A0A077YXS4_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YXS4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 78 aa.

						>A0A077YXS4_TRITR|A0A077YXS4
MHLKTNRATFFRSQRPGTACATSGTRAHLQASETAGKSSFAVPSGRRPTWSQTGFQSIQPMKGSPLGVRNALGVFDRR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.1	Low	53.9	Low	238 Å²	238	168.5 Å²	168.5	100%	1.172	84%	0.835	S	S	*	*				0	122.3	0	-71.4	-67.7	-102.2	0	0	108.1
2	H	54.5	Low	53	Low	185 Å²	185	173.5 Å²	173.5	86%	0.856	84%	0.837	S	S	*	*			trans	-73.6	131.2	-152.8	-68.9	98.4	0	0	0	115.9	K4	H2-K4 PolarHBondContact O-N 2.84Å
3	L	53.1	Low	53	Low	160 Å²	160	167.8 Å²	167.8	84%	0.838	83%	0.827	S	S	*	*			trans	-70.6	113.8	166.7	-162.1	73.5	0	0	0	108.7	T5	L3-T5 PolarHBondContact O-N 3.21Å; L3-T5 VanDerWaalsContact O-N 3.08Å
4	K	58.7	Low	52.6	Low	196 Å²	196	169.4 Å²	169.4	85%	0.852	83%	0.831	S	S	*	*			trans	-78.5	91.3	177.4	-74.1	179.8	179.1	177.8	0	109.9	H2 N6	H2-K4 PolarHBondContact O-N 2.84Å; K4-N6 PolarHBondContact O-N 3.29Å
5	T	61.2	Low	52.4	Low	118 Å²	118	173.5 Å²	173.5	72%	0.724	83%	0.834	S	S	*	*			trans	-64.1	105.2	165.3	-50.9	0	0	0	0	109.2	L3 R7	L3-T5 PolarHBondContact O-N 3.21Å; L3-T5 VanDerWaalsContact O-N 3.08Å; T5-R7 PolarHBondContact O-N 2.98Å; T5-R7 VanDerWaalsContact C-N 3.29Å
6	N	58.4	Low	51.7	Low	166 Å²	166	170.6 Å²	170.6	89%	0.888	83%	0.833	S	S	*	*			trans	-74.1	90.7	168.2	-94.3	-32.3	0	0	0	109	K4 A8	K4-N6 PolarHBondContact O-N 3.29Å; N6-A8 PolarHBondContact O-N 3.07Å
7	R	51.4	Low	51.2	Low	215 Å²	215	164.2 Å²	164.2	81%	0.811	82%	0.821	S	S	*	*			trans	-54.6	122.5	172.4	-173.4	175	179.8	127.9	-3.4	109.6	T5 T9	T5-R7 PolarHBondContact O-N 2.98Å; T5-R7 VanDerWaalsContact C-N 3.29Å; R7-T9 PolarHBondContact O-N 3.18Å
8	A	51.5	Low	50.7	Low	86 Å²	86	162.7 Å²	162.7	71%	0.711	82%	0.822	S	S	*	*			trans	-55.4	100.2	167.4	0	0	0	0	0	109.7	N6 F10	N6-A8 PolarHBondContact O-N 3.07Å; A8-F10 PolarHBondContact O-N 2.83Å
9	T	54.8	Low	50.3	Low	107 Å²	107	158.8 Å²	158.8	66%	0.656	82%	0.818	S	S	*	*			trans	-88.4	103.4	174.5	41.2	0	0	0	0	109.2	R7 F11	R7-T9 PolarHBondContact O-N 3.18Å; T9-F11 PolarHBondContact O-N 3.34Å; T9-F11 VanDerWaalsContact O-N 3.07Å
10	F	47.8	Very low	49.9	Very low	188 Å²	188	157.5 Å²	157.5	83%	0.825	82%	0.822	S	S	*	*			trans	-33	103.3	158.2	-72.7	-99.5	0	0	0	112.6	A8 R12	A8-F10 PolarHBondContact O-N 2.83Å; F10-R12 PolarHBondContact O-N 2.74Å
11	F	49.2	Very low	49.7	Very low	194 Å²	194	154.1 Å²	154.1	85%	0.851	82%	0.817	S	S	*	*			trans	-76.9	80.2	161.5	-96.6	-88	0	0	0	109.2	T9 S13	T9-F11 PolarHBondContact O-N 3.34Å; T9-F11 VanDerWaalsContact O-N 3.07Å; F11-S13 PolarHBondContact O-N 3.23Å
12	R	43.6	Very low	49.7	Very low	229 Å²	229	149.2 Å²	149.2	86%	0.864	80%	0.8	S	S	*	*			trans	-80.5	95.9	150.6	-84.5	-174.3	-179.7	-174.8	0.5	106.8	F10	F10-R12 PolarHBondContact O-N 2.74Å
13	S	53.3	Low	49.1	Very low	100 Å²	100	145.6 Å²	145.6	70%	0.699	80%	0.796	S	S	*	*			trans	-91	112.5	162.5	60.1	0	0	0	0	108.7	F11	F11-S13 PolarHBondContact O-N 3.23Å
14	Q	46.4	Very low	48.9	Very low	189 Å²	189	140.8 Å²	140.8	88%	0.883	79%	0.785	S	S	*	*			trans	-64.7	124.5	166.4	-66.3	168.1	-29.3	0	0	108.4
15	R	50.8	Low	48.6	Very low	231 Å²	231	138.7 Å²	138.7	87%	0.872	79%	0.789	S	S	*	*			trans	-108.2	121.1	155.3	-80.9	-174.4	176.1	144.4	-0.7	108
16	P	40.9	Very low	47.8	Very low	128 Å²	128	144.1 Å²	144.1	83%	0.831	80%	0.796	S	S	*	*			trans	-79.4	130.9	174.3	31.9	-29.2	0	0	0	109.5
17	G	42.3	Very low	47.1	Very low	61 Å²	61	139.2 Å²	139.2	63%	0.629	78%	0.779	S	S	*	*			trans	86.6	106.1	-178.7	0	0	0	0	0	112.2
18	T	42.5	Very low	46.5	Very low	137 Å²	137	138 Å²	138	84%	0.84	78%	0.782	S	S	*	*				-178.8	110.1	73.1	30.5	0	0	0	0	104.3
19	A	43.9	Very low	46.2	Very low	90 Å²	90	141.5 Å²	141.5	74%	0.744	79%	0.788	S	S	*	*				32.3	110.1	83.9	0	0	0	0	0	113.5
20	C	41.5	Very low	45.7	Very low	132 Å²	132	143.9 Å²	143.9	89%	0.892	79%	0.791	S	S	*	*			trans	50.9	124.2	157.7	-59.3	0	0	0	0	117.3
21	A	45.9	Very low	45.5	Very low	86 Å²	86	139.8 Å²	139.8	71%	0.711	79%	0.792	S	S	*	*				-166.5	129.3	61.1	0	0	0	0	0	111.1
22	T	51.4	Low	45	Very low	135 Å²	135	134.8 Å²	134.8	83%	0.828	78%	0.781	S	S	*	*	S	Bend	trans	-41.6	131	143.6	24.2	0	0	0	0	110.7
23	S	41.7	Very low	45.1	Very low	109 Å²	109	132.3 Å²	132.3	76%	0.762	78%	0.78	S	S	*	*			trans	48.8	82.2	160.3	60.9	0	0	0	0	117.8
24	G	49.7	Very low	44.5	Very low	60 Å²	60	135.2 Å²	135.2	62%	0.619	79%	0.793	S	S	*	*			trans	-103.7	-19.3	178.9	0	0	0	0	0	117.5
25	T	52	Low	44.7	Very low	151 Å²	151	129.6 Å²	129.6	93%	0.926	78%	0.779	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.4	7.3	-177	48.8	0	0	0	0	114.6
26	R	44.6	Very low	44.7	Very low	233 Å²	233	122 Å²	122	88%	0.879	77%	0.772	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.3	6.8	168.4	-159	172.7	179.9	173.2	0.3	113
27	A	43.3	Very low	45	Very low	63 Å²	63	125.9 Å²	125.9	52%	0.521	78%	0.776	S	S	.	*			trans	-103.4	8.2	-174.1	0	0	0	0	0	115.1	L29	A27-L29 VanDerWaalsContact O-N 3.11Å; A27-L29 PolarHBondContact O-N 2.91Å
28	H	39.7	Very low	45.5	Very low	188 Å²	188	127.4 Å²	127.4	87%	0.87	78%	0.777	S	S	*	*	S	Bend	trans	-78.8	15.9	173.8	-130.4	-66.7	0	0	0	114
29	L	44.7	Very low	46.1	Very low	160 Å²	160	126.5 Å²	126.5	84%	0.838	78%	0.776	S	S	*	*			trans	-123.4	57.6	175	-65.9	172.8	0	0	0	109.2	A27	A27-L29 VanDerWaalsContact O-N 3.11Å; A27-L29 PolarHBondContact O-N 2.91Å
30	Q	43.6	Very low	46.6	Very low	157 Å²	157	130.7 Å²	130.7	73%	0.734	78%	0.778	S	S	*	*			trans	-103.1	82.2	165.4	-169.3	171.2	-13.4	0	0	105.2	S32	Q30-S32 PolarHBondContact O-N 2.97Å
31	A	44.2	Very low	47.4	Very low	102 Å²	102	128.8 Å²	128.8	84%	0.843	77%	0.772	S	S	*	*				40.7	52.2	79.8	0	0	0	0	0	111.7
32	S	40	Very low	48.1	Very low	89 Å²	89	131 Å²	131	62%	0.622	78%	0.776	S	S	*	*			trans	-154.8	76.8	170.9	165.8	0	0	0	0	108.2	Q30	Q30-S32 PolarHBondContact O-N 2.97Å
33	E	43.9	Very low	48.6	Very low	178 Å²	178	129.7 Å²	129.7	83%	0.832	77%	0.77	S	S	*	*			trans	-164.8	93	141.4	-109.5	172.7	-164.3	0	0	106.8	A35	E33-A35 HydrophobicContact CB-CB 4.21Å; E33-A35 HydrophobicContact CG-CB 4.46Å; E33-A35 PolarHBondContact O-N 3.11Å
34	T	42.1	Very low	49.4	Very low	160 Å²	160	131 Å²	131	98%	0.982	78%	0.779	S	S	*	*			trans	-67.2	72	158.3	-44.2	0	0	0	0	106.8
35	A	50.9	Low	49.9	Very low	72 Å²	72	130.8 Å²	130.8	60%	0.595	78%	0.777	S	S	*	*			trans	-114.4	108.3	177.5	0	0	0	0	0	108.3	E33	E33-A35 HydrophobicContact CB-CB 4.21Å; E33-A35 HydrophobicContact CG-CB 4.46Å; E33-A35 PolarHBondContact O-N 3.11Å
36	G	50.2	Low	50.3	Low	70 Å²	70	135.4 Å²	135.4	72%	0.722	78%	0.778	S	S	*	*			trans	31	106	155.9	0	0	0	0	0	118.3	S38	G36-S38 PolarHBondContact O-N 2.74Å
37	K	46.6	Very low	51.1	Low	211 Å²	211	135.3 Å²	135.3	92%	0.917	78%	0.777	S	S	*	*			trans	5.4	79.4	149.4	-65.9	175.8	176.7	176.9	0	114.5	S39	K37-S39 PolarHBondContact O-N 3.46Å
38	S	53.5	Low	52	Low	92 Å²	92	136.8 Å²	136.8	64%	0.643	78%	0.781	S	S	*	*			trans	-82.8	94.3	163.1	76.4	0	0	0	0	107.3	G36 F40	G36-S38 PolarHBondContact O-N 2.74Å; S38-F40 VanDerWaalsContact C-N 3.31Å; S38-F40 PolarHBondContact O-N 3.28Å
39	S	54	Low	53.2	Low	118 Å²	118	134.2 Å²	134.2	83%	0.825	78%	0.779	S	S	*	*			trans	-67.1	93.1	164.9	38.6	0	0	0	0	108.4	K37 A41	K37-S39 PolarHBondContact O-N 3.46Å; S39-A41 PolarHBondContact O-N 2.81Å
40	F	54.8	Low	53.8	Low	179 Å²	179	137.7 Å²	137.7	79%	0.785	78%	0.781	S	S	*	*			trans	-70.7	112.4	161.6	-89.1	-87.4	0	0	0	107.4	S38 V42	S38-F40 VanDerWaalsContact C-N 3.31Å; S38-F40 PolarHBondContact O-N 3.28Å; F40-V42 PolarHBondContact O-N 2.97Å
41	A	59.3	Low	54.6	Low	92 Å²	92	134.6 Å²	134.6	76%	0.76	78%	0.777	S	S	*	*			trans	-59.1	111.9	163.3	0	0	0	0	0	107.2	S39 P43	S39-A41 PolarHBondContact O-N 2.81Å; A41-P43 VanDerWaalsContact O-CD 3.28Å; A41-P43 WeakPolarHBondContact O-CD 3.28Å
42	V	60.4	Low	55.4	Low	131 Å²	131	138.6 Å²	138.6	79%	0.794	78%	0.778	S	S	*	*			trans	-65.7	117.5	170.8	179.1	0	0	0	0	106.2	F40 S44	F40-V42 PolarHBondContact O-N 2.97Å; V42-S44 PolarHBondContact O-N 3.38Å
43	P	61.1	Low	56.4	Low	109 Å²	109	139.7 Å²	139.7	71%	0.708	78%	0.781	S	S	*	*			trans	-59.9	126.1	171.3	-12.9	25.8	0	0	0	107.1	A41 G45	A41-P43 VanDerWaalsContact O-CD 3.28Å; A41-P43 WeakPolarHBondContact O-CD 3.28Å; P43-G45 PolarHBondContact O-N 2.81Å
44	S	59.7	Low	57.3	Low	136 Å²	136	133.8 Å²	133.8	95%	0.951	77%	0.768	S	S	*	*			trans	-69.1	70	168.1	59	0	0	0	0	108.9	V42	V42-S44 PolarHBondContact O-N 3.38Å
45	G	58.9	Low	58.5	Low	55 Å²	55	136.5 Å²	136.5	57%	0.567	77%	0.767	S	S	*	*			trans	-119.2	150	174.3	0	0	0	0	0	108.6	P43 R47	P43-G45 PolarHBondContact O-N 2.81Å; G45-R47 PolarHBondContact O-N 3.28Å
46	R	60.5	Low	59.2	Low	249 Å²	249	141.2 Å²	141.2	94%	0.94	78%	0.776	S	S	*	*			trans	-39.2	131.8	-179.7	-70.8	179.1	177.5	-149.1	-0.7	111.1
47	R	61.2	Low	60	Low	231 Å²	231	142.8 Å²	142.8	87%	0.872	78%	0.777	S	S	*	*			trans	-44.4	132.4	173.5	-80.4	-172.3	172.4	-152.3	-1.2	108.7	G45 T49	G45-R47 PolarHBondContact O-N 3.28Å; R47-T49 PolarHBondContact O-N 3.12Å
48	P	61.9	Low	61.1	Low	94 Å²	94	140.2 Å²	140.2	61%	0.61	77%	0.771	S	S	*	*			trans	-59.1	112	171	24.3	-30.8	0	0	0	107	W50	P48-W50 VanDerWaalsContact C-N 3.27Å; P48-W50 PolarHBondContact O-N 3.15Å
49	T	66.4	Low	61.8	Low	134 Å²	134	143.2 Å²	143.2	82%	0.822	78%	0.775	S	S	*	*			trans	-64.1	100.7	160.2	35.4	0	0	0	0	105.2	R47 S51	R47-T49 PolarHBondContact O-N 3.12Å; T49-S51 PolarHBondContact O-N 3.07Å
50	W	56.7	Low	62.1	Low	233 Å²	233	139.2 Å²	139.2	88%	0.883	75%	0.746	S	S	*	*			trans	-61.9	89.4	162.5	-63.2	92.5	0	0	0	106.1	P48 Q52	P48-W50 VanDerWaalsContact C-N 3.27Å; P48-W50 PolarHBondContact O-N 3.15Å; W50-Q52 PolarHBondContact O-N 2.97Å
51	S	60.8	Low	62.7	Low	92 Å²	92	138.2 Å²	138.2	64%	0.643	75%	0.746	S	S	*	*			trans	-65.5	121	158	60.9	0	0	0	0	104.6	T49 T53	T49-S51 PolarHBondContact O-N 3.07Å; S51-T53 PolarHBondContact O-N 3.18Å; S51-T53 PolarHBondContact O-OG1 3.14Å
52	Q	60.1	Low	62.8	Low	185 Å²	185	142.9 Å²	142.9	86%	0.864	75%	0.749	S	S	*	*			trans	-56.7	98.5	169.3	-177.2	175.5	6.6	0	0	105.9	W50 G54	W50-Q52 PolarHBondContact O-N 2.97Å; Q52-G54 PolarHBondContact O-N 3.4Å
53	T	62	Low	62.9	Low	113 Å²	113	140.4 Å²	140.4	69%	0.693	75%	0.75	S	S	*	*			trans	-63.3	112.5	175.8	-25.4	0	0	0	0	103.8	S51 F55	S51-T53 PolarHBondContact O-N 3.18Å; S51-T53 PolarHBondContact O-OG1 3.14Å; T53-F55 PolarHBondContact O-N 3.37Å
54	G	62.8	Low	63	Low	54 Å²	54	136.8 Å²	136.8	56%	0.557	73%	0.727	S	S	*	*			trans	-50.2	140	176.3	0	0	0	0	0	108.6	Q52 Q56	Q52-G54 PolarHBondContact O-N 3.4Å; G54-Q56 PolarHBondContact O-N 2.84Å
55	F	66.8	Low	63.2	Low	216 Å²	216	135.7 Å²	135.7	95%	0.947	72%	0.717	S	S	*	*			trans	-55.8	103.3	177.1	-90.9	-86	0	0	0	108.9	T53 S57	T53-F55 PolarHBondContact O-N 3.37Å; F55-S57 PolarHBondContact O-N 3.02Å
56	Q	66.4	Low	63.4	Low	171 Å²	171	139.1 Å²	139.1	80%	0.799	72%	0.722	S	S	*	*			trans	-78.4	108.8	167.7	-67.1	-150.7	39.8	0	0	107	G54 I58	G54-Q56 PolarHBondContact O-N 2.84Å; Q56-I58 PolarHBondContact O-N 3.42Å; Q56-I58 VanDerWaalsContact O-N 3.12Å
57	S	66.2	Low	63.5	Low	104 Å²	104	127.6 Å²	127.6	73%	0.727	68%	0.68	S	S	*	*			trans	-68.4	106.4	171.3	-178	0	0	0	0	108.4	F55 Q59	F55-S57 PolarHBondContact O-N 3.02Å; S57-Q59 PolarHBondContact O-N 3.12Å; S57-Q59 VanDerWaalsContact O-N 3.15Å
58	I	69.1	Low	63.7	Low	157 Å²	157	119.1 Å²	119.1	81%	0.805	65%	0.654	S	S	*	*			trans	-76.8	100.5	170.4	-56.6	175.1	0	0	0	106.7	Q56	Q56-I58 PolarHBondContact O-N 3.42Å; Q56-I58 VanDerWaalsContact O-N 3.12Å
59	Q	67.8	Low	63.9	Low	154 Å²	154	122.9 Å²	122.9	72%	0.72	66%	0.656	S	S	*	*	P	Polyproline II helix	trans	-71.6	131.3	170.1	-64.8	-174.7	-0.5	0	0	108.5	S57 M61	S57-Q59 PolarHBondContact O-N 3.12Å; S57-Q59 VanDerWaalsContact O-N 3.15Å; Q59-M61 PolarHBondContact O-N 3.05Å; Q59-M61 VanDerWaalsContact O-N 3.14Å
60	P	61.2	Low	63.8	Low	34 Å²	34	119.6 Å²	119.6	22%	0.221	63%	0.633	C	S	.	*	P	Polyproline II helix	trans	-61.7	121.5	174.3	27.3	-35.1	0	0	0	108.9	G67 F75	P60-G67 WeakPolarHBondContact CB-O 3.03Å; P60-G67 VanDerWaalsContact CG-O 3.29Å; P60-G67 WeakPolarHBondContact CG-O 3.41Å; P60-F75 HydrophobicContact CG-CE1 4.05Å
61	M	68.2	Low	64.3	Low	159 Å²	159	113.9 Å²	113.9	78%	0.783	64%	0.636	S	S	*	*	P	Polyproline II helix	trans	-63.9	151.9	173.5	-66.4	-140.2	-75.8	0	0	110.3	Q59 G63 S64	Q59-M61 PolarHBondContact O-N 3.05Å; Q59-M61 VanDerWaalsContact O-N 3.14Å; M61-G63 PolarHBondContact O-N 3.15Å; M61-G63 VanDerWaalsContact O-N 3.12Å; M61-S64 WeakPolarHBondContact O-CB 3.18Å; M61-S64 PolarHBondContact O-N 3.28Å
62	K	61.1	Low	64.7	Low	190 Å²	190	116.8 Å²	116.8	83%	0.826	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.6	118.2	176.7	-169.3	175.4	-179.4	-177.1	0	109.1
63	G	62.1	Low	64.9	Low	79 Å²	79	109.9 Å²	109.9	81%	0.814	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	96.7	2.7	-173.1	0	0	0	0	0	115.1	M61	M61-G63 PolarHBondContact O-N 3.15Å; M61-G63 VanDerWaalsContact O-N 3.12Å
64	S	63.9	Low	65.1	Low	32 Å²	32	108.5 Å²	108.5	22%	0.224	61%	0.613	C	S	.	*			trans	-58.9	133.7	170.9	175.3	0	0	0	0	110.6	M61 L66 G67	M61-S64 WeakPolarHBondContact O-CB 3.18Å; M61-S64 PolarHBondContact O-N 3.28Å; S64-L66 VanDerWaalsContact O-N 3.07Å; S64-L66 PolarHBondContact OG-N 2.95Å; S64-L66 WeakPolarHBondContact OG-CB 3.46Å; S64-L66 PolarHBondContact O-N 3.27Å; S64-G67 PolarHBondContact O-N 3.28Å
65	P	62.7	Low	65.4	Low	113 Å²	113	110.9 Å²	110.9	73%	0.734	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.3	-15.2	174.4	28.2	-35.1	0	0	0	112.3	G67 R77	P65-G67 PolarHBondContact O-N 3.47Å; P65-R77 WeakPolarHBondContact O-CD 3.41Å
66	L	63.9	Low	65.3	Low	128 Å²	128	104.8 Å²	104.8	67%	0.67	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.7	-5	176	-58.1	175	0	0	0	113	S64 F75	S64-L66 VanDerWaalsContact O-N 3.07Å; S64-L66 PolarHBondContact OG-N 2.95Å; S64-L66 WeakPolarHBondContact OG-CB 3.46Å; S64-L66 PolarHBondContact O-N 3.27Å; L66-F75 WeakPolarHBondContact O-CD1 3.29Å
67	G	63.3	Low	65.1	Low	6 Å²	6	106.4 Å²	106.4	6%	0.062	58%	0.584	C	S	.	*			trans	78.5	165.8	-179.1	0	0	0	0	0	113.1	P60 S64 P65 F75 D76	P60-G67 WeakPolarHBondContact CB-O 3.03Å; P60-G67 VanDerWaalsContact CG-O 3.29Å; P60-G67 WeakPolarHBondContact CG-O 3.41Å; S64-G67 PolarHBondContact O-N 3.28Å; P65-G67 PolarHBondContact O-N 3.47Å; G67-F75 WeakPolarHBondContact O-CD1 3.43Å; G67-D76 WeakPolarHBondContact CA-O 3.49Å
68	V	65.3	Low	64.9	Low	53 Å²	53	114 Å²	114	32%	0.321	60%	0.597	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.4	138	172.3	-93.6	0	0	0	0	109.3	N70 D76	V68-N70 PolarHBondContact O-N 3.06Å; V68-D76 VanDerWaalsContact N-O 3.15Å; V68-D76 PolarHBondContact O-N 3.19Å; V68-D76 PolarHBondContact N-O 3.47Å
69	R	64.7	Low	64.7	Low	173 Å²	173	111.9 Å²	111.9	65%	0.653	59%	0.587	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-66.4	119	172.5	-84.4	-179	158.4	-171.3	-5.9	109.1	F75	R69-F75 HydrophobicContact CG-CD1 4.13Å; R69-F75 HydrophobicContact CG-CD2 4.27Å; R69-F75 HydrophobicContact CG-CE1 3.85Å; R69-F75 HydrophobicContact CG-CE2 3.97Å; R69-F75 HydrophobicContact CG-CG 4.36Å; R69-F75 HydrophobicContact CG-CZ 3.76Å
70	N	65.5	Low	64.5	Low	65 Å²	65	109.7 Å²	109.7	35%	0.348	58%	0.58	S	S	.	*	P	Polyproline II helix	trans	-73.8	172.6	167.1	69.8	14.3	0	0	0	110.4	V68 L72 G73 V74	V68-N70 PolarHBondContact O-N 3.06Å; N70-L72 WeakPolarHBondContact OD1-CA 3.07Å; N70-L72 PolarHBondContact OD1-N 3.02Å; N70-L72 WeakPolarHBondContact OD1-CB 3.16Å; N70-L72 PolarHBondContact O-N 2.89Å; N70-G73 PolarHBondContact O-N 3Å; N70-G73 PolarHBondContact OD1-N 3.07Å; N70-V74 PolarHBondContact N-O 3.43Å; N70-V74 PolarHBondContact OD1-N 3.43Å; N70-V74 PolarHBondContact OD1-O 2.95Å
71	A	65.6	Low	64.7	Low	114 Å²	114	113.9 Å²	113.9	94%	0.942	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.6	-15.4	-179.5	0	0	0	0	0	114
72	L	70.7	Confident	64.5	Low	152 Å²	152	111.2 Å²	111.2	80%	0.796	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.4	4.3	176.2	-56.4	175.3	0	0	0	112.8	N70 V74	N70-L72 WeakPolarHBondContact OD1-CA 3.07Å; N70-L72 PolarHBondContact OD1-N 3.02Å; N70-L72 WeakPolarHBondContact OD1-CB 3.16Å; N70-L72 PolarHBondContact O-N 2.89Å; L72-V74 HydrophobicContact CB-CG2 4.35Å; L72-V74 PolarHBondContact O-N 2.9Å
73	G	64.6	Low	64.7	Low	40 Å²	40	106.3 Å²	106.3	41%	0.412	57%	0.574	S	S	.	*	S	Bend	trans	75.9	7.6	-179.1	0	0	0	0	0	114.6	N70	N70-G73 PolarHBondContact O-N 3Å; N70-G73 PolarHBondContact OD1-N 3.07Å
74	V	65	Low	64.8	Low	84 Å²	84	108.1 Å²	108.1	51%	0.509	56%	0.558	S	S	.	*			trans	-88.4	132.5	179.1	-175.9	0	0	0	0	109.2	N70 L72 D76	N70-V74 PolarHBondContact N-O 3.43Å; N70-V74 PolarHBondContact OD1-N 3.43Å; N70-V74 PolarHBondContact OD1-O 2.95Å; L72-V74 HydrophobicContact CB-CG2 4.35Å; L72-V74 PolarHBondContact O-N 2.9Å; V74-D76 PolarHBondContact O-N 3.08Å
75	F	68.8	Low	64.9	Low	104 Å²	104	113.6 Å²	113.6	46%	0.456	58%	0.582	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-76.9	116.7	174	-78.2	-85.5	0	0	0	109.9	P60 L66 G67 R69	P60-F75 HydrophobicContact CG-CE1 4.05Å; L66-F75 WeakPolarHBondContact O-CD1 3.29Å; G67-F75 WeakPolarHBondContact O-CD1 3.43Å; R69-F75 HydrophobicContact CG-CD1 4.13Å; R69-F75 HydrophobicContact CG-CD2 4.27Å; R69-F75 HydrophobicContact CG-CE1 3.85Å; R69-F75 HydrophobicContact CG-CE2 3.97Å; R69-F75 HydrophobicContact CG-CG 4.36Å; R69-F75 HydrophobicContact CG-CZ 3.76Å
76	D	65.4	Low	65.1	Low	89 Å²	89	113.6 Å²	113.6	48%	0.476	57%	0.57	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-104.5	129.8	178.5	-163.2	5.5	0	0	0	110.4	G67 V68 V74	G67-D76 WeakPolarHBondContact CA-O 3.49Å; V68-D76 VanDerWaalsContact N-O 3.15Å; V68-D76 PolarHBondContact O-N 3.19Å; V68-D76 PolarHBondContact N-O 3.47Å; V74-D76 PolarHBondContact O-N 3.08Å
77	R	62.7	Low	65.2	Low	205 Å²	205	112.4 Å²	112.4	77%	0.774	56%	0.562	S	S	*	*			trans	-99	100.8	172.1	-76.9	-167.4	-82.2	161.6	-7.1	106.3	P65	P65-R77 WeakPolarHBondContact O-CD 3.41Å
78	R	60.7	Low	65.4	Low	264 Å²	264	122.1 Å²	122.1	100%	0.996	61%	0.608	S	S	*	*			trans	-57.8	0	173.1	-68.1	-174.4	-176.3	-172	-2.4	111.5

Retrieved 78 of 78 residues in 48.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).