A0A077YXR9_TRITR Loading...

Small nuclear ribonucleoprotein Sm D2

AlphaFold DB , UniProt , Accession A0A077YXR9, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 122 aa.

						>A0A077YXR9_TRITR|A0A077YXR9
MASTLQKPKSEMTQEELTAKEEEEFSVGPLSILTNAMKHNTQVLISCRNNKKLLARVKAFDRHCNMVLEEVKEMWTELPKGGKNQKKGKPVNKDRFIAKMFIRGDAVIMVLKNPLEAASGGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.2	Very low	65.5	Low	255 Å²	255	129.7 Å²	129.7	100%	1.256	72%	0.719	S	S	*	*				0	98	0	-69.3	-167.1	-175.1	0	0	107.5
2	A	34.9	Very low	67.3	Low	94 Å²	94	121.8 Å²	121.8	78%	0.777	67%	0.673	S	S	*	*			trans	-122.8	144	-177.8	0	0	0	0	0	106.7
3	S	40.9	Very low	69.2	Low	116 Å²	116	118.2 Å²	118.2	81%	0.811	66%	0.657	S	S	*	*			trans	88.9	54.1	-175	78.5	0	0	0	0	117.4	L5	S3-L5 PolarHBondContact O-N 2.92Å
4	T	49.4	Very low	70.7	Confident	129 Å²	129	119.8 Å²	119.8	79%	0.791	66%	0.657	S	S	*	*			trans	-67.3	112	145.4	-0.2	0	0	0	0	106.8	Q6	T4-Q6 VanDerWaalsContact C-N 3.29Å; T4-Q6 PolarHBondContact O-N 3.24Å
5	L	53.5	Low	72.1	Confident	173 Å²	173	122.7 Å²	122.7	91%	0.906	66%	0.664	S	S	*	*			trans	-51.2	93.8	167.8	-77.9	125.4	0	0	0	108.6	S3 K7	S3-L5 PolarHBondContact O-N 2.92Å; L5-K7 PolarHBondContact O-N 2.8Å
6	Q	70.1	Confident	73.2	Confident	138 Å²	138	119.2 Å²	119.2	65%	0.645	64%	0.642	S	S	*	*			trans	-72.8	115.3	175.9	-67.7	-170.8	5.5	0	0	107	T4	T4-Q6 VanDerWaalsContact C-N 3.29Å; T4-Q6 PolarHBondContact O-N 3.24Å
7	K	81.2	Confident	74.3	Confident	106 Å²	106	115.1 Å²	115.1	46%	0.461	62%	0.62	S	S	.	*			trans	-46.1	137.8	166.8	-66.3	178.5	-175.3	170.6	0	108.8	L5 K9 M12 E16	L5-K7 PolarHBondContact O-N 2.8Å; K7-K9 PolarHBondContact O-N 2.8Å; K7-M12 HydrophobicContact CB-CE 4.07Å; K7-M12 HydrophobicContact CB-CG 4.2Å; K7-M12 WeakPolarHBondContact O-CE 3.36Å; K7-E16 IonicContact NZ-OE1 2.8Å; K7-E16 PolarHBondContact NZ-OE1 3.23Å; K7-E16 IonicContact NZ-OE2 3.84Å
8	P	86.3	Confident	75.2	Confident	60 Å²	60	111.9 Å²	111.9	39%	0.39	61%	0.605	S	S	.	*			trans	-59	143.4	175.7	25.7	-33	0	0	0	109.6	S10 E11	P8-S10 PolarHBondContact O-N 2.98Å; P8-E11 HydrophobicContact CG-CB 4.06Å; P8-E11 HydrophobicContact CG-CG 3.77Å; P8-E11 PolarHBondContact O-N 2.9Å
9	K	85.9	Confident	76.1	Confident	112 Å²	112	108.9 Å²	108.9	49%	0.487	60%	0.597	S	S	.	*	G	3₁₀ helix	trans	-56	-22.9	-178.2	-72.7	-169.2	175.7	-169.4	0	112.5	K7 E11 M12 L17 E24	K7-K9 PolarHBondContact O-N 2.8Å; K9-E11 VanDerWaalsContact C-N 3.32Å; K9-M12 HydrophobicContact CG-SD 4.47Å; K9-L17 HydrophobicContact CB-CD2 4.18Å; K9-L17 HydrophobicContact CG-CD2 4.34Å; K9-E24 IonicContact NZ-OE1 3.01Å; K9-E24 PolarHBondContact NZ-OE1 3.5Å; K9-E24 IonicContact NZ-OE2 3.57Å
10	S	89.4	Confident	76.7	Confident	108 Å²	108	104.9 Å²	104.9	76%	0.755	57%	0.573	S	S	*	*	G	3₁₀ helix	trans	-70.8	-20	175.9	51.1	0	0	0	0	115	P8	P8-S10 PolarHBondContact O-N 2.98Å
11	E	89.3	Confident	77.4	Confident	136 Å²	136	101.7 Å²	101.7	64%	0.636	56%	0.555	S	S	*	*	G	3₁₀ helix	trans	-107.3	-1.5	-177.6	-67.7	174.6	-167.2	0	0	112.9	P8 K9	P8-E11 HydrophobicContact CG-CB 4.06Å; P8-E11 HydrophobicContact CG-CG 3.77Å; P8-E11 PolarHBondContact O-N 2.9Å; K9-E11 VanDerWaalsContact C-N 3.32Å
12	M	87.4	Confident	79.9	Confident	34 Å²	34	95.8 Å²	95.8	17%	0.167	52%	0.524	C	S	.	.	S	Bend	trans	-80.1	143.5	179.6	-71.2	179.4	158.2	0	0	110.9	K7 K9 E16 L17 K20	K7-M12 HydrophobicContact CB-CE 4.07Å; K7-M12 HydrophobicContact CB-CG 4.2Å; K7-M12 WeakPolarHBondContact O-CE 3.36Å; K9-M12 HydrophobicContact CG-SD 4.47Å; M12-E16 WeakPolarHBondContact CA-OE2 3.35Å; M12-E16 HydrophobicContact CB-CB 4.04Å; M12-E16 HydrophobicContact CG-CB 4.41Å; M12-L17 HydrophobicContact CB-CD2 3.8Å; M12-L17 HydrophobicContact CB-CG 3.8Å; M12-L17 HydrophobicContact CG-CD2 4.47Å; M12-L17 HydrophobicContact SD-CD2 3.97Å; M12-K20 HydrophobicContact CE-CD 4Å; M12-K20 HydrophobicContact SD-CD 3.95Å
13	T	91.5	Very high	82.5	Confident	75 Å²	75	97.3 Å²	97.3	46%	0.46	52%	0.515	S	S	.	.			trans	-68.1	162.5	168.9	70	0	0	0	0	110.7	E15 E16 L17	T13-E15 PolarHBondContact O-N 2.92Å; T13-E16 PolarHBondContact N-OE2 2.96Å; T13-E16 PolarHBondContact O-N 3.18Å; T13-E16 WeakPolarHBondContact OG1-CG 3.38Å; T13-E16 PolarHBondContact OG1-N 3.01Å; T13-L17 WeakPolarHBondContact O-CG 3.4Å; T13-L17 PolarHBondContact O-N 3.26Å
14	Q	90.5	Very high	84.9	Confident	141 Å²	141	95.4 Å²	95.4	66%	0.659	49%	0.493	S	S	*	.	H	α-helix	trans	-59.8	-34.4	177.9	-172	58.2	40	0	0	112.4	T18	Q14-T18 PolarHBondContact O-N 3.07Å; Q14-T18 VanDerWaalsContact O-N 3.07Å; Q14-T18 PolarHBondContact O-OG1 3.21Å
15	E	91.8	Very high	87	Confident	163 Å²	163	91 Å²	91	76%	0.762	46%	0.463	S	S	*	.	H	α-helix	trans	-67.7	-46.1	175.7	-63.7	178	170.7	0	0	111.2	T13 L17 T18 A19	T13-E15 PolarHBondContact O-N 2.92Å; E15-L17 VanDerWaalsContact C-N 3.31Å; E15-L17 PolarHBondContact O-N 3.39Å; E15-T18 PolarHBondContact O-N 3.24Å; E15-A19 WeakPolarHBondContact O-CB 3.3Å; E15-A19 PolarHBondContact O-N 3.41Å
16	E	90.7	Very high	88.8	Confident	67 Å²	67	85.8 Å²	85.8	31%	0.313	44%	0.441	S	S	.	.	H	α-helix	trans	-60.5	-40	175	-73.8	177.3	135.6	0	0	111.5	K7 M12 T13 K20	K7-E16 IonicContact NZ-OE1 2.8Å; K7-E16 PolarHBondContact NZ-OE1 3.23Å; K7-E16 IonicContact NZ-OE2 3.84Å; M12-E16 WeakPolarHBondContact CA-OE2 3.35Å; M12-E16 HydrophobicContact CB-CB 4.04Å; M12-E16 HydrophobicContact CG-CB 4.41Å; T13-E16 PolarHBondContact N-OE2 2.96Å; T13-E16 PolarHBondContact O-N 3.18Å; T13-E16 WeakPolarHBondContact OG1-CG 3.38Å; T13-E16 PolarHBondContact OG1-N 3.01Å; E16-K20 VanDerWaalsContact O-CB 3.3Å; E16-K20 WeakPolarHBondContact O-CB 3.45Å; E16-K20 PolarHBondContact O-N 2.94Å
17	L	90.6	Very high	89.6	Confident	50 Å²	50	85 Å²	85	26%	0.262	45%	0.446	S	S	.	.	H	α-helix	trans	-64.5	-40.7	177.1	-73.4	174.2	0	0	0	112.5	K9 M12 T13 E15 E21	K9-L17 HydrophobicContact CB-CD2 4.18Å; K9-L17 HydrophobicContact CG-CD2 4.34Å; M12-L17 HydrophobicContact CB-CD2 3.8Å; M12-L17 HydrophobicContact CB-CG 3.8Å; M12-L17 HydrophobicContact CG-CD2 4.47Å; M12-L17 HydrophobicContact SD-CD2 3.97Å; T13-L17 WeakPolarHBondContact O-CG 3.4Å; T13-L17 PolarHBondContact O-N 3.26Å; E15-L17 VanDerWaalsContact C-N 3.31Å; E15-L17 PolarHBondContact O-N 3.39Å; L17-E21 PolarHBondContact O-N 2.88Å
18	T	91.5	Very high	90.1	Very high	57 Å²	57	80.9 Å²	80.9	35%	0.35	43%	0.434	S	S	.	.	H	α-helix	trans	-69.7	-45.3	179.9	-53.6	0	0	0	0	110.4	Q14 E15 K20 E21 E22	Q14-T18 PolarHBondContact O-N 3.07Å; Q14-T18 VanDerWaalsContact O-N 3.07Å; Q14-T18 PolarHBondContact O-OG1 3.21Å; E15-T18 PolarHBondContact O-N 3.24Å; T18-K20 VanDerWaalsContact C-N 3.31Å; T18-K20 PolarHBondContact O-N 3.24Å; T18-E21 PolarHBondContact O-N 3.44Å; T18-E21 VanDerWaalsContact O-N 3.14Å; T18-E22 WeakPolarHBondContact O-CG 3.45Å; T18-E22 PolarHBondContact O-N 3.4Å
19	A	91.1	Very high	90.5	Very high	56 Å²	56	83.7 Å²	83.7	46%	0.463	45%	0.452	S	S	.	.	H	α-helix	trans	-60.2	-41.1	175.6	0	0	0	0	0	112	E15 E22 E23	E15-A19 WeakPolarHBondContact O-CB 3.3Å; E15-A19 PolarHBondContact O-N 3.41Å; A19-E22 PolarHBondContact O-N 2.78Å; A19-E23 PolarHBondContact O-N 2.98Å
20	K	89.8	Confident	90.9	Very high	27 Å²	27	80.1 Å²	80.1	12%	0.117	44%	0.438	C	S	.	.	H	α-helix	trans	-63.8	-39.5	175	-176.3	170.9	-174.5	166.2	0	112.3	M12 E16 T18 E23 E24	M12-K20 HydrophobicContact CE-CD 4Å; M12-K20 HydrophobicContact SD-CD 3.95Å; E16-K20 VanDerWaalsContact O-CB 3.3Å; E16-K20 WeakPolarHBondContact O-CB 3.45Å; E16-K20 PolarHBondContact O-N 2.94Å; T18-K20 VanDerWaalsContact C-N 3.31Å; T18-K20 PolarHBondContact O-N 3.24Å; K20-E23 PolarHBondContact O-N 2.87Å; K20-E24 WeakPolarHBondContact CE-OE1 3.3Å; K20-E24 HydrophobicContact CG-CG 4.47Å; K20-E24 WeakPolarHBondContact O-CB 3.48Å; K20-E24 VanDerWaalsContact O-CG 3.3Å; K20-E24 WeakPolarHBondContact O-CG 3.17Å; K20-E24 PolarHBondContact O-N 2.71Å
21	E	90.9	Very high	91.1	Very high	39 Å²	39	76.2 Å²	76.2	18%	0.182	41%	0.41	C	S	.	.	H	α-helix	trans	-65.4	-42.7	176.3	177.2	166.9	-141.9	0	0	111.8	L17 T18 E23 E24 F25 R62	L17-E21 PolarHBondContact O-N 2.88Å; T18-E21 PolarHBondContact O-N 3.44Å; T18-E21 VanDerWaalsContact O-N 3.14Å; E21-E23 VanDerWaalsContact C-N 3.32Å; E21-E23 PolarHBondContact O-N 3.14Å; E21-E24 PolarHBondContact O-N 2.64Å; E21-F25 HydrophobicContact CG-CD2 3.98Å; E21-F25 HydrophobicContact CG-CE1 4.02Å; E21-F25 HydrophobicContact CG-CE2 3.4Å; E21-F25 HydrophobicContact CG-CZ 3.43Å; E21-F25 VanDerWaalsContact CG-CZ 3.43Å; E21-F25 WeakPolarHBondContact O-CB 3.42Å; E21-F25 VanDerWaalsContact O-CG 3.24Å; E21-F25 WeakPolarHBondContact O-CG 3.47Å; E21-F25 PolarHBondContact O-N 3.02Å; E21-F25 WeakPolarHBondContact OE1-CZ 3.24Å; E21-R62 WeakPolarHBondContact OE1-CB 3.26Å; E21-R62 IonicContact OE1-CZ 3.69Å; E21-R62 IonicContact OE1-NH1 2.64Å; E21-R62 PolarHBondContact OE1-NH1 3.13Å; E21-R62 IonicContact OE2-CZ 3.99Å; E21-R62 IonicContact OE2-NH1 2.71Å; E21-R62 PolarHBondContact OE2-NH1 3.09Å
22	E	90.6	Very high	91.3	Very high	130 Å²	130	73.6 Å²	73.6	61%	0.607	40%	0.4	S	S	*	.	H	α-helix	trans	-62.4	-38.3	174.5	-70.3	180	-177.6	0	0	112.4	T18 A19 F25 S26	T18-E22 WeakPolarHBondContact O-CG 3.45Å; T18-E22 PolarHBondContact O-N 3.4Å; A19-E22 PolarHBondContact O-N 2.78Å; E22-F25 PolarHBondContact O-N 2.97Å; E22-S26 WeakPolarHBondContact O-CB 3.5Å; E22-S26 PolarHBondContact O-N 3.05Å; E22-S26 PolarHBondContact O-OG 3.28Å
23	E	90.8	Very high	91.6	Very high	127 Å²	127	72.3 Å²	72.3	59%	0.593	39%	0.393	S	S	*	.	H	α-helix	trans	-64.5	-47.4	172.2	-168.6	-176.9	-176.5	0	0	111.3	A19 K20 E21 F25 S26 V27	A19-E23 PolarHBondContact O-N 2.98Å; K20-E23 PolarHBondContact O-N 2.87Å; E21-E23 VanDerWaalsContact C-N 3.32Å; E21-E23 PolarHBondContact O-N 3.14Å; E23-F25 PolarHBondContact O-N 3.2Å; E23-S26 WeakPolarHBondContact CA-OG 3.36Å; E23-S26 PolarHBondContact O-N 3.01Å; E23-S26 PolarHBondContact O-OG 3.39Å; E23-S26 VanDerWaalsContact O-OG 3.05Å; E23-V27 PolarHBondContact O-N 3.43Å
24	E	90.1	Very high	91.7	Very high	76 Å²	76	69.3 Å²	69.3	36%	0.355	38%	0.375	S	S	.	.	H	α-helix	trans	-58.2	-36.3	176.3	-76.5	175.7	-177.1	0	0	111.3	K9 K20 E21 G28	K9-E24 IonicContact NZ-OE1 3.01Å; K9-E24 PolarHBondContact NZ-OE1 3.5Å; K9-E24 IonicContact NZ-OE2 3.57Å; K20-E24 WeakPolarHBondContact CE-OE1 3.3Å; K20-E24 HydrophobicContact CG-CG 4.47Å; K20-E24 WeakPolarHBondContact O-CB 3.48Å; K20-E24 VanDerWaalsContact O-CG 3.3Å; K20-E24 WeakPolarHBondContact O-CG 3.17Å; K20-E24 PolarHBondContact O-N 2.71Å; E21-E24 PolarHBondContact O-N 2.64Å; E24-G28 WeakPolarHBondContact O-CA 3.35Å; E24-G28 PolarHBondContact O-N 3.05Å
25	F	93.3	Very high	91.8	Very high	35 Å²	35	65.7 Å²	65.7	15%	0.154	36%	0.36	C	S	.	.	H	α-helix	trans	-76.8	-24	175.9	-67.5	-14.2	0	0	0	114.3	E21 E22 E23 L30 S31 T34 F60 R62	E21-F25 HydrophobicContact CG-CD2 3.98Å; E21-F25 HydrophobicContact CG-CE1 4.02Å; E21-F25 HydrophobicContact CG-CE2 3.4Å; E21-F25 HydrophobicContact CG-CZ 3.43Å; E21-F25 VanDerWaalsContact CG-CZ 3.43Å; E21-F25 WeakPolarHBondContact O-CB 3.42Å; E21-F25 VanDerWaalsContact O-CG 3.24Å; E21-F25 WeakPolarHBondContact O-CG 3.47Å; E21-F25 PolarHBondContact O-N 3.02Å; E21-F25 WeakPolarHBondContact OE1-CZ 3.24Å; E22-F25 PolarHBondContact O-N 2.97Å; E23-F25 PolarHBondContact O-N 3.2Å; F25-L30 HydrophobicContact CD1-CB 4.1Å; F25-L30 HydrophobicContact CD1-CD1 3.68Å; F25-L30 HydrophobicContact CE1-CD1 3.53Å; F25-S31 WeakPolarHBondContact O-CA 3.1Å; F25-S31 PolarHBondContact O-N 3.15Å; F25-T34 WeakPolarHBondContact O-CB 3.38Å; F25-T34 PolarHBondContact O-OG1 2.89Å; F25-F60 HydrophobicContact CB-CZ 4.24Å; F25-F60 AromaticContact CD1-CE2 3.78Å; F25-F60 HydrophobicContact CD1-CE2 3.78Å; F25-F60 HydrophobicContact CD1-CZ 4.31Å; F25-F60 HydrophobicContact CD2-CE2 4.24Å; F25-F60 HydrophobicContact CD2-CZ 4.25Å; F25-F60 AromaticContact CE1-CE2 3.96Å; F25-F60 HydrophobicContact CE1-CE2 3.96Å; F25-F60 HydrophobicContact CE2-CE2 4.38Å; F25-F60 AromaticContact CG-CE2 3.94Å; F25-F60 HydrophobicContact CG-CE2 3.94Å; F25-F60 HydrophobicContact CG-CZ 4.02Å; F25-F60 HydrophobicContact CZ-CE2 4.25Å; F25-R62 HydrophobicContact CE1-CB 4.21Å; F25-R62 HydrophobicContact CZ-CB 4.14Å
26	S	91.3	Very high	91.9	Very high	64 Å²	64	57.9 Å²	57.9	45%	0.448	32%	0.324	S	S	.	.	H	α-helix	trans	-94.3	-37.8	-177.4	52.8	0	0	0	0	113	E22 E23 S31	E22-S26 WeakPolarHBondContact O-CB 3.5Å; E22-S26 PolarHBondContact O-N 3.05Å; E22-S26 PolarHBondContact O-OG 3.28Å; E23-S26 WeakPolarHBondContact CA-OG 3.36Å; E23-S26 PolarHBondContact O-N 3.01Å; E23-S26 PolarHBondContact O-OG 3.39Å; E23-S26 VanDerWaalsContact O-OG 3.05Å; S26-S31 VanDerWaalsContact O-CB 3.26Å; S26-S31 WeakPolarHBondContact O-CB 3.04Å
27	V	88.4	Confident	92	Very high	122 Å²	122	58 Å²	58	74%	0.739	33%	0.325	S	S	*	.	H	α-helix	trans	-117.4	1.7	-172.1	-170.2	0	0	0	0	112.9	E23	E23-V27 PolarHBondContact O-N 3.43Å
28	G	91	Very high	92	Very high	20 Å²	20	62.6 Å²	62.6	21%	0.206	34%	0.343	C	S	.	.	S	Bend	trans	-102.1	-170.9	179.3	0	0	0	0	0	115.8	E24 L30 S31	E24-G28 WeakPolarHBondContact O-CA 3.35Å; E24-G28 PolarHBondContact O-N 3.05Å; G28-L30 PolarHBondContact O-N 2.84Å; G28-S31 WeakPolarHBondContact O-CB 3.38Å; G28-S31 PolarHBondContact O-N 2.82Å; G28-S31 PolarHBondContact O-OG 2.82Å
29	P	94	Very high	92	Very high	118 Å²	118	65.7 Å²	65.7	77%	0.766	35%	0.353	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.2	-30.8	174.6	-25.2	34.7	0	0	0	113.8	S31	P29-S31 PolarHBondContact O-N 3.45Å
30	L	94.7	Very high	92.1	Very high	38 Å²	38	66.1 Å²	66.1	20%	0.199	35%	0.348	C	S	.	.	T	Hydrogen-bonded Turn	trans	-73.7	-10.5	177.6	-63.2	179.3	0	0	0	113.2	F25 G28 I32 L33 T34 F60	F25-L30 HydrophobicContact CD1-CB 4.1Å; F25-L30 HydrophobicContact CD1-CD1 3.68Å; F25-L30 HydrophobicContact CE1-CD1 3.53Å; G28-L30 PolarHBondContact O-N 2.84Å; L30-I32 PolarHBondContact O-N 3.29Å; L30-I32 VanDerWaalsContact O-N 3.08Å; L30-L33 HydrophobicContact CD2-CD1 4.07Å; L30-L33 WeakPolarHBondContact O-CB 3.3Å; L30-L33 PolarHBondContact O-N 3.32Å; L30-T34 PolarHBondContact O-N 2.86Å; L30-F60 HydrophobicContact CB-CE2 4.23Å
31	S	93.8	Very high	92.2	Very high	25 Å²	25	65.1 Å²	65.1	18%	0.175	34%	0.344	C	S	.	.	H	α-helix	trans	-56.2	-26.1	173.4	66.6	0	0	0	0	113.1	F25 S26 G28 P29 L33 T34 N35	F25-S31 WeakPolarHBondContact O-CA 3.1Å; F25-S31 PolarHBondContact O-N 3.15Å; S26-S31 VanDerWaalsContact O-CB 3.26Å; S26-S31 WeakPolarHBondContact O-CB 3.04Å; G28-S31 WeakPolarHBondContact O-CB 3.38Å; G28-S31 PolarHBondContact O-N 2.82Å; G28-S31 PolarHBondContact O-OG 2.82Å; P29-S31 PolarHBondContact O-N 3.45Å; S31-L33 VanDerWaalsContact C-N 3.31Å; S31-L33 PolarHBondContact O-N 3.47Å; S31-T34 PolarHBondContact O-N 3.03Å; S31-N35 VanDerWaalsContact O-CB 3.29Å; S31-N35 WeakPolarHBondContact O-CB 3.37Å; S31-N35 PolarHBondContact O-N 3.1Å; S31-N35 PolarHBondContact O-ND2 2.64Å
32	I	93	Very high	92.4	Very high	81 Å²	81	65.5 Å²	65.5	42%	0.415	35%	0.346	S	S	.	.	H	α-helix	trans	-59.6	-42.6	173.5	-62.1	172.1	0	0	0	110.8	L30 A36 K112	L30-I32 PolarHBondContact O-N 3.29Å; L30-I32 VanDerWaalsContact O-N 3.08Å; I32-A36 WeakPolarHBondContact O-CB 3.27Å; I32-A36 PolarHBondContact O-N 3.19Å; I32-K112 HydrophobicContact CG2-CB 4.13Å
33	L	94.8	Very high	92.6	Very high	7 Å²	7	59.3 Å²	59.3	4%	0.037	32%	0.317	C	S	.	.	H	α-helix	trans	-72.8	-41.5	177.5	-67.5	172.5	0	0	0	111.5	L30 S31 N35 A36 M37 V57 F60 M66 V110	L30-L33 HydrophobicContact CD2-CD1 4.07Å; L30-L33 WeakPolarHBondContact O-CB 3.3Å; L30-L33 PolarHBondContact O-N 3.32Å; S31-L33 VanDerWaalsContact C-N 3.31Å; S31-L33 PolarHBondContact O-N 3.47Å; L33-N35 VanDerWaalsContact C-N 3.3Å; L33-N35 PolarHBondContact O-N 2.74Å; L33-A36 PolarHBondContact O-N 3Å; L33-A36 VanDerWaalsContact O-N 3.13Å; L33-M37 WeakPolarHBondContact O-CB 3.43Å; L33-M37 PolarHBondContact O-N 3.22Å; L33-V57 HydrophobicContact CD2-CG2 4.18Å; L33-F60 HydrophobicContact CB-CD1 3.91Å; L33-F60 HydrophobicContact CB-CD2 4.19Å; L33-F60 HydrophobicContact CB-CE1 4.01Å; L33-F60 HydrophobicContact CB-CE2 4.28Å; L33-F60 HydrophobicContact CB-CG 4.01Å; L33-F60 HydrophobicContact CB-CZ 4.21Å; L33-F60 HydrophobicContact CD1-CB 4.29Å; L33-F60 HydrophobicContact CD1-CD2 3.92Å; L33-F60 HydrophobicContact CD1-CG 4.07Å; L33-M66 HydrophobicContact CD1-CE 3.46Å; L33-M66 VanDerWaalsContact CD1-CE 3.46Å; L33-M66 HydrophobicContact CD1-SD 4.41Å; L33-M66 HydrophobicContact CD2-CE 3.77Å; L33-M66 HydrophobicContact CD2-SD 3.9Å; L33-M66 HydrophobicContact CG-CE 4.27Å; L33-V110 HydrophobicContact CD2-CG1 3.91Å
34	T	94.1	Very high	92.9	Very high	13 Å²	13	55.8 Å²	55.8	8%	0.08	30%	0.302	C	S	.	.	H	α-helix	trans	-55.4	-48	173.1	-57.5	0	0	0	0	111.1	F25 L30 S31 M37 K38 F60	F25-T34 WeakPolarHBondContact O-CB 3.38Å; F25-T34 PolarHBondContact O-OG1 2.89Å; L30-T34 PolarHBondContact O-N 2.86Å; S31-T34 PolarHBondContact O-N 3.03Å; T34-M37 PolarHBondContact O-N 2.87Å; T34-K38 HydrophobicContact CG2-CD 4.15Å; T34-K38 WeakPolarHBondContact O-CB 3.44Å; T34-K38 VanDerWaalsContact O-CG 3.32Å; T34-K38 WeakPolarHBondContact O-CG 3.33Å; T34-K38 PolarHBondContact O-N 2.91Å; T34-F60 VanDerWaalsContact OG1-CZ 3.26Å; T34-F60 WeakPolarHBondContact OG1-CZ 3.41Å
35	N	92.3	Very high	93.3	Very high	64 Å²	64	52.1 Å²	52.1	34%	0.342	29%	0.285	S	S	.	.	H	α-helix	trans	-65.2	-40.3	176.9	-71.3	-33	0	0	0	111.4	S31 L33 H39	S31-N35 VanDerWaalsContact O-CB 3.29Å; S31-N35 WeakPolarHBondContact O-CB 3.37Å; S31-N35 PolarHBondContact O-N 3.1Å; S31-N35 PolarHBondContact O-ND2 2.64Å; L33-N35 VanDerWaalsContact C-N 3.3Å; L33-N35 PolarHBondContact O-N 2.74Å; N35-H39 WeakPolarHBondContact O-CB 3.45Å; N35-H39 PolarHBondContact O-CD2 3.2Å; N35-H39 PolarHBondContact O-N 3.35Å; N35-H39 VanDerWaalsContact O-N 3.09Å
36	A	92.8	Very high	93.5	Very high	0 Å²	0	51.9 Å²	51.9	0%	0	29%	0.287	C	S	.	.	H	α-helix	trans	-64.8	-40.2	178.2	0	0	0	0	0	112.7	I32 L33 N40 T41 V43	I32-A36 WeakPolarHBondContact O-CB 3.27Å; I32-A36 PolarHBondContact O-N 3.19Å; L33-A36 PolarHBondContact O-N 3Å; L33-A36 VanDerWaalsContact O-N 3.13Å; A36-N40 CarbonylContact O-C 3.45Å; A36-N40 WeakPolarHBondContact O-CA 3.12Å; A36-N40 PolarHBondContact O-N 3.43Å; A36-T41 VanDerWaalsContact CA-OG1 3.24Å; A36-T41 WeakPolarHBondContact CA-OG1 3.32Å; A36-T41 PolarHBondContact O-N 3.16Å; A36-V43 HydrophobicContact CB-CG1 3.57Å
37	M	92.5	Very high	93.8	Very high	69 Å²	69	49.1 Å²	49.1	34%	0.34	27%	0.268	S	S	.	.	H	α-helix	trans	-66.7	-48.5	176.1	-177.3	-173.4	70.9	0	0	111.5	L33 T34 H39 N40 K58 F60	L33-M37 WeakPolarHBondContact O-CB 3.43Å; L33-M37 PolarHBondContact O-N 3.22Å; T34-M37 PolarHBondContact O-N 2.87Å; M37-H39 PolarHBondContact O-N 3.08Å; M37-N40 PolarHBondContact O-N 2.67Å; M37-N40 VanDerWaalsContact O-N 3.15Å; M37-K58 VanDerWaalsContact SD-O 3.4Å; M37-F60 HydrophobicContact CE-CE1 4.49Å; M37-F60 HydrophobicContact SD-CD1 4.44Å; M37-F60 HydrophobicContact SD-CE1 4.47Å
38	K	92.2	Very high	94.2	Very high	146 Å²	146	52.6 Å²	52.6	64%	0.635	27%	0.268	S	S	*	.	H	α-helix	trans	-60.4	-41.5	-179.7	-76.6	179.1	179.7	179.8	0	113	T34 N40	T34-K38 HydrophobicContact CG2-CD 4.15Å; T34-K38 WeakPolarHBondContact O-CB 3.44Å; T34-K38 VanDerWaalsContact O-CG 3.32Å; T34-K38 WeakPolarHBondContact O-CG 3.33Å; T34-K38 PolarHBondContact O-N 2.91Å; K38-N40 VanDerWaalsContact C-N 3.33Å
39	H	91.5	Very high	94.3	Very high	123 Å²	123	56.4 Å²	56.4	57%	0.569	28%	0.283	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.4	4.9	179.9	-62	-65.3	0	0	0	113.1	N35 M37 T41	N35-H39 WeakPolarHBondContact O-CB 3.45Å; N35-H39 PolarHBondContact O-CD2 3.2Å; N35-H39 PolarHBondContact O-N 3.35Å; N35-H39 VanDerWaalsContact O-N 3.09Å; M37-H39 PolarHBondContact O-N 3.08Å; H39-T41 HydrophobicContact CB-CG2 3.59Å; H39-T41 PolarHBondContact O-N 2.82Å; H39-T41 VanDerWaalsContact O-N 3.08Å
40	N	91.8	Very high	94.3	Very high	64 Å²	64	57.6 Å²	57.6	34%	0.342	28%	0.283	S	S	.	.	T	Hydrogen-bonded Turn	trans	49.4	32.7	-174.3	-169.1	52.1	0	0	0	112.5	A36 M37 K38 R56 K58	A36-N40 CarbonylContact O-C 3.45Å; A36-N40 WeakPolarHBondContact O-CA 3.12Å; A36-N40 PolarHBondContact O-N 3.43Å; M37-N40 PolarHBondContact O-N 2.67Å; M37-N40 VanDerWaalsContact O-N 3.15Å; K38-N40 VanDerWaalsContact C-N 3.33Å; N40-R56 WeakPolarHBondContact O-CD 3.43Å; N40-R56 PolarHBondContact O-NH1 3.1Å; N40-K58 PolarHBondContact OD1-NZ 3.32Å
41	T	92.7	Very high	94.4	Very high	6 Å²	6	58 Å²	58	4%	0.037	28%	0.283	C	S	.	.			trans	-79.5	149	-172.9	61.7	0	0	0	0	112	A36 H39 E116	A36-T41 VanDerWaalsContact CA-OG1 3.24Å; A36-T41 WeakPolarHBondContact CA-OG1 3.32Å; A36-T41 PolarHBondContact O-N 3.16Å; H39-T41 HydrophobicContact CB-CG2 3.59Å; H39-T41 PolarHBondContact O-N 2.82Å; H39-T41 VanDerWaalsContact O-N 3.08Å; T41-E116 VanDerWaalsContact CA-OE2 3.27Å; T41-E116 WeakPolarHBondContact CA-OE2 3.26Å; T41-E116 HydrophobicContact CG2-CB 4.21Å
42	Q	94.3	Very high	94.5	Very high	48 Å²	48	61.9 Å²	61.9	22%	0.224	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-65	141.4	172.4	-64.9	-173.4	-37.2	0	0	112.5	L54 A55 R56 N113 E116	Q42-L54 HydrophobicContact CB-CD1 4.38Å; Q42-A55 WeakPolarHBondContact CA-O 3.34Å; Q42-R56 HydrophobicContact CG-CG 4.13Å; Q42-N113 HydrophobicContact CB-CB 4.2Å; Q42-N113 VanDerWaalsContact O-CB 3.24Å; Q42-N113 WeakPolarHBondContact O-CB 3.43Å; Q42-N113 PolarHBondContact O-N 2.88Å; Q42-E116 PolarHBondContact N-OE2 2.94Å
43	V	96.1	Very high	94.8	Very high	0 Å²	0	58.3 Å²	58.3	0%	0	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.2	143.4	172.6	-60.5	0	0	0	0	110.4	A36 I45 L54 A55 V57 V110 L111	A36-V43 HydrophobicContact CB-CG1 3.57Å; V43-I45 HydrophobicContact CG2-CD1 4.08Å; V43-I45 HydrophobicContact CG2-CG1 3.99Å; V43-L54 WeakPolarHBondContact O-CA 3.2Å; V43-A55 WeakPolarHBondContact CG2-O 3.29Å; V43-A55 PolarHBondContact N-O 3.35Å; V43-A55 PolarHBondContact O-N 3.41Å; V43-V57 HydrophobicContact CG1-CG2 4.29Å; V43-V57 HydrophobicContact CG2-CG2 3.55Å; V43-V110 HydrophobicContact CB-CG1 4.2Å; V43-L111 CarbonylContact C-O 3.55Å; V43-L111 WeakPolarHBondContact CA-O 3.44Å
44	L	96.6	Very high	94.9	Very high	52 Å²	52	60.1 Å²	60.1	27%	0.272	29%	0.288	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	119.6	168.3	-176.8	72	0	0	0	108.9	K52 L53 L54 M74 L111	L44-K52 HydrophobicContact CD1-CB 4.16Å; L44-L53 CarbonylContact C-O 3.56Å; L44-L53 WeakPolarHBondContact CA-O 3.18Å; L44-L54 HydrophobicContact CB-CD1 4.46Å; L44-L54 HydrophobicContact CD1-CB 4.48Å; L44-L54 HydrophobicContact CD1-CD1 4.47Å; L44-M74 HydrophobicContact CD1-CE 4.19Å; L44-L111 HydrophobicContact CB-CB 4.42Å; L44-L111 PolarHBondContact N-O 2.92Å; L44-L111 PolarHBondContact O-N 2.96Å
45	I	97.4	Very high	95	Very high	0 Å²	0	59.6 Å²	59.6	0%	0	29%	0.285	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.5	123	179.6	-55	172.4	0	0	0	108.1	V43 K52 L53 M66 L68 V107 M109 V110	V43-I45 HydrophobicContact CG2-CD1 4.08Å; V43-I45 HydrophobicContact CG2-CG1 3.99Å; I45-K52 CarbonylContact O-C 3.52Å; I45-K52 VanDerWaalsContact O-CA 3.31Å; I45-K52 WeakPolarHBondContact O-CA 3.36Å; I45-L53 HydrophobicContact CB-CB 4.2Å; I45-L53 PolarHBondContact N-O 3.04Å; I45-L53 PolarHBondContact O-N 2.94Å; I45-M66 HydrophobicContact CD1-SD 4Å; I45-L68 HydrophobicContact CD1-CD1 3.73Å; I45-L68 HydrophobicContact CD1-CD2 3.87Å; I45-L68 HydrophobicContact CD1-CG 4.46Å; I45-V107 HydrophobicContact CG2-CB 4.42Å; I45-V107 HydrophobicContact CG2-CG1 3.86Å; I45-V107 HydrophobicContact CG2-CG2 3.91Å; I45-M109 WeakPolarHBondContact CA-O 3.16Å; I45-V110 HydrophobicContact CG1-CG1 4.43Å; I45-V110 HydrophobicContact CG1-CG2 4.45Å
46	S	97.5	Very high	95.2	Very high	29 Å²	29	58.4 Å²	58.4	20%	0.203	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.2	123.2	172.3	-167.3	0	0	0	0	109.7	I108 M109	S46-I108 PolarHBondContact O-N 2.66Å; S46-M109 PolarHBondContact N-O 2.93Å; S46-M109 PolarHBondContact O-N 2.93Å
47	C	97.5	Very high	95.4	Very high	6 Å²	6	58.4 Å²	58.4	4%	0.041	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.8	157.6	-176.5	-59.7	0	0	0	0	112.2	N49 N50 K51 A106	C47-N49 VanDerWaalsContact CB-OD1 3.26Å; C47-N49 WeakPolarHBondContact CB-OD1 3.17Å; C47-N49 PolarHBondContact O-N 3.48Å; C47-N50 PolarHBondContact O-N 2.79Å; C47-N50 VanDerWaalsContact O-N 3.11Å; C47-K51 WeakPolarHBondContact CB-O 3.42Å; C47-K51 PolarHBondContact N-O 2.88Å; C47-A106 CarbonylContact C-O 3.55Å; C47-A106 WeakPolarHBondContact CA-O 3.31Å
48	R	96.9	Very high	95.6	Very high	195 Å²	195	59.3 Å²	59.3	74%	0.736	28%	0.278	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.2	-22	-178.6	-166.7	171	-176.3	169.3	0.9	114.8	N50 A106 I108	R48-N50 PolarHBondContact O-N 3.2Å; R48-A106 PolarHBondContact N-O 3.38Å; R48-I108 HydrophobicContact CB-CD1 4.24Å; R48-I108 HydrophobicContact CB-CG1 4.36Å
49	N	94.5	Very high	95.8	Very high	100 Å²	100	54.4 Å²	54.4	54%	0.535	27%	0.265	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.8	18.8	175.8	63.5	-2.4	0	0	0	113.3	C47 K51	C47-N49 VanDerWaalsContact CB-OD1 3.26Å; C47-N49 WeakPolarHBondContact CB-OD1 3.17Å; C47-N49 PolarHBondContact O-N 3.48Å; N49-K51 PolarHBondContact O-N 2.87Å; N49-K51 WeakPolarHBondContact OD1-CB 3.48Å; N49-K51 WeakPolarHBondContact OD1-CG 3.26Å; N49-K51 PolarHBondContact OD1-N 3.11Å
50	N	93.2	Very high	96.1	Very high	144 Å²	144	50 Å²	50	77%	0.77	24%	0.244	S	C	*	.	S	Bend	trans	59.9	19.9	-176.7	-66	-32.8	0	0	0	114.8	C47 R48	C47-N50 PolarHBondContact O-N 2.79Å; C47-N50 VanDerWaalsContact O-N 3.11Å; R48-N50 PolarHBondContact O-N 3.2Å
51	K	96.4	Very high	96.2	Very high	45 Å²	45	49.2 Å²	49.2	20%	0.196	24%	0.24	C	C	.	.			trans	-96.2	153.4	169.6	-53.3	-164.3	-178.1	-174.7	0	110.4	C47 N49 E73 W75	C47-K51 WeakPolarHBondContact CB-O 3.42Å; C47-K51 PolarHBondContact N-O 2.88Å; N49-K51 PolarHBondContact O-N 2.87Å; N49-K51 WeakPolarHBondContact OD1-CB 3.48Å; N49-K51 WeakPolarHBondContact OD1-CG 3.26Å; N49-K51 PolarHBondContact OD1-N 3.11Å; K51-E73 HydrophobicContact CB-CG 4.48Å; K51-E73 HydrophobicContact CD-CG 4.16Å; K51-E73 WeakPolarHBondContact CD-OE1 3.36Å; K51-E73 WeakPolarHBondContact CE-OE1 3.49Å; K51-E73 IonicContact NZ-OE1 3.89Å; K51-E73 PolarHBondContact NZ-OE1 3.49Å; K51-W75 HydrophobicContact CB-CB 4.33Å; K51-W75 HydrophobicContact CD-CB 4.14Å; K51-W75 HydrophobicContact CD-CD2 4.45Å; K51-W75 HydrophobicContact CD-CE3 4.42Å; K51-W75 HydrophobicContact CD-CG 4.36Å; K51-W75 HydrophobicContact CG-CB 3.77Å; K51-W75 HydrophobicContact CG-CG 4.47Å
52	K	97.4	Very high	96.3	Very high	108 Å²	108	55.9 Å²	55.9	47%	0.47	26%	0.264	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.9	139.2	175.9	-61.5	-178.5	-177.9	-179.9	0	109.5	L44 I45 E73 M74	L44-K52 HydrophobicContact CD1-CB 4.16Å; I45-K52 CarbonylContact O-C 3.52Å; I45-K52 VanDerWaalsContact O-CA 3.31Å; I45-K52 WeakPolarHBondContact O-CA 3.36Å; K52-E73 CarbonylContact O-C 3.43Å; K52-E73 WeakPolarHBondContact O-CA 3.15Å; K52-M74 PolarHBondContact N-O 2.87Å; K52-M74 PolarHBondContact O-N 3.43Å
53	L	97.8	Very high	96.4	Very high	5 Å²	5	59.3 Å²	59.3	3%	0.026	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	125	173.7	-50.6	177.8	0	0	0	108.3	L44 I45 L68 V71 K72 E73 M100 I102	L44-L53 CarbonylContact C-O 3.56Å; L44-L53 WeakPolarHBondContact CA-O 3.18Å; I45-L53 HydrophobicContact CB-CB 4.2Å; I45-L53 PolarHBondContact N-O 3.04Å; I45-L53 PolarHBondContact O-N 2.94Å; L53-L68 HydrophobicContact CD1-CD1 4.04Å; L53-V71 HydrophobicContact CB-CG1 4.11Å; L53-V71 HydrophobicContact CD1-CG1 4.49Å; L53-V71 HydrophobicContact CD2-CG1 3.98Å; L53-V71 HydrophobicContact CG-CG1 4.43Å; L53-K72 WeakPolarHBondContact CA-O 3.48Å; L53-E73 HydrophobicContact CD2-CB 3.46Å; L53-E73 VanDerWaalsContact CD2-CB 3.46Å; L53-E73 HydrophobicContact CD2-CG 3.51Å; L53-M100 HydrophobicContact CD1-SD 3.9Å; L53-I102 HydrophobicContact CD1-CD1 3.65Å
54	L	97	Very high	96.4	Very high	46 Å²	46	61.1 Å²	61.1	24%	0.241	29%	0.292	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.3	117.7	163.1	-175.4	71.4	0	0	0	107	Q42 V43 L44 K72 M74	Q42-L54 HydrophobicContact CB-CD1 4.38Å; V43-L54 WeakPolarHBondContact O-CA 3.2Å; L44-L54 HydrophobicContact CB-CD1 4.46Å; L44-L54 HydrophobicContact CD1-CB 4.48Å; L44-L54 HydrophobicContact CD1-CD1 4.47Å; L54-K72 HydrophobicContact CB-CB 4.36Å; L54-K72 PolarHBondContact N-O 2.84Å; L54-K72 PolarHBondContact O-N 3Å; L54-M74 HydrophobicContact CB-CE 3.85Å
55	A	97	Very high	96.4	Very high	1 Å²	1	59.8 Å²	59.8	1%	0.008	29%	0.285	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.6	170.9	-170.8	0	0	0	0	0	112	Q42 V43 L68 V71	Q42-A55 WeakPolarHBondContact CA-O 3.34Å; V43-A55 WeakPolarHBondContact CG2-O 3.29Å; V43-A55 PolarHBondContact N-O 3.35Å; V43-A55 PolarHBondContact O-N 3.41Å; A55-L68 HydrophobicContact CB-CB 4.06Å; A55-L68 HydrophobicContact CB-CD1 4.07Å; A55-L68 HydrophobicContact CB-CD2 4.22Å; A55-L68 HydrophobicContact CB-CG 4.35Å; A55-V71 HydrophobicContact CB-CB 4.29Å; A55-V71 HydrophobicContact CB-CG1 4.25Å; A55-V71 HydrophobicContact CB-CG2 3.83Å
56	R	96.3	Very high	96.4	Very high	39 Å²	39	59.8 Å²	59.8	15%	0.147	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	133.7	166.4	-61.1	-177.7	-170.8	-79.7	-3.5	109.3	N40 Q42 L68 E69 E70 E116	N40-R56 WeakPolarHBondContact O-CD 3.43Å; N40-R56 PolarHBondContact O-NH1 3.1Å; Q42-R56 HydrophobicContact CG-CG 4.13Å; R56-L68 WeakPolarHBondContact O-CA 3.44Å; R56-E69 PolarHBondContact N-O 2.78Å; R56-E69 PolarHBondContact O-N 3.26Å; R56-E70 WeakPolarHBondContact CD-OE2 3.31Å; R56-E70 IonicContact NE-OE2 3.09Å; R56-E70 PolarHBondContact NE-OE2 2.82Å; R56-E70 VanDerWaalsContact NE-OE2 3.09Å; R56-E116 IonicContact CZ-OE1 3.21Å; R56-E116 IonicContact CZ-OE2 2.66Å; R56-E116 IonicContact NH1-OE1 2.9Å; R56-E116 PolarHBondContact NH1-OE1 3.36Å; R56-E116 IonicContact NH1-OE2 2.93Å; R56-E116 PolarHBondContact NH1-OE2 3.12Å; R56-E116 IonicContact NH2-OE1 3.95Å; R56-E116 PolarHBondContact NH2-OE1 3.43Å
57	V	96.6	Very high	96.4	Very high	1 Å²	1	61.4 Å²	61.4	1%	0.006	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.9	126.4	-179.4	-175.1	0	0	0	0	109.4	L33 V43 F60 M66 L68	L33-V57 HydrophobicContact CD2-CG2 4.18Å; V43-V57 HydrophobicContact CG1-CG2 4.29Å; V43-V57 HydrophobicContact CG2-CG2 3.55Å; V57-F60 HydrophobicContact CG1-CB 4.38Å; V57-M66 HydrophobicContact CG2-SD 4.38Å; V57-L68 HydrophobicContact CB-CD2 4.42Å; V57-L68 HydrophobicContact CG2-CD2 3.89Å
58	K	97	Very high	96.5	Very high	87 Å²	87	61.1 Å²	61.1	38%	0.378	29%	0.292	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	-32.8	174.4	-68.8	-52.6	-167.4	-171.7	0	113.7	M37 N40 V67 E69	M37-K58 VanDerWaalsContact SD-O 3.4Å; N40-K58 PolarHBondContact OD1-NZ 3.32Å; K58-V67 HydrophobicContact CB-CG1 4.34Å; K58-V67 PolarHBondContact N-O 2.87Å; K58-E69 WeakPolarHBondContact CE-OE2 3.42Å; K58-E69 HydrophobicContact CG-CB 4.2Å; K58-E69 HydrophobicContact CG-CG 3.62Å; K58-E69 IonicContact NZ-OE2 3.61Å
59	A	97.2	Very high	96.5	Very high	43 Å²	43	54.3 Å²	54.3	36%	0.355	27%	0.269	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.1	153.8	174.1	0	0	0	0	0	109.3	M66 V67	A59-M66 WeakPolarHBondContact O-CA 3.43Å; A59-V67 HydrophobicContact CB-CB 4.17Å; A59-V67 HydrophobicContact CB-CG2 4.21Å; A59-V67 PolarHBondContact N-O 2.96Å; A59-V67 PolarHBondContact O-N 2.78Å
60	F	96.7	Very high	96.6	Very high	32 Å²	32	54.7 Å²	54.7	14%	0.14	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.7	167.7	172.1	71.8	-80.9	0	0	0	110.4	F25 L30 L33 T34 M37 V57 N65 M66	F25-F60 HydrophobicContact CB-CZ 4.24Å; F25-F60 AromaticContact CD1-CE2 3.78Å; F25-F60 HydrophobicContact CD1-CE2 3.78Å; F25-F60 HydrophobicContact CD1-CZ 4.31Å; F25-F60 HydrophobicContact CD2-CE2 4.24Å; F25-F60 HydrophobicContact CD2-CZ 4.25Å; F25-F60 AromaticContact CE1-CE2 3.96Å; F25-F60 HydrophobicContact CE1-CE2 3.96Å; F25-F60 HydrophobicContact CE2-CE2 4.38Å; F25-F60 AromaticContact CG-CE2 3.94Å; F25-F60 HydrophobicContact CG-CE2 3.94Å; F25-F60 HydrophobicContact CG-CZ 4.02Å; F25-F60 HydrophobicContact CZ-CE2 4.25Å; L30-F60 HydrophobicContact CB-CE2 4.23Å; L33-F60 HydrophobicContact CB-CD1 3.91Å; L33-F60 HydrophobicContact CB-CD2 4.19Å; L33-F60 HydrophobicContact CB-CE1 4.01Å; L33-F60 HydrophobicContact CB-CE2 4.28Å; L33-F60 HydrophobicContact CB-CG 4.01Å; L33-F60 HydrophobicContact CB-CZ 4.21Å; L33-F60 HydrophobicContact CD1-CB 4.29Å; L33-F60 HydrophobicContact CD1-CD2 3.92Å; L33-F60 HydrophobicContact CD1-CG 4.07Å; T34-F60 VanDerWaalsContact OG1-CZ 3.26Å; T34-F60 WeakPolarHBondContact OG1-CZ 3.41Å; M37-F60 HydrophobicContact CE-CE1 4.49Å; M37-F60 HydrophobicContact SD-CD1 4.44Å; M37-F60 HydrophobicContact SD-CE1 4.47Å; V57-F60 HydrophobicContact CG1-CB 4.38Å; F60-N65 CarbonylContact C-O 3.56Å; F60-N65 WeakPolarHBondContact CA-O 3.5Å; F60-M66 HydrophobicContact CB-CG 4.09Å
61	D	94.8	Very high	96.8	Very high	47 Å²	47	47.9 Å²	47.9	25%	0.251	23%	0.23	S	C	.	.			trans	-130.2	179.3	174.5	76.9	3.2	0	0	0	112.5	H63 C64 N65	D61-H63 PolarHBondContact O-N 2.81Å; D61-H63 WeakPolarHBondContact OD1-CA 3.39Å; D61-H63 WeakPolarHBondContact OD1-CB 3.38Å; D61-H63 PolarHBondContact OD1-N 2.83Å; D61-H63 IonicContact OD2-ND1 3.6Å; D61-C64 PolarHBondContact O-N 2.83Å; D61-C64 PolarHBondContact OD1-N 2.87Å; D61-C64 VanDerWaalsContact OD1-N 3.15Å; D61-N65 PolarHBondContact N-O 3.44Å; D61-N65 VanDerWaalsContact N-O 3.1Å; D61-N65 WeakPolarHBondContact OD1-CB 3.34Å; D61-N65 PolarHBondContact OD1-N 3.14Å; D61-N65 PolarHBondContact OD1-ND2 2.84Å; D61-N65 PolarHBondContact OD2-ND2 3.19Å
62	R	94.3	Very high	96.9	Very high	146 Å²	146	49.6 Å²	49.6	55%	0.551	24%	0.238	S	C	*	.	T	Hydrogen-bonded Turn	trans	-60.7	-18.7	176.3	57.6	173.8	156.7	-94.7	3.1	115.5	E21 F25 C64	E21-R62 WeakPolarHBondContact OE1-CB 3.26Å; E21-R62 IonicContact OE1-CZ 3.69Å; E21-R62 IonicContact OE1-NH1 2.64Å; E21-R62 PolarHBondContact OE1-NH1 3.13Å; E21-R62 IonicContact OE2-CZ 3.99Å; E21-R62 IonicContact OE2-NH1 2.71Å; E21-R62 PolarHBondContact OE2-NH1 3.09Å; F25-R62 HydrophobicContact CE1-CB 4.21Å; F25-R62 HydrophobicContact CZ-CB 4.14Å; R62-C64 VanDerWaalsContact C-N 3.32Å
63	H	96.1	Very high	96.9	Very high	119 Å²	119	44.9 Å²	44.9	55%	0.551	22%	0.218	S	C	*	.	T	Hydrogen-bonded Turn	trans	-94.1	6.8	176.9	-54	107.9	0	0	0	112.1	D61 N65 G104	D61-H63 PolarHBondContact O-N 2.81Å; D61-H63 WeakPolarHBondContact OD1-CA 3.39Å; D61-H63 WeakPolarHBondContact OD1-CB 3.38Å; D61-H63 PolarHBondContact OD1-N 2.83Å; D61-H63 IonicContact OD2-ND1 3.6Å; H63-N65 PolarHBondContact O-N 2.9Å; H63-G104 WeakPolarHBondContact O-CA 3.24Å
64	C	95.7	Very high	96.9	Very high	39 Å²	39	47.5 Å²	47.5	26%	0.264	23%	0.23	S	C	.	.			trans	61.4	23.6	-171.5	-56.3	0	0	0	0	113.2	D61 R62 M66 G104	D61-C64 PolarHBondContact O-N 2.83Å; D61-C64 PolarHBondContact OD1-N 2.87Å; D61-C64 VanDerWaalsContact OD1-N 3.15Å; R62-C64 VanDerWaalsContact C-N 3.32Å; C64-M66 HydrophobicContact CB-CE 4.08Å; C64-M66 WeakPolarHBondContact O-CG 3.27Å; C64-G104 WeakPolarHBondContact O-CA 3.24Å
65	N	97.5	Very high	96.9	Very high	23 Å²	23	47.5 Å²	47.5	12%	0.123	23%	0.227	C	C	.	.			trans	-67.3	139.7	163.9	-58.3	-43.6	0	0	0	107.8	F60 D61 H63 F101 I102 R103 G104	F60-N65 CarbonylContact C-O 3.56Å; F60-N65 WeakPolarHBondContact CA-O 3.5Å; D61-N65 PolarHBondContact N-O 3.44Å; D61-N65 VanDerWaalsContact N-O 3.1Å; D61-N65 WeakPolarHBondContact OD1-CB 3.34Å; D61-N65 PolarHBondContact OD1-N 3.14Å; D61-N65 PolarHBondContact OD1-ND2 2.84Å; D61-N65 PolarHBondContact OD2-ND2 3.19Å; H63-N65 PolarHBondContact O-N 2.9Å; N65-F101 HydrophobicContact CB-CE2 4.03Å; N65-F101 HydrophobicContact CB-CZ 3.92Å; N65-I102 WeakPolarHBondContact CA-O 3.32Å; N65-R103 WeakPolarHBondContact OD1-CA 3.32Å; N65-R103 WeakPolarHBondContact OD1-CG 3.46Å; N65-G104 PolarHBondContact OD1-N 2.85Å
66	M	97.7	Very high	96.7	Very high	1 Å²	1	51.1 Å²	51.1	1%	0.005	25%	0.249	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-136.1	141.6	-176	-51.2	-179.2	-167.9	0	0	111.8	L33 I45 V57 A59 F60 C64 L68 F101 I102 V110	L33-M66 HydrophobicContact CD1-CE 3.46Å; L33-M66 VanDerWaalsContact CD1-CE 3.46Å; L33-M66 HydrophobicContact CD1-SD 4.41Å; L33-M66 HydrophobicContact CD2-CE 3.77Å; L33-M66 HydrophobicContact CD2-SD 3.9Å; L33-M66 HydrophobicContact CG-CE 4.27Å; I45-M66 HydrophobicContact CD1-SD 4Å; V57-M66 HydrophobicContact CG2-SD 4.38Å; A59-M66 WeakPolarHBondContact O-CA 3.43Å; F60-M66 HydrophobicContact CB-CG 4.09Å; C64-M66 HydrophobicContact CB-CE 4.08Å; C64-M66 WeakPolarHBondContact O-CG 3.27Å; M66-L68 HydrophobicContact CB-CD2 3.84Å; M66-L68 HydrophobicContact CB-CG 4.21Å; M66-L68 HydrophobicContact SD-CD2 4.47Å; M66-F101 WeakPolarHBondContact O-CA 3.4Å; M66-I102 HydrophobicContact CB-CG2 3.75Å; M66-I102 HydrophobicContact CG-CG2 4.38Å; M66-I102 PolarHBondContact N-O 3.18Å; M66-I102 PolarHBondContact O-N 3.48Å; M66-V110 HydrophobicContact CE-CG2 4.02Å
67	V	98	Very high	96.5	Very high	62 Å²	62	52.8 Å²	52.8	38%	0.376	26%	0.259	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.7	119.6	163.2	-178.3	0	0	0	0	107.2	K58 A59 F101	K58-V67 HydrophobicContact CB-CG1 4.34Å; K58-V67 PolarHBondContact N-O 2.87Å; A59-V67 HydrophobicContact CB-CB 4.17Å; A59-V67 HydrophobicContact CB-CG2 4.21Å; A59-V67 PolarHBondContact N-O 2.96Å; A59-V67 PolarHBondContact O-N 2.78Å; V67-F101 HydrophobicContact CG2-CD2 4.27Å
68	L	98	Very high	96.1	Very high	0 Å²	0	58.5 Å²	58.5	0%	0	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.8	143.5	-175	-56.5	179	0	0	0	110.4	I45 L53 A55 R56 V57 M66 V71 K99 M100 I102	I45-L68 HydrophobicContact CD1-CD1 3.73Å; I45-L68 HydrophobicContact CD1-CD2 3.87Å; I45-L68 HydrophobicContact CD1-CG 4.46Å; L53-L68 HydrophobicContact CD1-CD1 4.04Å; A55-L68 HydrophobicContact CB-CB 4.06Å; A55-L68 HydrophobicContact CB-CD1 4.07Å; A55-L68 HydrophobicContact CB-CD2 4.22Å; A55-L68 HydrophobicContact CB-CG 4.35Å; R56-L68 WeakPolarHBondContact O-CA 3.44Å; V57-L68 HydrophobicContact CB-CD2 4.42Å; V57-L68 HydrophobicContact CG2-CD2 3.89Å; M66-L68 HydrophobicContact CB-CD2 3.84Å; M66-L68 HydrophobicContact CB-CG 4.21Å; M66-L68 HydrophobicContact SD-CD2 4.47Å; L68-V71 HydrophobicContact CB-CG2 3.49Å; L68-V71 VanDerWaalsContact CB-CG2 3.49Å; L68-V71 HydrophobicContact CD1-CG2 4.36Å; L68-K99 WeakPolarHBondContact O-CA 3.33Å; L68-M100 HydrophobicContact CB-CB 4.46Å; L68-M100 PolarHBondContact N-O 2.88Å; L68-M100 PolarHBondContact O-N 3.37Å; L68-I102 HydrophobicContact CD1-CG2 3.78Å; L68-I102 HydrophobicContact CG-CG2 4.18Å
69	E	97.5	Very high	95.4	Very high	53 Å²	53	57.1 Å²	57.1	25%	0.248	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122	158.7	169.4	-68	-167.2	155.8	0	0	110.9	R56 K58 V71 A98 K99	R56-E69 PolarHBondContact N-O 2.78Å; R56-E69 PolarHBondContact O-N 3.26Å; K58-E69 WeakPolarHBondContact CE-OE2 3.42Å; K58-E69 HydrophobicContact CG-CB 4.2Å; K58-E69 HydrophobicContact CG-CG 3.62Å; K58-E69 IonicContact NZ-OE2 3.61Å; E69-V71 VanDerWaalsContact C-N 3.31Å; E69-V71 PolarHBondContact O-N 2.81Å; E69-A98 WeakPolarHBondContact CA-O 2.76Å; E69-K99 HydrophobicContact CG-CG 4.24Å; E69-K99 VanDerWaalsContact OE1-CE 3.25Å; E69-K99 WeakPolarHBondContact OE1-CE 3.4Å; E69-K99 IonicContact OE1-NZ 2.99Å
70	E	96.9	Very high	94.5	Very high	108 Å²	108	64.9 Å²	64.9	51%	0.505	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	54.7	44.6	179.4	-56.9	180	159.6	0	0	112.5	R56 K72 F96 A98	R56-E70 WeakPolarHBondContact CD-OE2 3.31Å; R56-E70 IonicContact NE-OE2 3.09Å; R56-E70 PolarHBondContact NE-OE2 2.82Å; R56-E70 VanDerWaalsContact NE-OE2 3.09Å; E70-K72 PolarHBondContact O-N 3.08Å; E70-F96 HydrophobicContact CB-CE2 4.36Å; E70-A98 PolarHBondContact N-O 3.22Å
71	V	97.8	Very high	93.2	Very high	0 Å²	0	65 Å²	65	0%	0	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.9	119.1	-170.9	-172.9	0	0	0	0	110.7	L53 A55 L68 E69 F96 I97 M100	L53-V71 HydrophobicContact CB-CG1 4.11Å; L53-V71 HydrophobicContact CD1-CG1 4.49Å; L53-V71 HydrophobicContact CD2-CG1 3.98Å; L53-V71 HydrophobicContact CG-CG1 4.43Å; A55-V71 HydrophobicContact CB-CB 4.29Å; A55-V71 HydrophobicContact CB-CG1 4.25Å; A55-V71 HydrophobicContact CB-CG2 3.83Å; L68-V71 HydrophobicContact CB-CG2 3.49Å; L68-V71 VanDerWaalsContact CB-CG2 3.49Å; L68-V71 HydrophobicContact CD1-CG2 4.36Å; E69-V71 VanDerWaalsContact C-N 3.31Å; E69-V71 PolarHBondContact O-N 2.81Å; V71-F96 CarbonylContact O-C 3.58Å; V71-F96 WeakPolarHBondContact O-CA 3.4Å; V71-I97 HydrophobicContact CB-CB 4.26Å; V71-I97 WeakPolarHBondContact CB-O 3.49Å; V71-I97 PolarHBondContact N-O 3.43Å; V71-I97 PolarHBondContact O-N 2.99Å; V71-M100 HydrophobicContact CG1-CE 4.23Å; V71-M100 HydrophobicContact CG1-SD 4.19Å; V71-M100 HydrophobicContact CG2-CB 3.88Å
72	K	97.7	Very high	92.1	Very high	82 Å²	82	65 Å²	65	36%	0.357	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.4	103.7	165.1	-175.4	175	-178.5	158.9	0	109.4	L53 L54 E70 M74 D94	L53-K72 WeakPolarHBondContact CA-O 3.48Å; L54-K72 HydrophobicContact CB-CB 4.36Å; L54-K72 PolarHBondContact N-O 2.84Å; L54-K72 PolarHBondContact O-N 3Å; E70-K72 PolarHBondContact O-N 3.08Å; K72-M74 HydrophobicContact CD-CG 4.47Å; K72-M74 HydrophobicContact CD-SD 4.31Å; K72-M74 HydrophobicContact CG-CG 4.08Å; K72-M74 HydrophobicContact CG-SD 4.44Å; K72-D94 WeakPolarHBondContact CE-OD2 3.46Å; K72-D94 IonicContact NZ-OD2 2.78Å; K72-D94 PolarHBondContact NZ-OD2 2.86Å
73	E	97.6	Very high	91	Very high	9 Å²	9	68.2 Å²	68.2	4%	0.042	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87	131.7	173.4	179.5	175.4	171.3	0	0	110	K51 K52 L53 W75 D94 R95	K51-E73 HydrophobicContact CB-CG 4.48Å; K51-E73 HydrophobicContact CD-CG 4.16Å; K51-E73 WeakPolarHBondContact CD-OE1 3.36Å; K51-E73 WeakPolarHBondContact CE-OE1 3.49Å; K51-E73 IonicContact NZ-OE1 3.89Å; K51-E73 PolarHBondContact NZ-OE1 3.49Å; K52-E73 CarbonylContact O-C 3.43Å; K52-E73 WeakPolarHBondContact O-CA 3.15Å; L53-E73 HydrophobicContact CD2-CB 3.46Å; L53-E73 VanDerWaalsContact CD2-CB 3.46Å; L53-E73 HydrophobicContact CD2-CG 3.51Å; E73-W75 HydrophobicContact CG-CE3 4Å; E73-W75 HydrophobicContact CG-CZ3 4.13Å; E73-D94 CarbonylContact O-C 3.49Å; E73-D94 WeakPolarHBondContact O-CA 3.41Å; E73-R95 HydrophobicContact CB-CG 3.99Å; E73-R95 VanDerWaalsContact CD-NE 3.33Å; E73-R95 VanDerWaalsContact CD-NH2 3.26Å; E73-R95 PolarHBondContact N-O 3.41Å; E73-R95 PolarHBondContact O-N 3.04Å; E73-R95 IonicContact OE1-CZ 3.71Å; E73-R95 IonicContact OE1-NE 3.52Å; E73-R95 IonicContact OE1-NH2 3.75Å; E73-R95 PolarHBondContact OE1-NH2 2.86Å; E73-R95 VanDerWaalsContact OE1-NH2 3.1Å; E73-R95 IonicContact OE2-CZ 2.69Å; E73-R95 IonicContact OE2-NE 3.1Å; E73-R95 PolarHBondContact OE2-NE 3.04Å; E73-R95 IonicContact OE2-NH2 3.73Å; E73-R95 PolarHBondContact OE2-NH2 3.15Å
74	M	97.4	Very high	89.7	Confident	59 Å²	59	70.7 Å²	70.7	29%	0.291	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	134.6	-175.1	-62	173.5	-75.4	0	0	109.8	L44 K52 L54 K72 K93 D94	L44-M74 HydrophobicContact CD1-CE 4.19Å; K52-M74 PolarHBondContact N-O 2.87Å; K52-M74 PolarHBondContact O-N 3.43Å; L54-M74 HydrophobicContact CB-CE 3.85Å; K72-M74 HydrophobicContact CD-CG 4.47Å; K72-M74 HydrophobicContact CD-SD 4.31Å; K72-M74 HydrophobicContact CG-CG 4.08Å; K72-M74 HydrophobicContact CG-SD 4.44Å; M74-K93 WeakPolarHBondContact CA-O 3.43Å; M74-D94 HydrophobicContact CG-CB 4.08Å
75	W	96.6	Very high	88.4	Confident	46 Å²	46	76 Å²	76	17%	0.174	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.7	161.9	174.4	68.1	100	0	0	0	110.8	K51 E73 E77 K93 R95	K51-W75 HydrophobicContact CB-CB 4.33Å; K51-W75 HydrophobicContact CD-CB 4.14Å; K51-W75 HydrophobicContact CD-CD2 4.45Å; K51-W75 HydrophobicContact CD-CE3 4.42Å; K51-W75 HydrophobicContact CD-CG 4.36Å; K51-W75 HydrophobicContact CG-CB 3.77Å; K51-W75 HydrophobicContact CG-CG 4.47Å; E73-W75 HydrophobicContact CG-CE3 4Å; E73-W75 HydrophobicContact CG-CZ3 4.13Å; W75-E77 PolarHBondContact NE1-OE1 3.1Å; W75-K93 HydrophobicContact CD2-CB 4.08Å; W75-K93 HydrophobicContact CH2-CB 4.15Å; W75-K93 HydrophobicContact CZ2-CB 3.67Å; W75-K93 HydrophobicContact CZ2-CD 3.94Å; W75-K93 HydrophobicContact CZ2-CG 4.48Å; W75-K93 PolarHBondContact N-O 3.41Å; W75-K93 PolarHBondContact O-N 2.78Å; W75-K93 VanDerWaalsContact O-O 3.05Å; W75-R95 HydrophobicContact CH2-CB 4.1Å; W75-R95 HydrophobicContact CH2-CG 4.04Å; W75-R95 HydrophobicContact CZ3-CB 4.15Å; W75-R95 HydrophobicContact CZ3-CG 3.79Å
76	T	94.5	Very high	87.2	Confident	77 Å²	77	84.5 Å²	84.5	47%	0.472	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	125.8	175.7	-54.8	0	0	0	0	108.7	P90 V91 N92	T76-P90 HydrophobicContact CG2-CB 3.48Å; T76-P90 VanDerWaalsContact CG2-CB 3.48Å; T76-V91 WeakPolarHBondContact CA-O 3.44Å; T76-N92 PolarHBondContact OG1-OD1 2.66Å
77	E	91.2	Very high	86.1	Confident	75 Å²	75	93.6 Å²	93.6	35%	0.35	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.3	133.2	170.1	-71.1	-177.1	-163.5	0	0	110	W75 P79 V91 K93	W75-E77 PolarHBondContact NE1-OE1 3.1Å; E77-P79 VanDerWaalsContact O-CD 3.3Å; E77-P79 WeakPolarHBondContact O-CD 3.45Å; E77-V91 PolarHBondContact N-O 2.69Å; E77-V91 PolarHBondContact O-N 3.45Å; E77-K93 HydrophobicContact CG-CD 4.34Å; E77-K93 VanDerWaalsContact OE1-CD 3.31Å; E77-K93 WeakPolarHBondContact OE1-CD 3.44Å; E77-K93 WeakPolarHBondContact OE1-CE 3.27Å; E77-K93 IonicContact OE1-NZ 3.45Å; E77-K93 PolarHBondContact OE1-NZ 2.99Å; E77-K93 WeakPolarHBondContact OE2-CE 3.33Å; E77-K93 IonicContact OE2-NZ 2.82Å; E77-K93 PolarHBondContact OE2-NZ 3.36Å
78	L	87.4	Confident	85.2	Confident	121 Å²	121	91.9 Å²	91.9	63%	0.634	46%	0.462	S	S	*	.			trans	-98.6	101	170.4	-73.2	157.4	0	0	0	107	K80 P90	L78-K80 PolarHBondContact O-N 3.05Å; L78-P90 HydrophobicContact CD2-CB 4.09Å; L78-P90 HydrophobicContact CD2-CG 3.87Å
79	P	83.3	Confident	84.7	Confident	58 Å²	58	100.8 Å²	100.8	38%	0.377	50%	0.501	S	S	.	.			trans	-59.4	125.7	178.8	23.2	-31.8	0	0	0	109.1	E77 G81 K89	E77-P79 VanDerWaalsContact O-CD 3.3Å; E77-P79 WeakPolarHBondContact O-CD 3.45Å; P79-G81 PolarHBondContact O-N 3.36Å; P79-G81 VanDerWaalsContact O-N 3.12Å; P79-K89 WeakPolarHBondContact CD-O 2.88Å
80	K	77.6	Confident	84.3	Confident	206 Å²	206	102.2 Å²	102.2	90%	0.896	52%	0.515	S	S	*	.			trans	-64.8	114.6	171.8	-69.4	-176.2	179.5	178.2	0	106.9	L78	L78-K80 PolarHBondContact O-N 3.05Å
81	G	70.1	Confident	84.1	Confident	33 Å²	33	100.6 Å²	100.6	34%	0.34	51%	0.512	S	S	.	.	P	Polyproline II helix	trans	-58.8	146.7	169.3	0	0	0	0	0	109.4	P79	P79-G81 PolarHBondContact O-N 3.36Å; P79-G81 VanDerWaalsContact O-N 3.12Å
82	G	71.7	Confident	84	Confident	47 Å²	47	106.8 Å²	106.8	49%	0.485	55%	0.545	S	S	.	.	P	Polyproline II helix	trans	-57.1	165.4	168.8	0	0	0	0	0	111.2	N84 Q85	G82-N84 PolarHBondContact O-N 2.96Å; G82-Q85 PolarHBondContact O-N 2.97Å
83	K	70.7	Confident	83.9	Confident	215 Å²	215	107 Å²	107	94%	0.935	55%	0.546	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.9	117.9	174.5	-148.1	175.3	-176.5	-178.8	0	108.1
84	N	68.2	Low	83.8	Confident	170 Å²	170	111 Å²	111	91%	0.909	57%	0.568	S	S	*	*	T	Hydrogen-bonded Turn	trans	79.1	10.9	-174.1	-62.9	-10	0	0	0	119.4	G82	G82-N84 PolarHBondContact O-N 2.96Å
85	Q	69.7	Low	83.9	Confident	152 Å²	152	113.9 Å²	113.9	71%	0.71	58%	0.576	S	S	*	*	S	Bend	trans	-103.2	141.1	170.2	-66	-168.9	6	0	0	112.1	G82	G82-Q85 PolarHBondContact O-N 2.97Å
86	K	72	Confident	83.9	Confident	200 Å²	200	118.4 Å²	118.4	87%	0.87	60%	0.597	S	S	*	*	P	Polyproline II helix	trans	-55	144.1	173.2	-69.7	-177.3	179.9	178.7	0	109.3	G88	K86-G88 PolarHBondContact O-N 2.67Å
87	K	74.6	Confident	84.1	Confident	192 Å²	192	116.8 Å²	116.8	84%	0.835	58%	0.584	S	S	*	*	P	Polyproline II helix	trans	-46.7	126.1	173.7	-68.8	-179.3	179	177.3	0	108.6
88	G	78.8	Confident	84.4	Confident	27 Å²	27	116.2 Å²	116.2	28%	0.278	59%	0.593	S	S	.	*	P	Polyproline II helix	trans	-67.2	163.6	-177.5	0	0	0	0	0	111.3	K86	K86-G88 PolarHBondContact O-N 2.67Å
89	K	86.6	Confident	84.9	Confident	186 Å²	186	117.7 Å²	117.7	81%	0.809	59%	0.594	S	S	*	*	P	Polyproline II helix	trans	-58.9	138.8	178.8	-68.2	-177.7	179.6	179.6	0	109.7	P79 V91	P79-K89 WeakPolarHBondContact CD-O 2.88Å; K89-V91 PolarHBondContact O-N 2.88Å
90	P	90.4	Very high	85.6	Confident	84 Å²	84	116.7 Å²	116.7	55%	0.545	59%	0.585	S	S	.	*	P	Polyproline II helix	trans	-57.7	129.6	174.8	-18.2	28.2	0	0	0	110.5	T76 L78	T76-P90 HydrophobicContact CG2-CB 3.48Å; T76-P90 VanDerWaalsContact CG2-CB 3.48Å; L78-P90 HydrophobicContact CD2-CB 4.09Å; L78-P90 HydrophobicContact CD2-CG 3.87Å
91	V	92.3	Very high	86.6	Confident	73 Å²	73	113.3 Å²	113.3	44%	0.442	57%	0.57	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-107.7	118.8	179	-177.5	0	0	0	0	108.6	T76 E77 K89	T76-V91 WeakPolarHBondContact CA-O 3.44Å; E77-V91 PolarHBondContact N-O 2.69Å; E77-V91 PolarHBondContact O-N 3.45Å; K89-V91 PolarHBondContact O-N 2.88Å
92	N	95	Very high	87.8	Confident	130 Å²	130	112.4 Å²	112.4	70%	0.695	56%	0.558	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-77.3	128.3	173.2	-67.8	-23.1	0	0	0	109.2	T76	T76-N92 PolarHBondContact OG1-OD1 2.66Å
93	K	96	Very high	89.1	Confident	86 Å²	86	117.5 Å²	117.5	37%	0.374	56%	0.562	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-118.2	146.3	172.1	-68.7	-164.8	-177.1	170.8	0	109.6	M74 W75 E77	M74-K93 WeakPolarHBondContact CA-O 3.43Å; W75-K93 HydrophobicContact CD2-CB 4.08Å; W75-K93 HydrophobicContact CH2-CB 4.15Å; W75-K93 HydrophobicContact CZ2-CB 3.67Å; W75-K93 HydrophobicContact CZ2-CD 3.94Å; W75-K93 HydrophobicContact CZ2-CG 4.48Å; W75-K93 PolarHBondContact N-O 3.41Å; W75-K93 PolarHBondContact O-N 2.78Å; W75-K93 VanDerWaalsContact O-O 3.05Å; E77-K93 HydrophobicContact CG-CD 4.34Å; E77-K93 VanDerWaalsContact OE1-CD 3.31Å; E77-K93 WeakPolarHBondContact OE1-CD 3.44Å; E77-K93 WeakPolarHBondContact OE1-CE 3.27Å; E77-K93 IonicContact OE1-NZ 3.45Å; E77-K93 PolarHBondContact OE1-NZ 2.99Å; E77-K93 WeakPolarHBondContact OE2-CE 3.33Å; E77-K93 IonicContact OE2-NZ 2.82Å; E77-K93 PolarHBondContact OE2-NZ 3.36Å
94	D	96.6	Very high	90.4	Very high	95 Å²	95	107.7 Å²	107.7	51%	0.508	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	155.7	169.7	59.1	-14.8	0	0	0	111	K72 E73 M74	K72-D94 WeakPolarHBondContact CE-OD2 3.46Å; K72-D94 IonicContact NZ-OD2 2.78Å; K72-D94 PolarHBondContact NZ-OD2 2.86Å; E73-D94 CarbonylContact O-C 3.49Å; E73-D94 WeakPolarHBondContact O-CA 3.41Å; M74-D94 HydrophobicContact CG-CB 4.08Å
95	R	97.8	Very high	91.7	Very high	119 Å²	119	104.2 Å²	104.2	45%	0.449	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.1	150.8	167.4	73	-174.6	174	174.1	0.4	109.9	E73 W75 I97	E73-R95 HydrophobicContact CB-CG 3.99Å; E73-R95 VanDerWaalsContact CD-NE 3.33Å; E73-R95 VanDerWaalsContact CD-NH2 3.26Å; E73-R95 PolarHBondContact N-O 3.41Å; E73-R95 PolarHBondContact O-N 3.04Å; E73-R95 IonicContact OE1-CZ 3.71Å; E73-R95 IonicContact OE1-NE 3.52Å; E73-R95 IonicContact OE1-NH2 3.75Å; E73-R95 PolarHBondContact OE1-NH2 2.86Å; E73-R95 VanDerWaalsContact OE1-NH2 3.1Å; E73-R95 IonicContact OE2-CZ 2.69Å; E73-R95 IonicContact OE2-NE 3.1Å; E73-R95 PolarHBondContact OE2-NE 3.04Å; E73-R95 IonicContact OE2-NH2 3.73Å; E73-R95 PolarHBondContact OE2-NH2 3.15Å; W75-R95 HydrophobicContact CH2-CB 4.1Å; W75-R95 HydrophobicContact CH2-CG 4.04Å; W75-R95 HydrophobicContact CZ3-CB 4.15Å; W75-R95 HydrophobicContact CZ3-CG 3.79Å; R95-I97 HydrophobicContact CG-CD1 4.3Å; R95-I97 HydrophobicContact CG-CG1 4.45Å
96	F	98	Very high	93	Very high	141 Å²	141	98.6 Å²	98.6	62%	0.618	48%	0.483	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.2	136.2	176.6	-177.4	-102.5	0	0	0	110.8	E70 V71 A98	E70-F96 HydrophobicContact CB-CE2 4.36Å; V71-F96 CarbonylContact O-C 3.58Å; V71-F96 WeakPolarHBondContact O-CA 3.4Å; F96-A98 HydrophobicContact CE1-CB 4.32Å
97	I	97.8	Very high	94.2	Very high	42 Å²	42	90.4 Å²	90.4	22%	0.215	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.9	118	178	-63.2	169.7	0	0	0	107.4	V71 R95 K99 M100	V71-I97 HydrophobicContact CB-CB 4.26Å; V71-I97 WeakPolarHBondContact CB-O 3.49Å; V71-I97 PolarHBondContact N-O 3.43Å; V71-I97 PolarHBondContact O-N 2.99Å; R95-I97 HydrophobicContact CG-CD1 4.3Å; R95-I97 HydrophobicContact CG-CG1 4.45Å; I97-K99 VanDerWaalsContact CG2-O 3.27Å; I97-K99 WeakPolarHBondContact CG2-O 3.25Å; I97-K99 PolarHBondContact O-N 3.47Å; I97-M100 HydrophobicContact CB-CE 4.27Å; I97-M100 HydrophobicContact CD1-CE 3.18Å; I97-M100 HydrophobicContact CG1-CE 4.28Å; I97-M100 HydrophobicContact CG2-CB 4.09Å; I97-M100 HydrophobicContact CG2-CE 4.17Å
98	A	97.8	Very high	95.3	Very high	63 Å²	63	86.7 Å²	86.7	52%	0.521	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.6	-44.6	-173.4	0	0	0	0	0	112.7	E69 E70 F96	E69-A98 WeakPolarHBondContact CA-O 2.76Å; E70-A98 PolarHBondContact N-O 3.22Å; F96-A98 HydrophobicContact CE1-CB 4.32Å
99	K	97.8	Very high	96.1	Very high	152 Å²	152	89.8 Å²	89.8	66%	0.661	45%	0.446	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-138.7	135.9	178.7	-57.4	-169.4	175.8	-169.4	0	109.5	L68 E69 I97	L68-K99 WeakPolarHBondContact O-CA 3.33Å; E69-K99 HydrophobicContact CG-CG 4.24Å; E69-K99 VanDerWaalsContact OE1-CE 3.25Å; E69-K99 WeakPolarHBondContact OE1-CE 3.4Å; E69-K99 IonicContact OE1-NZ 2.99Å; I97-K99 VanDerWaalsContact CG2-O 3.27Å; I97-K99 WeakPolarHBondContact CG2-O 3.25Å; I97-K99 PolarHBondContact O-N 3.47Å
100	M	97.5	Very high	96.5	Very high	37 Å²	37	82.7 Å²	82.7	18%	0.182	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.5	136.7	-179.1	178.9	-176.9	-76.5	0	0	110.4	L53 L68 V71 I97	L53-M100 HydrophobicContact CD1-SD 3.9Å; L68-M100 HydrophobicContact CB-CB 4.46Å; L68-M100 PolarHBondContact N-O 2.88Å; L68-M100 PolarHBondContact O-N 3.37Å; V71-M100 HydrophobicContact CG1-CE 4.23Å; V71-M100 HydrophobicContact CG1-SD 4.19Å; V71-M100 HydrophobicContact CG2-CB 3.88Å; I97-M100 HydrophobicContact CB-CE 4.27Å; I97-M100 HydrophobicContact CD1-CE 3.18Å; I97-M100 HydrophobicContact CG1-CE 4.28Å; I97-M100 HydrophobicContact CG2-CB 4.09Å; I97-M100 HydrophobicContact CG2-CE 4.17Å
101	F	98.3	Very high	96.8	Very high	136 Å²	136	82.6 Å²	82.6	60%	0.596	41%	0.413	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96	130.6	160.4	175.8	-96.3	0	0	0	109	N65 M66 V67	N65-F101 HydrophobicContact CB-CE2 4.03Å; N65-F101 HydrophobicContact CB-CZ 3.92Å; M66-F101 WeakPolarHBondContact O-CA 3.4Å; V67-F101 HydrophobicContact CG2-CD2 4.27Å
102	I	97.2	Very high	96.7	Very high	14 Å²	14	82.5 Å²	82.5	7%	0.072	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118	134.9	172.4	-174.9	163.3	0	0	0	110	L53 N65 M66 L68 A106 V107	L53-I102 HydrophobicContact CD1-CD1 3.65Å; N65-I102 WeakPolarHBondContact CA-O 3.32Å; M66-I102 HydrophobicContact CB-CG2 3.75Å; M66-I102 HydrophobicContact CG-CG2 4.38Å; M66-I102 PolarHBondContact N-O 3.18Å; M66-I102 PolarHBondContact O-N 3.48Å; L68-I102 HydrophobicContact CD1-CG2 3.78Å; L68-I102 HydrophobicContact CG-CG2 4.18Å; I102-A106 HydrophobicContact CD1-CB 4.42Å; I102-A106 HydrophobicContact CG1-CB 4.39Å; I102-V107 HydrophobicContact CD1-CG2 3.95Å; I102-V107 HydrophobicContact CG1-CG2 4.27Å
103	R	97.8	Very high	96.3	Very high	153 Å²	153	78 Å²	78	58%	0.577	38%	0.383	S	S	*	.			trans	-80.2	137.4	171.8	-166.8	-177.2	163.8	79.1	2.4	109.9	N65 D105 A106	N65-R103 WeakPolarHBondContact OD1-CA 3.32Å; N65-R103 WeakPolarHBondContact OD1-CG 3.46Å; R103-D105 VanDerWaalsContact C-N 3.27Å; R103-D105 VanDerWaalsContact CB-OD1 3.27Å; R103-D105 WeakPolarHBondContact CB-OD1 3.45Å; R103-D105 VanDerWaalsContact CD-CG 3.47Å; R103-D105 WeakPolarHBondContact CD-OD1 3.42Å; R103-D105 VanDerWaalsContact CD-OD2 3.3Å; R103-D105 WeakPolarHBondContact CD-OD2 3.12Å; R103-D105 WeakPolarHBondContact CG-OD1 3.44Å; R103-D105 IonicContact CZ-OD2 2.78Å; R103-D105 VanDerWaalsContact NE-CG 3.28Å; R103-D105 IonicContact NE-OD1 2.66Å; R103-D105 PolarHBondContact NE-OD1 2.93Å; R103-D105 IonicContact NE-OD2 3.07Å; R103-D105 PolarHBondContact NE-OD2 2.99Å; R103-D105 PolarHBondContact O-N 2.82Å; R103-A106 WeakPolarHBondContact O-CB 3.42Å; R103-A106 PolarHBondContact O-N 3.21Å; R103-A106 VanDerWaalsContact O-N 3.16Å
104	G	97.3	Very high	95.5	Very high	10 Å²	10	78.8 Å²	78.8	10%	0.103	40%	0.397	C	S	.	.	G	3₁₀ helix	trans	-69.9	-18.6	-171.9	0	0	0	0	0	115.2	H63 C64 N65 A106 V107	H63-G104 WeakPolarHBondContact O-CA 3.24Å; C64-G104 WeakPolarHBondContact O-CA 3.24Å; N65-G104 PolarHBondContact OD1-N 2.85Å; G104-A106 PolarHBondContact O-N 3.27Å; G104-V107 PolarHBondContact O-N 2.9Å; G104-V107 VanDerWaalsContact O-N 3.1Å
105	D	97.3	Very high	94.4	Very high	96 Å²	96	80.4 Å²	80.4	51%	0.513	40%	0.404	S	S	.	.	G	3₁₀ helix	trans	-67	-20.6	172.3	62	-11.3	0	0	0	113.6	R103	R103-D105 VanDerWaalsContact C-N 3.27Å; R103-D105 VanDerWaalsContact CB-OD1 3.27Å; R103-D105 WeakPolarHBondContact CB-OD1 3.45Å; R103-D105 VanDerWaalsContact CD-CG 3.47Å; R103-D105 WeakPolarHBondContact CD-OD1 3.42Å; R103-D105 VanDerWaalsContact CD-OD2 3.3Å; R103-D105 WeakPolarHBondContact CD-OD2 3.12Å; R103-D105 WeakPolarHBondContact CG-OD1 3.44Å; R103-D105 IonicContact CZ-OD2 2.78Å; R103-D105 VanDerWaalsContact NE-CG 3.28Å; R103-D105 IonicContact NE-OD1 2.66Å; R103-D105 PolarHBondContact NE-OD1 2.93Å; R103-D105 IonicContact NE-OD2 3.07Å; R103-D105 PolarHBondContact NE-OD2 2.99Å; R103-D105 PolarHBondContact O-N 2.82Å
106	A	96.9	Very high	92.7	Very high	34 Å²	34	77.1 Å²	77.1	28%	0.281	39%	0.394	S	S	.	.	G	3₁₀ helix	trans	-81.6	-16.7	173.3	0	0	0	0	0	112.7	C47 R48 I102 R103 G104	C47-A106 CarbonylContact C-O 3.55Å; C47-A106 WeakPolarHBondContact CA-O 3.31Å; R48-A106 PolarHBondContact N-O 3.38Å; I102-A106 HydrophobicContact CD1-CB 4.42Å; I102-A106 HydrophobicContact CG1-CB 4.39Å; R103-A106 WeakPolarHBondContact O-CB 3.42Å; R103-A106 PolarHBondContact O-N 3.21Å; R103-A106 VanDerWaalsContact O-N 3.16Å; G104-A106 PolarHBondContact O-N 3.27Å
107	V	97.1	Very high	90.7	Very high	28 Å²	28	73.7 Å²	73.7	17%	0.17	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.9	129.9	-174.6	178.5	0	0	0	0	110.2	I45 I102 G104 V110	I45-V107 HydrophobicContact CG2-CB 4.42Å; I45-V107 HydrophobicContact CG2-CG1 3.86Å; I45-V107 HydrophobicContact CG2-CG2 3.91Å; I102-V107 HydrophobicContact CD1-CG2 3.95Å; I102-V107 HydrophobicContact CG1-CG2 4.27Å; G104-V107 PolarHBondContact O-N 2.9Å; G104-V107 VanDerWaalsContact O-N 3.1Å; V107-V110 HydrophobicContact CG1-CG2 3.72Å
108	I	97	Very high	88.7	Confident	115 Å²	115	75.9 Å²	75.9	59%	0.59	42%	0.416	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.2	-48.5	173.5	-65	175.2	0	0	0	110.6	S46 R48	S46-I108 PolarHBondContact O-N 2.66Å; R48-I108 HydrophobicContact CB-CD1 4.24Å; R48-I108 HydrophobicContact CB-CG1 4.36Å
109	M	95.6	Very high	86.7	Confident	92 Å²	92	77.2 Å²	77.2	45%	0.453	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.7	140.9	-171.9	-176.4	179.5	65.3	0	0	109.9	I45 S46 L111	I45-M109 WeakPolarHBondContact CA-O 3.16Å; S46-M109 PolarHBondContact N-O 2.93Å; S46-M109 PolarHBondContact O-N 2.93Å; M109-L111 HydrophobicContact CE-CD1 3.62Å; M109-L111 HydrophobicContact CE-CG 4Å; M109-L111 HydrophobicContact CG-CD2 4.41Å; M109-L111 HydrophobicContact CG-CG 4.27Å; M109-L111 HydrophobicContact SD-CD1 4.29Å; M109-L111 HydrophobicContact SD-CD2 4.2Å; M109-L111 HydrophobicContact SD-CG 4.21Å
110	V	96.1	Very high	84.4	Confident	37 Å²	37	73 Å²	73	22%	0.224	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	128.6	173.8	-175.3	0	0	0	0	108.7	L33 V43 I45 M66 V107	L33-V110 HydrophobicContact CD2-CG1 3.91Å; V43-V110 HydrophobicContact CB-CG1 4.2Å; I45-V110 HydrophobicContact CG1-CG1 4.43Å; I45-V110 HydrophobicContact CG1-CG2 4.45Å; M66-V110 HydrophobicContact CE-CG2 4.02Å; V107-V110 HydrophobicContact CG1-CG2 3.72Å
111	L	94.9	Very high	81.7	Confident	81 Å²	81	74.7 Å²	74.7	42%	0.424	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	127.3	175.8	-64.6	173.9	0	0	0	109.3	V43 L44 M109	V43-L111 CarbonylContact C-O 3.55Å; V43-L111 WeakPolarHBondContact CA-O 3.44Å; L44-L111 HydrophobicContact CB-CB 4.42Å; L44-L111 PolarHBondContact N-O 2.92Å; L44-L111 PolarHBondContact O-N 2.96Å; M109-L111 HydrophobicContact CE-CD1 3.62Å; M109-L111 HydrophobicContact CE-CG 4Å; M109-L111 HydrophobicContact CG-CD2 4.41Å; M109-L111 HydrophobicContact CG-CG 4.27Å; M109-L111 HydrophobicContact SD-CD1 4.29Å; M109-L111 HydrophobicContact SD-CD2 4.2Å; M109-L111 HydrophobicContact SD-CG 4.21Å
112	K	91	Very high	78.6	Confident	71 Å²	71	81.1 Å²	81.1	31%	0.309	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.2	135.4	170.5	-176.1	179	176.6	-175.8	0	109.3	I32 P114	I32-K112 HydrophobicContact CG2-CB 4.13Å; K112-P114 VanDerWaalsContact O-CD 3.32Å; K112-P114 WeakPolarHBondContact O-CD 3.3Å
113	N	86.4	Confident	77.7	Confident	36 Å²	36	84.5 Å²	84.5	19%	0.193	50%	0.496	C	S	.	.			trans	-65.8	118.2	174.3	-174.8	-7	0	0	0	109.9	Q42 L115	Q42-N113 HydrophobicContact CB-CB 4.2Å; Q42-N113 VanDerWaalsContact O-CB 3.24Å; Q42-N113 WeakPolarHBondContact O-CB 3.43Å; Q42-N113 PolarHBondContact O-N 2.88Å; N113-L115 VanDerWaalsContact C-N 3.27Å; N113-L115 PolarHBondContact O-N 2.81Å; N113-L115 WeakPolarHBondContact OD1-CB 3.38Å; N113-L115 PolarHBondContact OD1-N 3.09Å
114	P	80.3	Confident	76.6	Confident	103 Å²	103	80.8 Å²	80.8	67%	0.669	49%	0.492	S	S	*	.	H	α-helix	trans	-70.2	-24.2	-179.1	28.3	-34.8	0	0	0	112.9	K112 A117	K112-P114 VanDerWaalsContact O-CD 3.32Å; K112-P114 WeakPolarHBondContact O-CD 3.3Å; P114-A117 PolarHBondContact O-N 3.36Å
115	L	72.2	Confident	75.5	Confident	128 Å²	128	84.8 Å²	84.8	67%	0.67	51%	0.514	S	S	*	.	H	α-helix	trans	-72.6	-31.4	-172.4	-62.6	175.2	0	0	0	112.9	N113 A117 A118 S119	N113-L115 VanDerWaalsContact C-N 3.27Å; N113-L115 PolarHBondContact O-N 2.81Å; N113-L115 WeakPolarHBondContact OD1-CB 3.38Å; N113-L115 PolarHBondContact OD1-N 3.09Å; L115-A117 VanDerWaalsContact C-N 3.28Å; L115-A117 PolarHBondContact O-N 3.33Å; L115-A118 PolarHBondContact O-N 2.88Å; L115-A118 VanDerWaalsContact O-N 3.17Å; L115-S119 PolarHBondContact O-N 2.82Å
116	E	61.9	Low	74.2	Confident	51 Å²	51	84.1 Å²	84.1	24%	0.238	51%	0.514	C	S	.	.	H	α-helix	trans	-74	-21.1	178.2	-69.4	-157.2	166.8	0	0	112.7	T41 Q42 R56 A118 S119 G120	T41-E116 VanDerWaalsContact CA-OE2 3.27Å; T41-E116 WeakPolarHBondContact CA-OE2 3.26Å; T41-E116 HydrophobicContact CG2-CB 4.21Å; Q42-E116 PolarHBondContact N-OE2 2.94Å; R56-E116 IonicContact CZ-OE1 3.21Å; R56-E116 IonicContact CZ-OE2 2.66Å; R56-E116 IonicContact NH1-OE1 2.9Å; R56-E116 PolarHBondContact NH1-OE1 3.36Å; R56-E116 IonicContact NH1-OE2 2.93Å; R56-E116 PolarHBondContact NH1-OE2 3.12Å; R56-E116 IonicContact NH2-OE1 3.95Å; R56-E116 PolarHBondContact NH2-OE1 3.43Å; E116-A118 VanDerWaalsContact C-N 3.26Å; E116-A118 PolarHBondContact O-N 3.04Å; E116-S119 WeakPolarHBondContact CA-OG 2.88Å; E116-S119 PolarHBondContact O-N 2.92Å; E116-S119 PolarHBondContact O-OG 3.18Å; E116-G120 PolarHBondContact O-N 3.17Å
117	A	56.8	Low	72.8	Confident	69 Å²	69	87.3 Å²	87.3	57%	0.57	53%	0.528	S	S	*	.	H	α-helix	trans	-69.3	-26.7	170.5	0	0	0	0	0	112.2	P114 L115	P114-A117 PolarHBondContact O-N 3.36Å; L115-A117 VanDerWaalsContact C-N 3.28Å; L115-A117 PolarHBondContact O-N 3.33Å
118	A	55.4	Low	71.1	Confident	87 Å²	87	91.2 Å²	91.2	72%	0.719	55%	0.552	S	S	*	*	H	α-helix	trans	-82.6	-25.6	178	0	0	0	0	0	113	L115 E116	L115-A118 PolarHBondContact O-N 2.88Å; L115-A118 VanDerWaalsContact O-N 3.17Å; E116-A118 VanDerWaalsContact C-N 3.26Å; E116-A118 PolarHBondContact O-N 3.04Å
119	S	56	Low	69.3	Low	91 Å²	91	89.5 Å²	89.5	64%	0.636	55%	0.549	S	S	*	.	H	α-helix	trans	-87.9	-17.3	179.8	56.6	0	0	0	0	114.4	L115 E116 G121	L115-S119 PolarHBondContact O-N 2.82Å; E116-S119 WeakPolarHBondContact CA-OG 2.88Å; E116-S119 PolarHBondContact O-N 2.92Å; E116-S119 PolarHBondContact O-OG 3.18Å; S119-G121 VanDerWaalsContact C-N 3.33Å; S119-G121 PolarHBondContact O-N 2.78Å
120	G	50.2	Low	67.3	Low	65 Å²	65	89.3 Å²	89.3	67%	0.67	56%	0.557	S	S	*	*	S	Bend	trans	-86.7	13.9	-177.3	0	0	0	0	0	116.2	E116	E116-G120 PolarHBondContact O-N 3.17Å
121	G	39.9	Very low	64.9	Low	72 Å²	72	93.7 Å²	93.7	74%	0.742	59%	0.585	S	S	*	*			trans	-100	25.3	177.2	0	0	0	0	0	114.6	S119	S119-G121 VanDerWaalsContact C-N 3.33Å; S119-G121 PolarHBondContact O-N 2.78Å
122	K	33.2	Very low	62.1	Low	270 Å²	270	94.8 Å²	94.8	100%	1.174	60%	0.599	S	S	*	*			trans	-126	0	169.6	-80.7	-170.8	177.4	-177.8	0	110.3

Retrieved 122 of 122 residues in 327.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).