-N 3.5Å
3	A	49.8	Very low	54.4	Low	109 Å²	109	140.5 Å²	140.5	90%	0.901	86%	0.863	S	S	*	*			trans	-82.1	104.2	169.6	0	0	0	0	0	108.6
4	S	58	Low	54.7	Low	118 Å²	118	146.6 Å²	146.6	83%	0.825	86%	0.863	S	S	*	*			trans	-56.9	156.3	170.5	-34.5	0	0	0	0	112.2	T2	T2-S4 PolarHBondContact O-N 3.5Å
5	G	56.4	Low	55.1	Low	71 Å²	71	148.1 Å²	148.1	73%	0.732	86%	0.858	S	S	*	*				125.7	5.4	128.3	0	0	0	0	0	120.3	A7	G5-A7 PolarHBondContact O-N 3.06Å
6	W	61.1	Low	55	Low	273 Å²	273	151.5 Å²	151.5	100%	1.034	86%	0.863	S	S	*	*			trans	-85.8	68.8	165	-118.5	-60.8	0	0	0	110.1
7	A	54.4	Low	54.9	Low	85 Å²	85	148.9 Å²	148.9	70%	0.702	85%	0.85	S	S	*	*			trans	-68.4	134.9	174.6	0	0	0	0	0	110.4	G5 A9	G5-A7 PolarHBondContact O-N 3.06Å; A7-A9 PolarHBondContact O-N 3.33Å
8	A	48.4	Very low	55.2	Low	105 Å²	105	145.8 Å²	145.8	87%	0.868	84%	0.839	S	S	*	*			trans	-56.9	126.9	165.2	0	0	0	0	0	111.3
9	A	52.5	Low	55.5	Low	95 Å²	95	141.1 Å²	141.1	79%	0.785	83%	0.826	S	S	*	*			trans	-143.9	91.7	155.9	0	0	0	0	0	105.3	A7	A7-A9 PolarHBondContact O-N 3.33Å
10	A	53.3	Low	55.8	Low	92 Å²	92	142.9 Å²	142.9	76%	0.76	82%	0.823	S	S	*	*				98.2	97.8	96.4	0	0	0	0	0	109
11	E	51.7	Low	55.9	Low	199 Å²	199	143.4 Å²	143.4	93%	0.93	82%	0.816	S	S	*	*			trans	-41.7	133.7	159.4	-76.7	137.5	140.2	0	0	111.6
12	S	48.1	Very low	56.4	Low	107 Å²	107	135.6 Å²	135.6	75%	0.748	78%	0.782	S	S	*	*			trans	-159.7	104.3	149.6	-167.1	0	0	0	0	109.8
13	E	56.4	Low	56	Low	181 Å²	181	135.4 Å²	135.4	85%	0.846	78%	0.775	S	S	*	*			trans	-10.1	124.1	151.5	-59.7	167.9	158.2	0	0	115.3
14	R	57.9	Low	56.6	Low	226 Å²	226	136.4 Å²	136.4	85%	0.853	76%	0.761	S	S	*	*			trans	-164.7	111.6	146.3	-106.6	161.5	-153.4	-169.6	5.7	111.8
15	E	61.3	Low	56.5	Low	169 Å²	169	136.1 Å²	136.1	79%	0.79	75%	0.75	S	S	*	*			trans	59.4	111.9	141.6	-67	179.3	146.4	0	0	119.1	V17	E15-V17 PolarHBondContact O-N 2.94Å
16	H	54	Low	56.6	Low	203 Å²	203	138.1 Å²	138.1	94%	0.94	75%	0.748	S	S	*	*			trans	-59.7	91.1	165.3	-68.6	-111.9	0	0	0	111.2
17	V	52.9	Low	56.5	Low	107 Å²	107	132.3 Å²	132.3	65%	0.648	73%	0.732	S	S	*	*			trans	-94.7	108	163.6	-178.3	0	0	0	0	108.5	E15 G19 V22	E15-V17 PolarHBondContact O-N 2.94Å; V17-G19 PolarHBondContact O-N 3.35Å; V17-V22 HydrophobicContact CG1-CG2 4.15Å
18	S	59.5	Low	56.7	Low	93 Å²	93	136.3 Å²	136.3	65%	0.65	74%	0.736	S	S	*	*			trans	-55.4	109.6	175	178.1	0	0	0	0	110.6	K20 K21	S18-K20 PolarHBondContact O-N 3.04Å; S18-K21 PolarHBondContact O-N 2.81Å
19	G	61.9	Low	57	Low	57 Å²	57	136.6 Å²	136.6	59%	0.588	73%	0.732	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.6	12.8	-175.4	0	0	0	0	0	116.4	V17	V17-G19 PolarHBondContact O-N 3.35Å
20	K	60.1	Low	56.9	Low	177 Å²	177	135.4 Å²	135.4	77%	0.77	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90	-22.1	172.1	-86.1	-173.9	174.3	-179	0	114.3	S18	S18-K20 PolarHBondContact O-N 3.04Å
21	K	59.1	Low	56.9	Low	153 Å²	153	135.8 Å²	135.8	67%	0.665	73%	0.732	S	S	*	*	S	Bend	trans	-86.4	-31.2	178.6	-95.3	-171.9	171.7	-172.6	0	114.3	S18 L23 Q24 D25	S18-K21 PolarHBondContact O-N 2.81Å; K21-L23 PolarHBondContact O-N 3.4Å; K21-L23 VanDerWaalsContact O-N 3.15Å; K21-Q24 PolarHBondContact O-N 3.38Å; K21-Q24 VanDerWaalsContact O-N 3.08Å; K21-D25 PolarHBondContact O-N 3.15Å
22	V	61.6	Low	57	Low	89 Å²	89	130.1 Å²	130.1	54%	0.539	72%	0.719	S	S	.	*	H	α-helix	trans	-62.2	-28	-175.1	-179.9	0	0	0	0	113	V17 V26	V17-V22 HydrophobicContact CG1-CG2 4.15Å; V22-V26 WeakPolarHBondContact O-CG2 3.5Å
23	L	58.2	Low	57.2	Low	135 Å²	135	132.2 Å²	132.2	71%	0.707	73%	0.727	S	S	*	*	H	α-helix	trans	-84.7	-12.1	179.1	-82.8	159.9	0	0	0	114.5	K21	K21-L23 PolarHBondContact O-N 3.4Å; K21-L23 VanDerWaalsContact O-N 3.15Å
24	Q	61.4	Low	57.3	Low	129 Å²	129	129.3 Å²	129.3	60%	0.603	72%	0.722	S	S	*	*	H	α-helix	trans	-98.6	-30.5	-179.2	-70.7	-176.2	-14.7	0	0	112.6	K21 V26 H27	K21-Q24 PolarHBondContact O-N 3.38Å; K21-Q24 VanDerWaalsContact O-N 3.08Å; Q24-V26 VanDerWaalsContact C-N 3.28Å; Q24-V26 PolarHBondContact O-N 3.08Å; Q24-H27 PolarHBondContact O-N 3.23Å
25	D	56.9	Low	57.2	Low	112 Å²	112	125.4 Å²	125.4	60%	0.599	72%	0.718	S	S	*	*	H	α-helix	trans	-75.3	-17	179.2	-66	-27.5	0	0	0	113.1	K21 H27	K21-D25 PolarHBondContact O-N 3.15Å; D25-H27 VanDerWaalsContact C-N 3.31Å
26	V	58.4	Low	56.8	Low	114 Å²	114	123.9 Å²	123.9	69%	0.691	72%	0.723	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.4	-21	172.4	177.1	0	0	0	0	112.2	V22 Q24	V22-V26 WeakPolarHBondContact O-CG2 3.5Å; Q24-V26 VanDerWaalsContact C-N 3.28Å; Q24-V26 PolarHBondContact O-N 3.08Å
27	H	57.9	Low	57	Low	151 Å²	151	118.7 Å²	118.7	70%	0.699	71%	0.71	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.7	-2.8	-173.9	-92.9	-90.9	0	0	0	115.1	Q24 D25	Q24-H27 PolarHBondContact O-N 3.23Å; D25-H27 VanDerWaalsContact C-N 3.31Å
28	H	58.5	Low	57.2	Low	168 Å²	168	122.3 Å²	122.3	78%	0.778	72%	0.719	S	S	*	*	T	Hydrogen-bonded Turn	trans	-128.8	-4.2	-169.6	-64.1	-31.7	0	0	0	116.7
29	S	55.1	Low	57.3	Low	111 Å²	111	124 Å²	124	78%	0.776	73%	0.728	S	S	*	*	S	Bend	trans	-119.8	22	-177.3	95.2	0	0	0	0	115.5
30	G	50	Low	57.4	Low	70 Å²	70	126.7 Å²	126.7	72%	0.722	73%	0.729	S	S	*	*			trans	-117.2	93.5	-176	0	0	0	0	0	113.9
31	A	54.3	Low	57.4	Low	101 Å²	101	126.3 Å²	126.3	84%	0.835	73%	0.73	S	S	*	*			trans	72.4	117.3	140.5	0	0	0	0	0	121
32	A	54.1	Low	57.4	Low	79 Å²	79	124 Å²	124	65%	0.653	73%	0.725	S	S	*	*			trans	92.6	86.9	136.5	0	0	0	0	0	118.7	T34	A32-T34 PolarHBondContact O-N 3.17Å; A32-T34 PolarHBondContact O-OG1 3.02Å
33	T	51.5	Low	57.2	Low	151 Å²	151	125 Å²	125	93%	0.926	73%	0.727	S	S	*	*			trans	-45.1	100.4	143.6	50.6	0	0	0	0	110.6
34	T	59.1	Low	57.2	Low	120 Å²	120	120.6 Å²	120.6	74%	0.736	71%	0.707	S	S	*	*			trans	-143.1	126.5	174.1	-17.5	0	0	0	0	108.1	A32	A32-T34 PolarHBondContact O-N 3.17Å; A32-T34 PolarHBondContact O-OG1 3.02Å
35	N	54.7	Low	57.2	Low	144 Å²	144	118.4 Å²	118.4	77%	0.77	70%	0.7	S	S	*	*			trans	-50.6	137.6	-173.1	-74.5	-43.6	0	0	0	112.8	S37	N35-S37 VanDerWaalsContact C-N 3.31Å; N35-S37 PolarHBondContact O-N 2.99Å
36	P	53.8	Low	57.2	Low	137 Å²	137	122 Å²	122	89%	0.89	71%	0.705	S	S	*	*			trans	-81.8	79	176.6	35	-32.1	0	0	0	109.2
37	S	58.4	Low	57.5	Low	94 Å²	94	120 Å²	120	66%	0.657	70%	0.696	S	S	*	*			trans	-129.2	109.9	172.3	45.7	0	0	0	0	108.5	N35	N35-S37 VanDerWaalsContact C-N 3.31Å; N35-S37 PolarHBondContact O-N 2.99Å
38	E	57.2	Low	57.7	Low	183 Å²	183	120.8 Å²	120.8	86%	0.855	69%	0.693	S	S	*	*			trans	83.8	106.3	177.9	-57.3	-175.5	166.7	0	0	116.2	D40	E38-D40 PolarHBondContact O-N 3.43Å; E38-D40 VanDerWaalsContact O-N 3.16Å
39	P	61.5	Low	57.9	Low	128 Å²	128	119.7 Å²	119.7	83%	0.831	69%	0.686	S	S	*	*			trans	-69.2	111.6	170.8	27.8	-30.5	0	0	0	110.2	E41	P39-E41 PolarHBondContact O-N 3.16Å
40	D	64	Low	58.4	Low	115 Å²	115	117.1 Å²	117.1	62%	0.615	67%	0.671	S	S	*	*			trans	-25.7	120.9	173.8	-105.4	-27.7	0	0	0	115.5	E38 L42 N43	E38-D40 PolarHBondContact O-N 3.43Å; E38-D40 VanDerWaalsContact O-N 3.16Å; D40-L42 HydrophobicContact CB-CB 4.31Å; D40-L42 PolarHBondContact O-N 3.35Å; D40-N43 PolarHBondContact O-N 3.31Å
41	E	60.4	Low	58.9	Low	168 Å²	168	118.2 Å²	118.2	79%	0.785	66%	0.664	S	S	*	*	H	α-helix	trans	-51.9	-22.7	169.6	-68.7	-173.1	148.8	0	0	112.7	P39 S44	P39-E41 PolarHBondContact O-N 3.16Å; E41-S44 WeakPolarHBondContact O-CB 3.31Å; E41-S44 PolarHBondContact O-N 2.9Å; E41-S44 PolarHBondContact O-OG 3.2Å
42	L	58.1	Low	59.5	Low	106 Å²	106	115.8 Å²	115.8	56%	0.555	64%	0.644	S	S	*	*	H	α-helix	trans	-64.3	-34.9	174.4	-75.3	161.4	0	0	0	113.5	D40 S44 N45 W46	D40-L42 HydrophobicContact CB-CB 4.31Å; D40-L42 PolarHBondContact O-N 3.35Å; L42-S44 PolarHBondContact O-N 2.69Å; L42-N45 PolarHBondContact O-N 3.47Å; L42-W46 PolarHBondContact O-N 3.37Å
43	N	56.8	Low	60	Low	110 Å²	110	115.6 Å²	115.6	59%	0.588	64%	0.635	S	S	*	*	H	α-helix	trans	-72.4	-21.8	179.9	-147.8	-4.6	0	0	0	111.7	D40 S47	D40-N43 PolarHBondContact O-N 3.31Å; N43-S47 WeakPolarHBondContact O-CB 3.42Å; N43-S47 PolarHBondContact O-N 3.36Å
44	S	59.5	Low	60.6	Low	41 Å²	41	111.8 Å²	111.8	29%	0.287	61%	0.614	S	S	.	*	H	α-helix	trans	-73	-31.9	172.9	85.7	0	0	0	0	112.8	E41 L42 R48	E41-S44 WeakPolarHBondContact O-CB 3.31Å; E41-S44 PolarHBondContact O-N 2.9Å; E41-S44 PolarHBondContact O-OG 3.2Å; L42-S44 PolarHBondContact O-N 2.69Å; S44-R48 WeakPolarHBondContact O-CB 3.27Å; S44-R48 VanDerWaalsContact O-CG 3.27Å; S44-R48 WeakPolarHBondContact O-CG 3.33Å; S44-R48 PolarHBondContact O-N 2.95Å; S44-R48 VanDerWaalsContact O-N 3.12Å
45	N	60.5	Low	60.8	Low	84 Å²	84	108.7 Å²	108.7	45%	0.449	60%	0.601	S	S	.	*	H	α-helix	trans	-77.4	-33.7	-178.4	-82.8	-34.7	0	0	0	113	L42 K49	L42-N45 PolarHBondContact O-N 3.47Å; N45-K49 WeakPolarHBondContact O-CB 3.46Å; N45-K49 VanDerWaalsContact O-CG 3.31Å; N45-K49 WeakPolarHBondContact O-CG 3.27Å; N45-K49 PolarHBondContact O-N 3.16Å; N45-K49 VanDerWaalsContact O-N 3.16Å
46	W	57.4	Low	61.4	Low	188 Å²	188	111.3 Å²	111.3	71%	0.712	60%	0.6	S	S	*	*	H	α-helix	trans	-73.7	-40.8	174.7	-67.4	-4.2	0	0	0	112.1	L42 K49 A50	L42-W46 PolarHBondContact O-N 3.37Å; W46-K49 PolarHBondContact O-N 2.94Å; W46-A50 WeakPolarHBondContact O-CB 3.47Å; W46-A50 PolarHBondContact O-N 3.12Å
47	S	64.1	Low	62.2	Low	71 Å²	71	113.4 Å²	113.4	50%	0.497	59%	0.59	S	S	.	*	H	α-helix	trans	-60.6	-48.1	174.9	-176.9	0	0	0	0	111.6	N43 K49 A50 V51	N43-S47 WeakPolarHBondContact O-CB 3.42Å; N43-S47 PolarHBondContact O-N 3.36Å; S47-K49 PolarHBondContact O-N 3.42Å; S47-A50 PolarHBondContact O-N 3.44Å; S47-V51 WeakPolarHBondContact O-CB 3.49Å; S47-V51 WeakPolarHBondContact O-CG2 3.46Å; S47-V51 PolarHBondContact O-N 3.47Å
48	R	63.1	Low	62.8	Low	167 Å²	167	113 Å²	113	63%	0.63	58%	0.583	S	S	*	*	H	α-helix	trans	-63.9	-41.1	178	-71.1	-178.9	-136.1	-171.8	7.1	113.2	S44 V51 A52	S44-R48 WeakPolarHBondContact O-CB 3.27Å; S44-R48 VanDerWaalsContact O-CG 3.27Å; S44-R48 WeakPolarHBondContact O-CG 3.33Å; S44-R48 PolarHBondContact O-N 2.95Å; S44-R48 VanDerWaalsContact O-N 3.12Å; R48-V51 PolarHBondContact O-N 3.49Å; R48-A52 VanDerWaalsContact O-CB 3.29Å; R48-A52 WeakPolarHBondContact O-CB 3.29Å; R48-A52 PolarHBondContact O-N 3.38Å
49	K	61.9	Low	63.4	Low	145 Å²	145	106.1 Å²	106.1	63%	0.63	56%	0.562	S	S	*	*	H	α-helix	trans	-65.7	-43.2	177	-76.7	179.8	-178.8	-180	0	111.7	N45 W46 S47 A52 V53	N45-K49 WeakPolarHBondContact O-CB 3.46Å; N45-K49 VanDerWaalsContact O-CG 3.31Å; N45-K49 WeakPolarHBondContact O-CG 3.27Å; N45-K49 PolarHBondContact O-N 3.16Å; N45-K49 VanDerWaalsContact O-N 3.16Å; W46-K49 PolarHBondContact O-N 2.94Å; S47-K49 PolarHBondContact O-N 3.42Å; K49-A52 PolarHBondContact O-N 2.9Å; K49-V53 WeakPolarHBondContact O-CB 3.34Å; K49-V53 VanDerWaalsContact O-CG2 3.27Å; K49-V53 WeakPolarHBondContact O-CG2 3.19Å; K49-V53 PolarHBondContact O-N 3.5Å
50	A	65	Low	64	Low	57 Å²	57	105.1 Å²	105.1	47%	0.471	55%	0.547	S	S	.	.	H	α-helix	trans	-64.1	-42.1	177.1	0	0	0	0	0	112.1	W46 S47 V53 S54	W46-A50 WeakPolarHBondContact O-CB 3.47Å; W46-A50 PolarHBondContact O-N 3.12Å; S47-A50 PolarHBondContact O-N 3.44Å; A50-V53 PolarHBondContact O-N 2.94Å; A50-S54 WeakPolarHBondContact O-CB 3.47Å; A50-S54 PolarHBondContact O-N 3.12Å; A50-S54 PolarHBondContact O-OG 2.99Å
51	V	61.4	Low	64.7	Low	93 Å²	93	107.3 Å²	107.3	56%	0.564	55%	0.547	S	S	*	.	H	α-helix	trans	-63.8	-45	175.2	172.7	0	0	0	0	110.9	S47 R48 V53 S54 A55	S47-V51 WeakPolarHBondContact O-CB 3.49Å; S47-V51 WeakPolarHBondContact O-CG2 3.46Å; S47-V51 PolarHBondContact O-N 3.47Å; R48-V51 PolarHBondContact O-N 3.49Å; V51-V53 PolarHBondContact O-N 2.79Å; V51-S54 PolarHBondContact O-N 3.5Å; V51-A55 WeakPolarHBondContact O-CB 3.42Å; V51-A55 PolarHBondContact O-N 2.95Å
52	A	66.4	Low	65.4	Low	51 Å²	51	103 Å²	103	42%	0.421	53%	0.532	S	S	.	.	H	α-helix	trans	-64	-40.9	178.3	0	0	0	0	0	112.9	R48 K49 S54 A55 R56	R48-A52 VanDerWaalsContact O-CB 3.29Å; R48-A52 WeakPolarHBondContact O-CB 3.29Å; R48-A52 PolarHBondContact O-N 3.38Å; K49-A52 PolarHBondContact O-N 2.9Å; A52-S54 VanDerWaalsContact C-N 3.35Å; A52-A55 PolarHBondContact O-N 2.85Å; A52-R56 WeakPolarHBondContact O-CG 3.37Å; A52-R56 PolarHBondContact O-N 3.26Å
53	V	64.6	Low	66.3	Low	75 Å²	75	102.9 Å²	102.9	46%	0.455	53%	0.528	S	S	.	.	H	α-helix	trans	-65.5	-40.5	175.3	171.4	0	0	0	0	110.8	K49 A50 V51 R56 R57	K49-V53 WeakPolarHBondContact O-CB 3.34Å; K49-V53 VanDerWaalsContact O-CG2 3.27Å; K49-V53 WeakPolarHBondContact O-CG2 3.19Å; K49-V53 PolarHBondContact O-N 3.5Å; A50-V53 PolarHBondContact O-N 2.94Å; V51-V53 PolarHBondContact O-N 2.79Å; V53-R56 PolarHBondContact O-N 2.96Å; V53-R57 WeakPolarHBondContact O-CG 3.42Å; V53-R57 PolarHBondContact O-N 3.45Å; V53-R57 VanDerWaalsContact O-N 3.12Å
54	S	65.5	Low	67.1	Low	71 Å²	71	104 Å²	104	50%	0.497	53%	0.53	S	S	.	.	H	α-helix	trans	-65.2	-43.3	177	-59.8	0	0	0	0	111.8	A50 V51 A52 R57 T58	A50-S54 WeakPolarHBondContact O-CB 3.47Å; A50-S54 PolarHBondContact O-N 3.12Å; A50-S54 PolarHBondContact O-OG 2.99Å; V51-S54 PolarHBondContact O-N 3.5Å; A52-S54 VanDerWaalsContact C-N 3.35Å; S54-R57 PolarHBondContact O-N 3.38Å; S54-T58 PolarHBondContact O-N 3.28Å; S54-T58 PolarHBondContact O-OG1 3.19Å
55	A	63.5	Low	68	Low	55 Å²	55	109.9 Å²	109.9	46%	0.455	55%	0.546	S	S	.	.	H	α-helix	trans	-64	-38.7	176.3	0	0	0	0	0	112.8	V51 A52 T58 G59	V51-A55 WeakPolarHBondContact O-CB 3.42Å; V51-A55 PolarHBondContact O-N 2.95Å; A52-A55 PolarHBondContact O-N 2.85Å; A55-T58 WeakPolarHBondContact CA-OG1 3.3Å; A55-T58 PolarHBondContact O-N 2.85Å; A55-T58 PolarHBondContact O-OG1 3.39Å; A55-G59 PolarHBondContact O-N 2.95Å
56	R	66.4	Low	68.7	Low	199 Å²	199	114.8 Å²	114.8	75%	0.751	56%	0.558	S	S	*	*	H	α-helix	trans	-63.5	-43.4	173.8	-76.3	-177.9	-178.7	-160.3	1	111.7	A52 V53 G59 M60	A52-R56 WeakPolarHBondContact O-CG 3.37Å; A52-R56 PolarHBondContact O-N 3.26Å; V53-R56 PolarHBondContact O-N 2.96Å; R56-G59 PolarHBondContact O-N 3.02Å; R56-M60 WeakPolarHBondContact O-CG 3.36Å; R56-M60 PolarHBondContact O-N 2.98Å
57	R	70.5	Confident	69.6	Low	180 Å²	180	112 Å²	112	68%	0.679	55%	0.551	S	S	*	*	H	α-helix	trans	-63.8	-41.3	177.9	-73.4	179.6	-179.3	-179.1	0.6	112.4	V53 S54 R61	V53-R57 WeakPolarHBondContact O-CG 3.42Å; V53-R57 PolarHBondContact O-N 3.45Å; V53-R57 VanDerWaalsContact O-N 3.12Å; S54-R57 PolarHBondContact O-N 3.38Å; R57-R61 PolarHBondContact O-N 3.39Å; R57-R61 VanDerWaalsContact O-N 3.16Å
58	T	71	Confident	70	Confident	85 Å²	85	116 Å²	116	52%	0.521	56%	0.56	S	S	.	*	H	α-helix	trans	-68.3	-41.9	175.8	49.6	0	0	0	0	111.5	S54 A55 M60 R61 V62	S54-T58 PolarHBondContact O-N 3.28Å; S54-T58 PolarHBondContact O-OG1 3.19Å; A55-T58 WeakPolarHBondContact CA-OG1 3.3Å; A55-T58 PolarHBondContact O-N 2.85Å; A55-T58 PolarHBondContact O-OG1 3.39Å; T58-M60 PolarHBondContact O-N 3.2Å; T58-R61 PolarHBondContact O-N 3.48Å; T58-V62 WeakPolarHBondContact O-CG2 3.38Å; T58-V62 PolarHBondContact O-N 3.49Å
59	G	70.7	Confident	70	Confident	39 Å²	39	113 Å²	113	40%	0.402	56%	0.556	S	S	.	*	H	α-helix	trans	-56.3	-48.6	174.3	0	0	0	0	0	112.9	A55 R56 R61 V62 E63	A55-G59 PolarHBondContact O-N 2.95Å; R56-G59 PolarHBondContact O-N 3.02Å; G59-R61 VanDerWaalsContact C-N 3.32Å; G59-R61 PolarHBondContact O-N 2.91Å; G59-V62 PolarHBondContact O-N 3.01Å; G59-E63 PolarHBondContact O-N 2.94Å
60	M	72.8	Confident	70.1	Confident	108 Å²	108	109.1 Å²	109.1	53%	0.532	55%	0.551	S	S	.	*	H	α-helix	trans	-61.8	-38.4	176.2	-68.9	-167.7	-36.2	0	0	112.5	R56 T58 E63 Q64	R56-M60 WeakPolarHBondContact O-CG 3.36Å; R56-M60 PolarHBondContact O-N 2.98Å; T58-M60 PolarHBondContact O-N 3.2Å; M60-E63 PolarHBondContact O-N 3.18Å; M60-Q64 WeakPolarHBondContact O-CB 3.49Å; M60-Q64 VanDerWaalsContact O-CG 3.3Å; M60-Q64 WeakPolarHBondContact O-CG 3.46Å; M60-Q64 PolarHBondContact O-N 3.16Å
61	R	78.9	Confident	69.8	Low	161 Å²	161	110.7 Å²	110.7	61%	0.608	56%	0.555	S	S	*	*	H	α-helix	trans	-65.5	-39.7	176.2	179.3	179.6	-85.8	176.5	-5.6	111.6	R57 T58 G59 R65	R57-R61 PolarHBondContact O-N 3.39Å; R57-R61 VanDerWaalsContact O-N 3.16Å; T58-R61 PolarHBondContact O-N 3.48Å; G59-R61 VanDerWaalsContact C-N 3.32Å; G59-R61 PolarHBondContact O-N 2.91Å; R61-R65 WeakPolarHBondContact O-CB 3.4Å; R61-R65 WeakPolarHBondContact O-CG 3.37Å; R61-R65 PolarHBondContact O-N 2.93Å
62	V	75.1	Confident	69.8	Low	78 Å²	78	109.4 Å²	109.4	47%	0.473	55%	0.55	S	S	.	*	H	α-helix	trans	-65.8	-43.7	175.4	173.6	0	0	0	0	110.4	T58 G59 R65 R66	T58-V62 WeakPolarHBondContact O-CG2 3.38Å; T58-V62 PolarHBondContact O-N 3.49Å; G59-V62 PolarHBondContact O-N 3.01Å; V62-R65 PolarHBondContact O-N 2.73Å; V62-R66 WeakPolarHBondContact O-CG 3.34Å; V62-R66 PolarHBondContact O-N 3.43Å
63	E	76.4	Confident	69.1	Low	102 Å²	102	112 Å²	112	48%	0.477	56%	0.561	S	S	.	*	H	α-helix	trans	-64.1	-43.3	177.2	-163	-168.2	148.4	0	0	112.2	G59 M60 R65 R66 K67	G59-E63 PolarHBondContact O-N 2.94Å; M60-E63 PolarHBondContact O-N 3.18Å; E63-R65 VanDerWaalsContact C-N 3.33Å; E63-R65 PolarHBondContact O-N 3.21Å; E63-R66 PolarHBondContact O-N 3.44Å; E63-K67 PolarHBondContact O-N 2.92Å; E63-K67 WeakPolarHBondContact OE1-CE 3.42Å; E63-K67 IonicContact OE1-NZ 2.73Å; E63-K67 PolarHBondContact OE1-NZ 3.44Å
64	Q	74.7	Confident	68.7	Low	133 Å²	133	111.6 Å²	111.6	62%	0.621	57%	0.565	S	S	*	*	H	α-helix	trans	-60.3	-41.2	174	-78.7	179.3	-10.6	0	0	111.9	M60 K67 K68	M60-Q64 WeakPolarHBondContact O-CB 3.49Å; M60-Q64 VanDerWaalsContact O-CG 3.3Å; M60-Q64 WeakPolarHBondContact O-CG 3.46Å; M60-Q64 PolarHBondContact O-N 3.16Å; Q64-K67 PolarHBondContact O-N 3.29Å; Q64-K68 WeakPolarHBondContact O-CB 3.48Å; Q64-K68 PolarHBondContact O-N 3.36Å
65	R	78.5	Confident	68.2	Low	165 Å²	165	116 Å²	116	62%	0.623	58%	0.58	S	S	*	*	H	α-helix	trans	-64.8	-41	174.6	-76.4	179.8	176.9	-166.5	-1.5	112	R61 V62 E63 K68 N69	R61-R65 WeakPolarHBondContact O-CB 3.4Å; R61-R65 WeakPolarHBondContact O-CG 3.37Å; R61-R65 PolarHBondContact O-N 2.93Å; V62-R65 PolarHBondContact O-N 2.73Å; E63-R65 VanDerWaalsContact C-N 3.33Å; E63-R65 PolarHBondContact O-N 3.21Å; R65-K68 PolarHBondContact O-N 2.98Å; R65-N69 WeakPolarHBondContact O-CB 3.46Å; R65-N69 VanDerWaalsContact O-CG 3.31Å; R65-N69 PolarHBondContact O-N 2.96Å; R65-N69 PolarHBondContact O-OD1 2.91Å
66	R	74.9	Confident	67.8	Low	188 Å²	188	121 Å²	121	71%	0.709	59%	0.593	S	S	*	*	H	α-helix	trans	-60.4	-46.4	174.8	-75.6	-177.5	176.4	-178.9	-0.9	111.5	V62 E63 N69 A70	V62-R66 WeakPolarHBondContact O-CG 3.34Å; V62-R66 PolarHBondContact O-N 3.43Å; E63-R66 PolarHBondContact O-N 3.44Å; R66-N69 PolarHBondContact O-N 3.39Å; R66-A70 PolarHBondContact O-N 3.49Å
67	K	75.2	Confident	67.2	Low	129 Å²	129	113.4 Å²	113.4	56%	0.561	58%	0.577	S	S	*	*	H	α-helix	trans	-60.4	-46.3	176.2	-77.2	172	170.1	160.9	0	111.9	E63 Q64 N69 A70 T71	E63-K67 PolarHBondContact O-N 2.92Å; E63-K67 WeakPolarHBondContact OE1-CE 3.42Å; E63-K67 IonicContact OE1-NZ 2.73Å; E63-K67 PolarHBondContact OE1-NZ 3.44Å; Q64-K67 PolarHBondContact O-N 3.29Å; K67-N69 PolarHBondContact O-N 3.29Å; K67-A70 PolarHBondContact O-N 2.8Å; K67-T71 PolarHBondContact O-N 3.15Å; K67-T71 VanDerWaalsContact O-N 3.09Å; K67-T71 PolarHBondContact O-OG1 3.09Å
68	K	73.2	Confident	66.6	Low	155 Å²	155	112.4 Å²	112.4	67%	0.674	59%	0.585	S	S	*	*	H	α-helix	trans	-61.5	-41.1	177.9	-171.7	176.8	180	179.7	0	112.5	Q64 R65 T71 S72	Q64-K68 WeakPolarHBondContact O-CB 3.48Å; Q64-K68 PolarHBondContact O-N 3.36Å; R65-K68 PolarHBondContact O-N 2.98Å; K68-T71 WeakPolarHBondContact CA-OG1 3.39Å; K68-T71 PolarHBondContact O-N 3.02Å; K68-T71 PolarHBondContact O-OG1 3.44Å; K68-S72 WeakPolarHBondContact O-CB 3.47Å; K68-S72 PolarHBondContact O-N 3.49Å
69	N	63.4	Low	65.9	Low	104 Å²	104	119.6 Å²	119.6	56%	0.556	60%	0.603	S	S	*	*	H	α-helix	trans	-68.4	-40.2	177.9	-71.4	-0.7	0	0	0	111.6	R65 R66 K67 T71 S72 V73	R65-N69 WeakPolarHBondContact O-CB 3.46Å; R65-N69 VanDerWaalsContact O-CG 3.31Å; R65-N69 PolarHBondContact O-N 2.96Å; R65-N69 PolarHBondContact O-OD1 2.91Å; R66-N69 PolarHBondContact O-N 3.39Å; K67-N69 PolarHBondContact O-N 3.29Å; N69-T71 PolarHBondContact O-N 3.35Å; N69-S72 WeakPolarHBondContact O-CB 3.49Å; N69-S72 PolarHBondContact O-N 3.12Å; N69-S72 VanDerWaalsContact O-N 3.12Å; N69-V73 WeakPolarHBondContact O-CG2 3.39Å; N69-V73 PolarHBondContact O-N 3.09Å
70	A	63.3	Low	65.2	Low	64 Å²	64	127 Å²	127	53%	0.529	62%	0.624	S	S	.	*	H	α-helix	trans	-60.8	-42.8	175.6	0	0	0	0	0	112.2	R66 K67 S72 V73 A74	R66-A70 PolarHBondContact O-N 3.49Å; K67-A70 PolarHBondContact O-N 2.8Å; A70-S72 VanDerWaalsContact C-N 3.31Å; A70-S72 PolarHBondContact O-N 3.45Å; A70-V73 PolarHBondContact O-N 3.41Å; A70-A74 PolarHBondContact O-N 3.38Å; A70-A74 VanDerWaalsContact O-N 3.09Å
71	T	59.3	Low	64.3	Low	89 Å²	89	125.5 Å²	125.5	55%	0.546	63%	0.625	S	S	.	*	H	α-helix	trans	-67.6	-29.4	174.2	47.2	0	0	0	0	113.2	K67 K68 N69 M75	K67-T71 PolarHBondContact O-N 3.15Å; K67-T71 VanDerWaalsContact O-N 3.09Å; K67-T71 PolarHBondContact O-OG1 3.09Å; K68-T71 WeakPolarHBondContact CA-OG1 3.39Å; K68-T71 PolarHBondContact O-N 3.02Å; K68-T71 PolarHBondContact O-OG1 3.44Å; N69-T71 PolarHBondContact O-N 3.35Å; T71-M75 WeakPolarHBondContact O-CG 3.45Å; T71-M75 PolarHBondContact O-N 2.97Å
72	S	61	Low	63.4	Low	67 Å²	67	124.5 Å²	124.5	47%	0.469	63%	0.631	S	S	.	*	H	α-helix	trans	-73	-35.3	176.2	-169.1	0	0	0	0	112.5	K68 N69 A70	K68-S72 WeakPolarHBondContact O-CB 3.47Å; K68-S72 PolarHBondContact O-N 3.49Å; N69-S72 WeakPolarHBondContact O-CB 3.49Å; N69-S72 PolarHBondContact O-N 3.12Å; N69-S72 VanDerWaalsContact O-N 3.12Å; A70-S72 VanDerWaalsContact C-N 3.31Å; A70-S72 PolarHBondContact O-N 3.45Å
73	V	52.7	Low	62.6	Low	106 Å²	106	132.1 Å²	132.1	64%	0.642	65%	0.651	S	S	*	*	H	α-helix	trans	-73.7	-36.1	176.6	176.5	0	0	0	0	110.8	N69 A70 M75 H76 G77	N69-V73 WeakPolarHBondContact O-CG2 3.39Å; N69-V73 PolarHBondContact O-N 3.09Å; A70-V73 PolarHBondContact O-N 3.41Å; V73-M75 VanDerWaalsContact C-N 3.33Å; V73-M75 PolarHBondContact O-N 3.24Å; V73-H76 PolarHBondContact O-N 3.36Å; V73-G77 PolarHBondContact O-N 3.36Å; V73-G77 VanDerWaalsContact O-N 3.1Å
74	A	56	Low	61.8	Low	65 Å²	65	132 Å²	132	54%	0.537	66%	0.661	S	S	.	*	H	α-helix	trans	-61.1	-39.3	174.5	0	0	0	0	0	112.7	A70 H76	A70-A74 PolarHBondContact O-N 3.38Å; A70-A74 VanDerWaalsContact O-N 3.09Å; A74-H76 VanDerWaalsContact C-N 3.28Å; A74-H76 PolarHBondContact O-N 3Å
75	M	54.4	Low	60.9	Low	164 Å²	164	129.9 Å²	129.9	81%	0.808	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.5	-4.9	-179.5	-65.3	-66.5	-126.7	0	0	114.3	T71 V73	T71-M75 WeakPolarHBondContact O-CG 3.45Å; T71-M75 PolarHBondContact O-N 2.97Å; V73-M75 VanDerWaalsContact C-N 3.33Å; V73-M75 PolarHBondContact O-N 3.24Å
76	H	55.5	Low	60.1	Low	159 Å²	159	127.8 Å²	127.8	74%	0.736	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-116.8	-3.4	176.5	-84.1	50.1	0	0	0	113.6	V73 A74	V73-H76 PolarHBondContact O-N 3.36Å; A74-H76 VanDerWaalsContact C-N 3.28Å; A74-H76 PolarHBondContact O-N 3Å
77	G	54.7	Low	59.4	Low	41 Å²	41	129.6 Å²	129.6	42%	0.423	66%	0.661	S	S	.	*	S	Bend	trans	-78.6	-18.8	177.1	0	0	0	0	0	115.1	V73 R79	V73-G77 PolarHBondContact O-N 3.36Å; V73-G77 VanDerWaalsContact O-N 3.1Å; G77-R79 VanDerWaalsContact C-N 3.34Å; G77-R79 PolarHBondContact O-N 3.1Å
78	D	57.8	Low	58.7	Low	158 Å²	158	129.1 Å²	129.1	85%	0.845	67%	0.665	S	S	*	*	S	Bend	trans	-94.8	29.3	-174.1	-76.6	-16	0	0	0	114.2
79	R	55.9	Low	58.1	Low	237 Å²	237	125 Å²	125	89%	0.894	65%	0.653	S	S	*	*			trans	-119.5	52.6	168.6	-71.5	-170.7	179.4	179.8	0.7	111.3	G77 S81	G77-R79 VanDerWaalsContact C-N 3.34Å; G77-R79 PolarHBondContact O-N 3.1Å; R79-S81 VanDerWaalsContact C-N 3.26Å; R79-S81 PolarHBondContact O-N 3.07Å
80	F	56.3	Low	57.8	Low	193 Å²	193	123.5 Å²	123.5	85%	0.846	65%	0.65	S	S	*	*			trans	-67.4	94.9	153.3	-92.2	-84.5	0	0	0	108.2	L82	F80-L82 PolarHBondContact O-N 2.97Å
81	S	53.9	Low	57.6	Low	78 Å²	78	127.5 Å²	127.5	55%	0.545	66%	0.657	S	S	.	*			trans	-63.1	104.1	166.8	-179	0	0	0	0	108	R79 R83	R79-S81 VanDerWaalsContact C-N 3.26Å; R79-S81 PolarHBondContact O-N 3.07Å; S81-R83 PolarHBondContact O-N 2.84Å
82	L	58.3	Low	57.8	Low	140 Å²	140	127.1 Å²	127.1	73%	0.733	66%	0.657	S	S	*	*	G	3₁₀ helix	trans	-63.3	10.9	175	-66.9	166.5	0	0	0	113.6	F80 I85	F80-L82 PolarHBondContact O-N 2.97Å; L82-I85 HydrophobicContact CB-CD1 4.21Å; L82-I85 HydrophobicContact CD2-CD1 3.59Å; L82-I85 HydrophobicContact CD2-CG1 4.39Å
83	R	58.6	Low	57.8	Low	238 Å²	238	128.3 Å²	128.3	90%	0.898	66%	0.658	S	S	*	*	G	3₁₀ helix	trans	-87.8	0.2	-177.8	-68.3	-172.2	177.1	-158.1	-0.6	114.2	S81	S81-R83 PolarHBondContact O-N 2.84Å
84	S	60	Low	58.1	Low	99 Å²	99	126.8 Å²	126.8	69%	0.692	65%	0.649	S	S	*	*	G	3₁₀ helix	trans	-134	38.2	175.9	66.5	0	0	0	0	112.6	D86	S84-D86 VanDerWaalsContact C-N 3.3Å; S84-D86 PolarHBondContact O-N 3Å
85	I	56	Low	58.5	Low	88 Å²	88	132.7 Å²	132.7	45%	0.451	66%	0.659	S	S	.	*			trans	-68.1	96.4	168.2	-66.4	167.3	0	0	0	107	L82	L82-I85 HydrophobicContact CB-CD1 4.21Å; L82-I85 HydrophobicContact CD2-CD1 3.59Å; L82-I85 HydrophobicContact CD2-CG1 4.39Å
86	D	62.6	Low	59.1	Low	121 Å²	121	131.6 Å²	131.6	65%	0.647	66%	0.655	S	S	*	*			trans	-58.2	150.9	168.2	-105.8	-35.1	0	0	0	109.7	S84 D88 T89	S84-D86 VanDerWaalsContact C-N 3.3Å; S84-D86 PolarHBondContact O-N 3Å; D86-D88 PolarHBondContact O-N 2.93Å; D86-T89 PolarHBondContact O-N 3.45Å; D86-T89 PolarHBondContact O-OG1 3.19Å
87	R	60.2	Low	59.8	Low	226 Å²	226	131.2 Å²	131.2	85%	0.853	66%	0.658	S	S	*	*	H	α-helix	trans	-50	-27.4	179.7	-97.7	-171.9	-179.3	176.8	1.2	113.2	C90	R87-C90 WeakPolarHBondContact O-CB 3.32Å; R87-C90 PolarHBondContact O-N 3.4Å
88	D	60.1	Low	60.2	Low	120 Å²	120	140.4 Å²	140.4	64%	0.642	69%	0.686	S	S	*	*	H	α-helix	trans	-72.5	-28.8	-178.9	-62.8	-21.6	0	0	0	113.2	D86 C90 Q91	D86-D88 PolarHBondContact O-N 2.93Å; D88-C90 VanDerWaalsContact C-N 3.26Å; D88-C90 PolarHBondContact O-N 3.34Å; D88-Q91 PolarHBondContact O-N 3.09Å
89	T	59.5	Low	60.3	Low	69 Å²	69	139.5 Å²	139.5	42%	0.423	68%	0.678	S	S	.	*	H	α-helix	trans	-73.9	-20.9	174.8	0.4	0	0	0	0	112.2	D86 Q91 C92 I93	D86-T89 PolarHBondContact O-N 3.45Å; D86-T89 PolarHBondContact O-OG1 3.19Å; T89-Q91 VanDerWaalsContact C-N 3.34Å; T89-C92 PolarHBondContact O-N 3.49Å; T89-I93 PolarHBondContact O-N 3.4Å
90	C	57.9	Low	60.6	Low	72 Å²	72	134.4 Å²	134.4	49%	0.486	67%	0.667	S	S	.	*	H	α-helix	trans	-69.3	-31.2	174.3	-161.7	0	0	0	0	112.1	R87 D88 I93 T94	R87-C90 WeakPolarHBondContact O-CB 3.32Å; R87-C90 PolarHBondContact O-N 3.4Å; D88-C90 VanDerWaalsContact C-N 3.26Å; D88-C90 PolarHBondContact O-N 3.34Å; C90-I93 PolarHBondContact O-N 3.44Å; C90-T94 PolarHBondContact O-N 3.32Å; C90-T94 VanDerWaalsContact O-N 3.09Å; C90-T94 PolarHBondContact O-OG1 2.93Å
91	Q	59.5	Low	60.8	Low	147 Å²	147	131.1 Å²	131.1	69%	0.687	66%	0.657	S	S	*	*	H	α-helix	trans	-67	-35.9	174.8	-69.5	-162.4	-2.9	0	0	112.3	D88 T89 I93 T94 Y95	D88-Q91 PolarHBondContact O-N 3.09Å; T89-Q91 VanDerWaalsContact C-N 3.34Å; Q91-I93 PolarHBondContact O-N 3.4Å; Q91-T94 PolarHBondContact O-N 3.42Å; Q91-Y95 PolarHBondContact O-N 2.9Å; Q91-Y95 VanDerWaalsContact O-N 3.14Å
92	C	62.3	Low	61.2	Low	81 Å²	81	134.2 Å²	134.2	55%	0.547	66%	0.663	S	S	.	*	H	α-helix	trans	-64.7	-38.4	176.1	-62.2	0	0	0	0	112.6	T89	T89-C92 PolarHBondContact O-N 3.49Å
93	I	62.3	Low	61.4	Low	92 Å²	92	133.9 Å²	133.9	47%	0.472	66%	0.659	S	S	.	*	H	α-helix	trans	-71.7	-37.1	177.4	-62.8	172.6	0	0	0	110.8	T89 C90 Q91 Y95 L96 L97	T89-I93 PolarHBondContact O-N 3.4Å; C90-I93 PolarHBondContact O-N 3.44Å; Q91-I93 PolarHBondContact O-N 3.4Å; I93-Y95 VanDerWaalsContact C-N 3.3Å; I93-Y95 PolarHBondContact O-N 3.35Å; I93-L96 PolarHBondContact O-N 2.74Å; I93-L97 HydrophobicContact CG2-CD1 4.17Å; I93-L97 PolarHBondContact O-N 3.14Å
94	T	57.5	Low	61.6	Low	74 Å²	74	126.9 Å²	126.9	45%	0.454	64%	0.643	S	S	.	*	H	α-helix	trans	-67.8	-29.6	179.7	-47.7	0	0	0	0	112.3	C90 Q91	C90-T94 PolarHBondContact O-N 3.32Å; C90-T94 VanDerWaalsContact O-N 3.09Å; C90-T94 PolarHBondContact O-OG1 2.93Å; Q91-T94 PolarHBondContact O-N 3.42Å
95	Y	65.1	Low	61.7	Low	190 Å²	190	128.9 Å²	128.9	75%	0.745	64%	0.639	S	S	*	*	H	α-helix	trans	-69.3	-30	173.8	-177.6	-102.2	0	0	0	113.1	Q91 I93	Q91-Y95 PolarHBondContact O-N 2.9Å; Q91-Y95 VanDerWaalsContact O-N 3.14Å; I93-Y95 VanDerWaalsContact C-N 3.3Å; I93-Y95 PolarHBondContact O-N 3.35Å
96	L	68	Low	62.1	Low	141 Å²	141	132.1 Å²	132.1	74%	0.738	65%	0.654	S	S	*	*	H	α-helix	trans	-82.2	-15.3	-179.1	-70.6	169.5	0	0	0	114	I93	I93-L96 PolarHBondContact O-N 2.74Å
97	L	70.1	Confident	62.1	Low	150 Å²	150	133 Å²	133	79%	0.785	65%	0.654	S	S	*	*			trans	-102.2	-3.6	-179.2	-68.3	172.5	0	0	0	113.5	I93	I93-L97 HydrophobicContact CG2-CD1 4.17Å; I93-L97 PolarHBondContact O-N 3.14Å
98	K	62.4	Low	62.3	Low	234 Å²	234	124.5 Å²	124.5	100%	1.017	64%	0.636	S	S	*	*			trans	-94.4	0	167.8	-80.7	-174.1	174.3	-179.6	0	109.9

Retrieved 98 of 98 residues in 117.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).