A0A077YXW0_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YXW0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 33 aa.

						>A0A077YXW0_TRITR|A0A077YXW0
MTPRPENGTILDFLYFSLRRSFMSKIISTAPWV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.5	Very low	71.2	Confident	240 Å²	240	131.9 Å²	131.9	100%	1.182	70%	0.699	S	S	*	*				0	100.8	0	-87.4	170.8	172.1	0	0	107.5	P3	M1-P3 WeakPolarHBondContact O-CD 3.3Å; M1-P3 VanDerWaalsContact O-CD 3.3Å
2	T	65.8	Low	72.4	Confident	121 Å²	121	129.1 Å²	129.1	74%	0.742	69%	0.685	S	S	*	*			trans	-72	112.8	170.9	-51.5	0	0	0	0	106.2	R4	T2-R4 PolarHBondContact O-N 2.95Å
3	P	63.1	Low	73.4	Confident	104 Å²	104	130.5 Å²	130.5	68%	0.675	68%	0.681	S	S	*	*			trans	-61.7	109.5	174.2	26.1	-29.8	0	0	0	104.9	M1 P5	M1-P3 WeakPolarHBondContact O-CD 3.3Å; M1-P3 VanDerWaalsContact O-CD 3.3Å; P3-P5 WeakPolarHBondContact O-CB 2.72Å; P3-P5 WeakPolarHBondContact O-CG 2.99Å; P3-P5 WeakPolarHBondContact O-CD 3.46Å
4	R	65.6	Low	74.6	Confident	242 Å²	242	128.8 Å²	128.8	91%	0.913	67%	0.673	S	S	*	*			trans	-61.7	91.7	-173	-66.6	-179.5	80.2	162.6	3.5	108.5	T2 E6	T2-R4 PolarHBondContact O-N 2.95Å; R4-E6 VanDerWaalsContact C-N 3.35Å
5	P	67	Low	75.5	Confident	71 Å²	71	129.2 Å²	129.2	46%	0.461	66%	0.663	S	S	.	*			trans	-96.4	4.4	-163.3	28.4	-10.2	0	0	0	110.6	P3 T9	P3-P5 WeakPolarHBondContact O-CB 2.72Å; P3-P5 WeakPolarHBondContact O-CG 2.99Å; P3-P5 WeakPolarHBondContact O-CD 3.46Å; P5-T9 VanDerWaalsContact O-CB 3.27Å; P5-T9 WeakPolarHBondContact O-CB 3.27Å; P5-T9 PolarHBondContact O-N 2.57Å; P5-T9 VanDerWaalsContact O-N 3.13Å; P5-T9 PolarHBondContact O-OG1 3.13Å
6	E	67.7	Low	76.2	Confident	163 Å²	163	127.5 Å²	127.5	76%	0.762	65%	0.65	S	S	*	*	H	α-helix	trans	-72.3	-42	-169.4	-140.2	166.3	95.5	0	0	112	R4	R4-E6 VanDerWaalsContact C-N 3.35Å
7	N	70	Confident	76.9	Confident	144 Å²	144	122.9 Å²	122.9	77%	0.77	63%	0.632	S	S	*	*	H	α-helix	trans	-85.6	-27.6	-179.7	-63.3	38.3	0	0	0	112.7
8	G	74.4	Confident	77.6	Confident	41 Å²	41	122.3 Å²	122.3	42%	0.423	63%	0.629	S	S	.	*	H	α-helix	trans	-80.6	-33	-178.1	0	0	0	0	0	113.4	I10 L11 D12	G8-I10 PolarHBondContact O-N 3.5Å; G8-L11 PolarHBondContact O-N 3.36Å; G8-D12 PolarHBondContact O-N 3.45Å; G8-D12 WeakPolarHBondContact O-CB 3.08Å
9	T	84.7	Confident	78.2	Confident	82 Å²	82	122.9 Å²	122.9	50%	0.503	62%	0.623	S	S	.	*	H	α-helix	trans	-66.3	-38.6	-175	-58.3	0	0	0	0	112.4	P5 D12 F13	P5-T9 VanDerWaalsContact O-CB 3.27Å; P5-T9 WeakPolarHBondContact O-CB 3.27Å; P5-T9 PolarHBondContact O-N 2.57Å; P5-T9 VanDerWaalsContact O-N 3.13Å; P5-T9 PolarHBondContact O-OG1 3.13Å; T9-D12 PolarHBondContact O-N 2.81Å; T9-F13 WeakPolarHBondContact O-CB 3.22Å; T9-F13 PolarHBondContact O-N 2.78Å
10	I	88.9	Confident	78.5	Confident	126 Å²	126	124.8 Å²	124.8	65%	0.646	62%	0.622	S	S	*	*	H	α-helix	trans	-67.3	-41.7	176.5	-62.2	167.3	0	0	0	110.2	G8 D12 F13 L14	G8-I10 PolarHBondContact O-N 3.5Å; I10-D12 VanDerWaalsContact C-N 3.32Å; I10-F13 PolarHBondContact O-N 3.25Å; I10-L14 VanDerWaalsContact O-CB 3.22Å; I10-L14 WeakPolarHBondContact O-CB 3.33Å; I10-L14 PolarHBondContact O-N 2.82Å
11	L	88.1	Confident	78.9	Confident	117 Å²	117	122 Å²	122	61%	0.613	62%	0.615	S	S	*	*	H	α-helix	trans	-63.6	-41.1	176.6	-175.8	65.6	0	0	0	111	G8 L14 Y15	G8-L11 PolarHBondContact O-N 3.36Å; L11-L14 PolarHBondContact O-N 3.4Å; L11-Y15 WeakPolarHBondContact O-CB 3.45Å; L11-Y15 PolarHBondContact O-N 2.82Å
12	D	86.5	Confident	80.7	Confident	98 Å²	98	116.5 Å²	116.5	52%	0.524	58%	0.584	S	S	.	*	H	α-helix	trans	-64.3	-47	174.1	-178.7	-103.9	0	0	0	111.5	G8 T9 I10 L14 Y15 F16	G8-D12 PolarHBondContact O-N 3.45Å; G8-D12 WeakPolarHBondContact O-CB 3.08Å; T9-D12 PolarHBondContact O-N 2.81Å; I10-D12 VanDerWaalsContact C-N 3.32Å; D12-L14 VanDerWaalsContact C-N 3.34Å; D12-L14 PolarHBondContact O-N 3.45Å; D12-Y15 CarbonylContact O-C 3.6Å; D12-Y15 PolarHBondContact O-N 2.87Å; D12-F16 WeakPolarHBondContact O-CB 3.19Å; D12-F16 PolarHBondContact O-N 2.76Å
13	F	85.4	Confident	81.2	Confident	147 Å²	147	115.3 Å²	115.3	65%	0.645	57%	0.571	S	S	*	*	H	α-helix	trans	-60.2	-43.7	176.6	-177.3	-96.6	0	0	0	111.8	T9 I10 S17	T9-F13 WeakPolarHBondContact O-CB 3.22Å; T9-F13 PolarHBondContact O-N 2.78Å; I10-F13 PolarHBondContact O-N 3.25Å; F13-S17 WeakPolarHBondContact O-CB 3.17Å; F13-S17 PolarHBondContact O-N 3.25Å; F13-S17 PolarHBondContact O-OG 2.83Å
14	L	89.8	Confident	82	Confident	107 Å²	107	114 Å²	114	56%	0.56	57%	0.565	S	S	*	*	H	α-helix	trans	-65.8	-45.1	176.7	-174.9	67.8	0	0	0	110.8	I10 L11 D12 S17 L18	I10-L14 VanDerWaalsContact O-CB 3.22Å; I10-L14 WeakPolarHBondContact O-CB 3.33Å; I10-L14 PolarHBondContact O-N 2.82Å; L11-L14 PolarHBondContact O-N 3.4Å; D12-L14 VanDerWaalsContact C-N 3.34Å; D12-L14 PolarHBondContact O-N 3.45Å; L14-S17 PolarHBondContact O-N 3.4Å; L14-L18 WeakPolarHBondContact O-CB 3.19Å; L14-L18 PolarHBondContact O-N 2.75Å
15	Y	87.7	Confident	82.6	Confident	135 Å²	135	109 Å²	109	53%	0.529	55%	0.55	S	S	.	.	H	α-helix	trans	-63.1	-44.7	177.5	179.8	-103.5	0	0	0	111.2	L11 D12 R19	L11-Y15 WeakPolarHBondContact O-CB 3.45Å; L11-Y15 PolarHBondContact O-N 2.82Å; D12-Y15 CarbonylContact O-C 3.6Å; D12-Y15 PolarHBondContact O-N 2.87Å; Y15-R19 WeakPolarHBondContact O-CA 2.99Å; Y15-R19 WeakPolarHBondContact O-CB 3.46Å; Y15-R19 PolarHBondContact O-N 2.72Å
16	F	86.3	Confident	83	Confident	102 Å²	102	109.4 Å²	109.4	45%	0.447	55%	0.547	S	S	.	.	H	α-helix	trans	-67.5	-40.7	178.2	-167.6	-103.1	0	0	0	111.9	D12 R20	D12-F16 WeakPolarHBondContact O-CB 3.19Å; D12-F16 PolarHBondContact O-N 2.76Å; F16-R20 VanDerWaalsContact CZ-NH2 3.28Å; F16-R20 WeakPolarHBondContact O-CB 3.36Å; F16-R20 PolarHBondContact O-N 2.93Å
17	S	89.7	Confident	83.3	Confident	50 Å²	50	107.9 Å²	107.9	35%	0.35	54%	0.543	S	S	.	.	H	α-helix	trans	-65.3	-46.8	175.5	-63.4	0	0	0	0	111.7	F13 L14 S21	F13-S17 WeakPolarHBondContact O-CB 3.17Å; F13-S17 PolarHBondContact O-N 3.25Å; F13-S17 PolarHBondContact O-OG 2.83Å; L14-S17 PolarHBondContact O-N 3.4Å; S17-S21 WeakPolarHBondContact O-CB 3.28Å; S17-S21 PolarHBondContact O-N 2.77Å
18	L	89.5	Confident	83.5	Confident	111 Å²	111	105.3 Å²	105.3	58%	0.581	54%	0.536	S	S	*	.	H	α-helix	trans	-64.3	-48	176.7	-174.7	71	0	0	0	110.4	L14 R20 S21 F22	L14-L18 WeakPolarHBondContact O-CB 3.19Å; L14-L18 PolarHBondContact O-N 2.75Å; L18-R20 PolarHBondContact O-N 3.21Å; L18-S21 PolarHBondContact O-N 3.46Å; L18-F22 WeakPolarHBondContact O-CB 3.26Å; L18-F22 VanDerWaalsContact O-CB 3.28Å; L18-F22 PolarHBondContact O-N 2.87Å
19	R	88.9	Confident	83.4	Confident	134 Å²	134	108.4 Å²	108.4	51%	0.506	55%	0.547	S	S	.	.	H	α-helix	trans	-59.8	-46.3	179.1	-178.5	179.4	179.4	-165.4	0.9	111.3	Y15 S21 F22 M23	Y15-R19 WeakPolarHBondContact O-CA 2.99Å; Y15-R19 WeakPolarHBondContact O-CB 3.46Å; Y15-R19 PolarHBondContact O-N 2.72Å; R19-S21 VanDerWaalsContact C-N 3.35Å; R19-S21 PolarHBondContact O-N 3.35Å; R19-F22 PolarHBondContact O-N 3.41Å; R19-M23 HydrophobicContact CG-CG 4.5Å; R19-M23 WeakPolarHBondContact O-CB 3.18Å; R19-M23 VanDerWaalsContact O-CG 3.26Å; R19-M23 WeakPolarHBondContact O-CG 3.22Å; R19-M23 PolarHBondContact O-N 2.99Å
20	R	83.8	Confident	82.4	Confident	160 Å²	160	107.6 Å²	107.6	60%	0.604	55%	0.548	S	S	*	.	H	α-helix	trans	-60.5	-44.9	176.1	-175.6	179.4	-69.6	-146	-5.3	111.1	F16 L18 S24	F16-R20 VanDerWaalsContact CZ-NH2 3.28Å; F16-R20 WeakPolarHBondContact O-CB 3.36Å; F16-R20 PolarHBondContact O-N 2.93Å; L18-R20 PolarHBondContact O-N 3.21Å; R20-S24 PolarHBondContact O-N 2.99Å
21	S	85.8	Confident	81.2	Confident	67 Å²	67	105.6 Å²	105.6	47%	0.469	54%	0.544	S	S	.	.	H	α-helix	trans	-64.2	-45.1	177.5	-174.2	0	0	0	0	112.6	S17 L18 R19 S24 K25	S17-S21 WeakPolarHBondContact O-CB 3.28Å; S17-S21 PolarHBondContact O-N 2.77Å; L18-S21 PolarHBondContact O-N 3.46Å; R19-S21 VanDerWaalsContact C-N 3.35Å; R19-S21 PolarHBondContact O-N 3.35Å; S21-S24 PolarHBondContact O-N 3.19Å; S21-K25 PolarHBondContact O-N 3.5Å
22	F	85.2	Confident	80.1	Confident	125 Å²	125	111.2 Å²	111.2	55%	0.548	56%	0.557	S	S	.	*	H	α-helix	trans	-67.6	-40.2	-177.7	-147.8	-98.8	0	0	0	111.1	L18 R19 K25 I26	L18-F22 WeakPolarHBondContact O-CB 3.26Å; L18-F22 VanDerWaalsContact O-CB 3.28Å; L18-F22 PolarHBondContact O-N 2.87Å; R19-F22 PolarHBondContact O-N 3.41Å; F22-K25 CarbonylContact O-C 3.57Å; F22-K25 PolarHBondContact O-N 3.23Å; F22-I26 HydrophobicContact CD1-CD1 3.37Å; F22-I26 HydrophobicContact CD1-CG1 3.81Å; F22-I26 HydrophobicContact CE1-CD1 3.73Å; F22-I26 HydrophobicContact CE1-CG1 3.95Å; F22-I26 HydrophobicContact CG-CD1 4.47Å; F22-I26 VanDerWaalsContact O-CG1 3.25Å; F22-I26 WeakPolarHBondContact O-CG1 3.2Å; F22-I26 PolarHBondContact O-N 3.06Å
23	M	76.8	Confident	78.6	Confident	96 Å²	96	116.4 Å²	116.4	47%	0.473	59%	0.592	S	S	.	*	H	α-helix	trans	-61.5	-45.9	174.4	-71.5	-65.6	153.7	0	0	111.7	R19 K25 I26 I27	R19-M23 HydrophobicContact CG-CG 4.5Å; R19-M23 WeakPolarHBondContact O-CB 3.18Å; R19-M23 VanDerWaalsContact O-CG 3.26Å; R19-M23 WeakPolarHBondContact O-CG 3.22Å; R19-M23 PolarHBondContact O-N 2.99Å; M23-K25 VanDerWaalsContact C-N 3.29Å; M23-K25 PolarHBondContact O-N 3.25Å; M23-I26 HydrophobicContact CE-CD1 4.3Å; M23-I26 PolarHBondContact O-N 2.7Å; M23-I26 HydrophobicContact SD-CD1 4.29Å; M23-I27 WeakPolarHBondContact O-CD1 3.25Å; M23-I27 WeakPolarHBondContact O-CG1 3.43Å; M23-I27 PolarHBondContact O-N 3.37Å
24	S	79.3	Confident	78.3	Confident	76 Å²	76	114.9 Å²	114.9	53%	0.531	59%	0.589	S	S	.	*	H	α-helix	trans	-61.1	-37	174.3	-69.1	0	0	0	0	112.6	R20 S21 S28	R20-S24 PolarHBondContact O-N 2.99Å; S21-S24 PolarHBondContact O-N 3.19Å; S24-S28 WeakPolarHBondContact O-CB 3.12Å; S24-S28 PolarHBondContact O-N 3.39Å
25	K	78.4	Confident	77.6	Confident	138 Å²	138	115.3 Å²	115.3	60%	0.6	59%	0.591	S	S	*	*	H	α-helix	trans	-69.3	-41.3	173.9	-95.9	-177.4	174.3	-176.6	0	113.2	S21 F22 M23 S28 T29	S21-K25 PolarHBondContact O-N 3.5Å; F22-K25 CarbonylContact O-C 3.57Å; F22-K25 PolarHBondContact O-N 3.23Å; M23-K25 VanDerWaalsContact C-N 3.29Å; M23-K25 PolarHBondContact O-N 3.25Å; K25-S28 CarbonylContact O-C 3.6Å; K25-S28 PolarHBondContact O-N 2.77Å; K25-T29 WeakPolarHBondContact O-CA 3.48Å; K25-T29 PolarHBondContact O-OG1 3.33Å; K25-T29 PolarHBondContact O-N 2.76Å; K25-T29 WeakPolarHBondContact O-CB 3.48Å
26	I	76.5	Confident	77.1	Confident	78 Å²	78	114.2 Å²	114.2	40%	0.4	59%	0.594	S	S	.	*	H	α-helix	trans	-61.2	-50.9	179.4	-71.3	163.3	0	0	0	109.6	F22 M23 S28 T29 A30	F22-I26 HydrophobicContact CD1-CD1 3.37Å; F22-I26 HydrophobicContact CD1-CG1 3.81Å; F22-I26 HydrophobicContact CE1-CD1 3.73Å; F22-I26 HydrophobicContact CE1-CG1 3.95Å; F22-I26 HydrophobicContact CG-CD1 4.47Å; F22-I26 VanDerWaalsContact O-CG1 3.25Å; F22-I26 WeakPolarHBondContact O-CG1 3.2Å; F22-I26 PolarHBondContact O-N 3.06Å; M23-I26 HydrophobicContact CE-CD1 4.3Å; M23-I26 PolarHBondContact O-N 2.7Å; M23-I26 HydrophobicContact SD-CD1 4.29Å; I26-S28 VanDerWaalsContact C-N 3.26Å; I26-S28 PolarHBondContact O-N 3.04Å; I26-T29 PolarHBondContact O-N 3.37Å; I26-A30 WeakPolarHBondContact O-CB 3.15Å; I26-A30 PolarHBondContact O-N 3.07Å
27	I	73.6	Confident	76.6	Confident	131 Å²	131	114.9 Å²	114.9	67%	0.672	60%	0.603	S	S	*	*	H	α-helix	trans	-66.2	-34.6	-178.7	-46.4	150.6	0	0	0	110.2	M23	M23-I27 WeakPolarHBondContact O-CD1 3.25Å; M23-I27 WeakPolarHBondContact O-CG1 3.43Å; M23-I27 PolarHBondContact O-N 3.37Å
28	S	73.4	Confident	75.7	Confident	90 Å²	90	118.9 Å²	118.9	63%	0.629	62%	0.618	S	S	*	*	H	α-helix	trans	-82	-23.1	-179.9	-172.3	0	0	0	0	114.8	S24 K25 I26	S24-S28 WeakPolarHBondContact O-CB 3.12Å; S24-S28 PolarHBondContact O-N 3.39Å; K25-S28 CarbonylContact O-C 3.6Å; K25-S28 PolarHBondContact O-N 2.77Å; I26-S28 VanDerWaalsContact C-N 3.26Å; I26-S28 PolarHBondContact O-N 3.04Å
29	T	72	Confident	74.8	Confident	106 Å²	106	119.5 Å²	119.5	65%	0.65	62%	0.621	S	S	*	*	H	α-helix	trans	-101.6	-19.8	-175.3	-49.3	0	0	0	0	112.5	K25 I26 P31	K25-T29 WeakPolarHBondContact O-CA 3.48Å; K25-T29 PolarHBondContact O-OG1 3.33Å; K25-T29 PolarHBondContact O-N 2.76Å; K25-T29 WeakPolarHBondContact O-CB 3.48Å; I26-T29 PolarHBondContact O-N 3.37Å; T29-P31 WeakPolarHBondContact O-CD 3.08Å
30	A	64.6	Low	73.8	Confident	65 Å²	65	118.4 Å²	118.4	54%	0.537	63%	0.629	S	S	.	*			trans	-104.6	51.6	173.2	0	0	0	0	0	114.4	I26 W32	I26-A30 WeakPolarHBondContact O-CB 3.15Å; I26-A30 PolarHBondContact O-N 3.07Å; A30-W32 PolarHBondContact O-N 3.17Å; A30-W32 VanDerWaalsContact O-N 3.17Å
31	P	64.8	Low	73	Confident	85 Å²	85	115.2 Å²	115.2	55%	0.552	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.7	33.1	167.6	31.3	-28.5	0	0	0	112.8	T29	T29-P31 WeakPolarHBondContact O-CD 3.08Å
32	W	65	Low	72	Confident	234 Å²	234	119.3 Å²	119.3	89%	0.886	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-144.5	30	-172.9	-54.6	78.5	0	0	0	115.1	A30	A30-W32 PolarHBondContact O-N 3.17Å; A30-W32 VanDerWaalsContact O-N 3.17Å
33	V	54	Low	70.8	Confident	207 Å²	207	118.7 Å²	118.7	100%	1.255	65%	0.653	S	S	*	*			trans	-107.7	0	147.3	-175	0	0	0	0	106.5

Retrieved 33 of 33 residues in 28.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).