A0A077YY86_TRITR Loading...

ATP-synt Eps domain containing protein

AlphaFold DB , UniProt , Accession A0A077YY86, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 59 aa.

						>A0A077YY86_TRITR|A0A077YY86
MTLFYWRMAGVNYIRYSEIAGKIVRSCLKEPLRSEALKREGTTVKFARWKDGKQVAKAE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.1	Low	81.4	Confident	221 Å²	221	115.1 Å²	115.1	100%	1.089	60%	0.6	S	S	*	*				0	102.5	0	-76.5	-85.6	-154.2	0	0	107.6	L3	M1-L3 PolarHBondContact O-N 3.14Å
2	T	69.4	Low	82.2	Confident	125 Å²	125	113 Å²	113	77%	0.767	59%	0.59	S	S	*	*			trans	-66.5	93.2	179.7	-0.1	0	0	0	0	109	F4	T2-F4 PolarHBondContact O-N 3.09Å; T2-F4 VanDerWaalsContact O-N 3.17Å
3	L	73.3	Confident	82.8	Confident	104 Å²	104	115.5 Å²	115.5	55%	0.545	59%	0.589	S	S	.	*			trans	-77.9	100.8	-175.4	-71.9	156.4	0	0	0	109.4	M1 Y5 M8	M1-L3 PolarHBondContact O-N 3.14Å; L3-Y5 PolarHBondContact O-N 3.31Å; L3-M8 HydrophobicContact CB-SD 4.44Å; L3-M8 HydrophobicContact CD2-CE 3.82Å; L3-M8 HydrophobicContact CD2-SD 3.37Å; L3-M8 WeakPolarHBondContact CD2-SD 3.49Å; L3-M8 HydrophobicContact CG-SD 4.47Å
4	F	84.5	Confident	83.4	Confident	110 Å²	110	115.4 Å²	115.4	48%	0.482	59%	0.588	S	S	.	*			trans	-85.2	103.3	165.7	-64.6	-69.1	0	0	0	108.6	T2 W6 R7 M8	T2-F4 PolarHBondContact O-N 3.09Å; T2-F4 VanDerWaalsContact O-N 3.17Å; F4-W6 HydrophobicContact CB-CD2 4.34Å; F4-W6 HydrophobicContact CB-CZ2 4.1Å; F4-W6 HydrophobicContact CD1-CZ2 4.24Å; F4-W6 AromaticContact CD1-NE1 3.72Å; F4-W6 HydrophobicContact CG-CZ2 4.1Å; F4-W6 AromaticContact CG-NE1 3.98Å; F4-W6 PolarHBondContact O-N 3.28Å; F4-W6 VanDerWaalsContact O-N 3.12Å; F4-R7 HydrophobicContact CB-CB 4.06Å; F4-R7 HydrophobicContact CB-CG 3.82Å; F4-R7 WeakPolarHBondContact O-CA 3.43Å; F4-R7 WeakPolarHBondContact O-CB 3.42Å; F4-R7 PolarHBondContact O-N 3.05Å; F4-M8 PolarHBondContact O-N 3.02Å
5	Y	85.9	Confident	83.9	Confident	184 Å²	184	116.9 Å²	116.9	72%	0.722	58%	0.584	S	S	*	*	H	α-helix	trans	-52.8	-36.4	-178	-67.5	-76	0	0	0	113.5	L3 R7 M8 A9	L3-Y5 PolarHBondContact O-N 3.31Å; Y5-R7 VanDerWaalsContact C-N 3.33Å; Y5-R7 PolarHBondContact O-N 3.28Å; Y5-M8 PolarHBondContact O-N 2.91Å; Y5-A9 PolarHBondContact O-N 2.94Å
6	W	85.3	Confident	84.4	Confident	52 Å²	52	116.5 Å²	116.5	20%	0.197	57%	0.574	C	S	.	*	H	α-helix	trans	-65.7	-33.9	177.1	56.2	-94.8	0	0	0	112.7	F4 A9 V11 Y13 Y16	F4-W6 HydrophobicContact CB-CD2 4.34Å; F4-W6 HydrophobicContact CB-CZ2 4.1Å; F4-W6 HydrophobicContact CD1-CZ2 4.24Å; F4-W6 AromaticContact CD1-NE1 3.72Å; F4-W6 HydrophobicContact CG-CZ2 4.1Å; F4-W6 AromaticContact CG-NE1 3.98Å; F4-W6 PolarHBondContact O-N 3.28Å; F4-W6 VanDerWaalsContact O-N 3.12Å; W6-A9 PolarHBondContact O-N 3.1Å; W6-V11 WeakPolarHBondContact O-CB 3.37Å; W6-V11 PolarHBondContact O-N 3.36Å; W6-Y13 HydrophobicContact CH2-CD2 4.31Å; W6-Y16 HydrophobicContact CB-CD2 3.68Å; W6-Y16 HydrophobicContact CB-CE2 4.33Å; W6-Y16 HydrophobicContact CB-CG 4.2Å; W6-Y16 AromaticContact CD1-CD2 4Å; W6-Y16 AromaticContact CD1-CE2 3.98Å; W6-Y16 HydrophobicContact CD2-CG 4.38Å; W6-Y16 AromaticContact CG-CD2 3.85Å; W6-Y16 HydrophobicContact CG-CD2 3.85Å; W6-Y16 HydrophobicContact CG-CE2 4.29Å; W6-Y16 HydrophobicContact CG-CG 4.09Å
7	R	86.2	Confident	84.8	Confident	159 Å²	159	113.2 Å²	113.2	60%	0.6	57%	0.566	S	S	*	*	H	α-helix	trans	-67.4	-42.1	172.8	-73	-66.8	-157.3	172.2	6.9	111.5	F4 Y5 A9 G10	F4-R7 HydrophobicContact CB-CB 4.06Å; F4-R7 HydrophobicContact CB-CG 3.82Å; F4-R7 WeakPolarHBondContact O-CA 3.43Å; F4-R7 WeakPolarHBondContact O-CB 3.42Å; F4-R7 PolarHBondContact O-N 3.05Å; Y5-R7 VanDerWaalsContact C-N 3.33Å; Y5-R7 PolarHBondContact O-N 3.28Å; R7-A9 VanDerWaalsContact C-N 3.28Å; R7-A9 PolarHBondContact O-N 3.46Å; R7-G10 PolarHBondContact O-N 3.45Å; R7-G10 VanDerWaalsContact O-N 3.13Å
8	M	86.9	Confident	85.2	Confident	129 Å²	129	112.2 Å²	112.2	64%	0.635	56%	0.559	S	S	*	*	H	α-helix	trans	-65.8	-33.3	178.4	-62.1	-177.4	83.4	0	0	112.1	L3 F4 Y5 G10	L3-M8 HydrophobicContact CB-SD 4.44Å; L3-M8 HydrophobicContact CD2-CE 3.82Å; L3-M8 HydrophobicContact CD2-SD 3.37Å; L3-M8 WeakPolarHBondContact CD2-SD 3.49Å; L3-M8 HydrophobicContact CG-SD 4.47Å; F4-M8 PolarHBondContact O-N 3.02Å; Y5-M8 PolarHBondContact O-N 2.91Å; M8-G10 PolarHBondContact O-N 3.45Å
9	A	87.9	Confident	85.5	Confident	73 Å²	73	110.2 Å²	110.2	60%	0.603	55%	0.55	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.1	2.3	174.7	0	0	0	0	0	114	Y5 W6 R7 V11	Y5-A9 PolarHBondContact O-N 2.94Å; W6-A9 PolarHBondContact O-N 3.1Å; R7-A9 VanDerWaalsContact C-N 3.28Å; R7-A9 PolarHBondContact O-N 3.46Å; A9-V11 HydrophobicContact CB-CG2 3.98Å; A9-V11 PolarHBondContact O-N 3.42Å
10	G	88.8	Confident	85.9	Confident	71 Å²	71	106.8 Å²	106.8	73%	0.732	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	72	14	-177.1	0	0	0	0	0	113.7	R7 M8	R7-G10 PolarHBondContact O-N 3.45Å; R7-G10 VanDerWaalsContact O-N 3.13Å; M8-G10 PolarHBondContact O-N 3.45Å
11	V	89.8	Confident	86.2	Confident	38 Å²	38	102.7 Å²	102.7	23%	0.23	52%	0.524	C	S	.	.			trans	-87.2	127.3	-179.3	-173.2	0	0	0	0	108.8	W6 A9 R15	W6-V11 WeakPolarHBondContact O-CB 3.37Å; W6-V11 PolarHBondContact O-N 3.36Å; A9-V11 HydrophobicContact CB-CG2 3.98Å; A9-V11 PolarHBondContact O-N 3.42Å; V11-R15 HydrophobicContact CG1-CB 3.51Å; V11-R15 HydrophobicContact CG1-CG 3.5Å
12	N	91.6	Very high	87.8	Confident	90 Å²	90	97.2 Å²	97.2	48%	0.481	49%	0.494	S	S	.	.			trans	-73.4	161.9	172	68.2	33.1	0	0	0	110.6	I14 R15 Y16	N12-I14 PolarHBondContact O-N 3.07Å; N12-I14 PolarHBondContact OD1-N 3.38Å; N12-R15 PolarHBondContact O-N 2.92Å; N12-R15 VanDerWaalsContact OD1-CB 3.27Å; N12-R15 WeakPolarHBondContact OD1-CB 3.49Å; N12-R15 PolarHBondContact OD1-N 3.33Å; N12-Y16 PolarHBondContact O-N 3.35Å
13	Y	89.8	Confident	88.9	Confident	146 Å²	146	95.9 Å²	95.9	57%	0.573	48%	0.481	S	S	*	.	H	α-helix	trans	-58.7	-36.9	-177.6	175.6	-105.4	0	0	0	112.8	W6 R15 Y16 S17	W6-Y13 HydrophobicContact CH2-CD2 4.31Å; Y13-R15 PolarHBondContact O-N 3.43Å; Y13-Y16 HydrophobicContact CD2-CD1 4.47Å; Y13-Y16 PolarHBondContact O-N 3.26Å; Y13-S17 PolarHBondContact O-N 3.45Å
14	I	91.7	Very high	89.8	Confident	113 Å²	113	95.7 Å²	95.7	58%	0.579	48%	0.484	S	S	*	.	H	α-helix	trans	-59	-51	178.3	-60.6	174.1	0	0	0	109.7	N12 Y16 S17 E18	N12-I14 PolarHBondContact O-N 3.07Å; N12-I14 PolarHBondContact OD1-N 3.38Å; I14-Y16 VanDerWaalsContact C-N 3.34Å; I14-Y16 PolarHBondContact O-N 3.32Å; I14-S17 WeakPolarHBondContact O-CB 3.48Å; I14-S17 PolarHBondContact O-N 2.88Å; I14-S17 VanDerWaalsContact O-N 3.17Å; I14-E18 HydrophobicContact CG2-CG 4.46Å; I14-E18 WeakPolarHBondContact O-CG 3.38Å; I14-E18 PolarHBondContact O-N 3.13Å
15	R	90.7	Very high	90.1	Very high	139 Å²	139	94.2 Å²	94.2	53%	0.525	48%	0.475	S	S	.	.	H	α-helix	trans	-65.6	-36.8	-179.4	-177.3	58.2	171.4	-171.8	-0.6	112.3	V11 N12 Y13 E18 I19	V11-R15 HydrophobicContact CG1-CB 3.51Å; V11-R15 HydrophobicContact CG1-CG 3.5Å; N12-R15 PolarHBondContact O-N 2.92Å; N12-R15 VanDerWaalsContact OD1-CB 3.27Å; N12-R15 WeakPolarHBondContact OD1-CB 3.49Å; N12-R15 PolarHBondContact OD1-N 3.33Å; Y13-R15 PolarHBondContact O-N 3.43Å; R15-E18 WeakPolarHBondContact CD-OE2 3.28Å; R15-E18 IonicContact CZ-OE2 3.93Å; R15-E18 IonicContact NH1-OE2 3.01Å; R15-E18 PolarHBondContact NH1-OE2 3.28Å; R15-E18 PolarHBondContact O-N 3.05Å; R15-I19 HydrophobicContact CG-CD1 4.17Å; R15-I19 WeakPolarHBondContact O-CD1 3.28Å; R15-I19 VanDerWaalsContact O-CG1 3.23Å; R15-I19 WeakPolarHBondContact O-CG1 3.29Å; R15-I19 PolarHBondContact O-N 3.48Å
16	Y	91.3	Very high	90.3	Very high	110 Å²	110	87.6 Å²	87.6	43%	0.431	46%	0.456	S	S	.	.	H	α-helix	trans	-59.8	-48.2	172	171.3	-101.3	0	0	0	111.5	W6 N12 Y13 I14 E18 I19 A20	W6-Y16 HydrophobicContact CB-CD2 3.68Å; W6-Y16 HydrophobicContact CB-CE2 4.33Å; W6-Y16 HydrophobicContact CB-CG 4.2Å; W6-Y16 AromaticContact CD1-CD2 4Å; W6-Y16 AromaticContact CD1-CE2 3.98Å; W6-Y16 HydrophobicContact CD2-CG 4.38Å; W6-Y16 AromaticContact CG-CD2 3.85Å; W6-Y16 HydrophobicContact CG-CD2 3.85Å; W6-Y16 HydrophobicContact CG-CE2 4.29Å; W6-Y16 HydrophobicContact CG-CG 4.09Å; N12-Y16 PolarHBondContact O-N 3.35Å; Y13-Y16 HydrophobicContact CD2-CD1 4.47Å; Y13-Y16 PolarHBondContact O-N 3.26Å; I14-Y16 VanDerWaalsContact C-N 3.34Å; I14-Y16 PolarHBondContact O-N 3.32Å; Y16-E18 PolarHBondContact O-N 3.29Å; Y16-I19 PolarHBondContact O-N 2.62Å; Y16-A20 PolarHBondContact O-N 3.28Å
17	S	92.2	Very high	90.7	Very high	61 Å²	61	90 Å²	90	43%	0.427	48%	0.479	S	S	.	.	H	α-helix	trans	-64.3	-38.1	177.6	-173.7	0	0	0	0	112.7	Y13 I14 A20 G21	Y13-S17 PolarHBondContact O-N 3.45Å; I14-S17 WeakPolarHBondContact O-CB 3.48Å; I14-S17 PolarHBondContact O-N 2.88Å; I14-S17 VanDerWaalsContact O-N 3.17Å; S17-A20 PolarHBondContact O-N 3.33Å; S17-G21 PolarHBondContact O-N 3.43Å
18	E	91.8	Very high	90.9	Very high	95 Å²	95	85.9 Å²	85.9	44%	0.444	47%	0.469	S	S	.	.	H	α-helix	trans	-59.7	-45.9	174.3	-75.1	176.5	166.5	0	0	111.5	I14 R15 Y16 G21 K22	I14-E18 HydrophobicContact CG2-CG 4.46Å; I14-E18 WeakPolarHBondContact O-CG 3.38Å; I14-E18 PolarHBondContact O-N 3.13Å; R15-E18 WeakPolarHBondContact CD-OE2 3.28Å; R15-E18 IonicContact CZ-OE2 3.93Å; R15-E18 IonicContact NH1-OE2 3.01Å; R15-E18 PolarHBondContact NH1-OE2 3.28Å; R15-E18 PolarHBondContact O-N 3.05Å; Y16-E18 PolarHBondContact O-N 3.29Å; E18-G21 PolarHBondContact O-N 3.05Å; E18-K22 WeakPolarHBondContact O-CB 3.42Å; E18-K22 PolarHBondContact O-N 2.87Å
19	I	91.1	Very high	91.2	Very high	74 Å²	74	88.4 Å²	88.4	38%	0.379	48%	0.476	S	S	.	.	H	α-helix	trans	-62.5	-47.3	178.7	-68.1	163.3	0	0	0	110.3	R15 Y16 G21 K22 I23	R15-I19 HydrophobicContact CG-CD1 4.17Å; R15-I19 WeakPolarHBondContact O-CD1 3.28Å; R15-I19 VanDerWaalsContact O-CG1 3.23Å; R15-I19 WeakPolarHBondContact O-CG1 3.29Å; R15-I19 PolarHBondContact O-N 3.48Å; Y16-I19 PolarHBondContact O-N 2.62Å; I19-G21 VanDerWaalsContact C-N 3.33Å; I19-G21 PolarHBondContact O-N 3.46Å; I19-K22 WeakPolarHBondContact O-CB 3.32Å; I19-K22 PolarHBondContact O-N 3.01Å; I19-I23 HydrophobicContact CG2-CD1 4.02Å; I19-I23 WeakPolarHBondContact O-CG1 3.5Å; I19-I23 PolarHBondContact O-N 3.46Å
20	A	92.3	Very high	91.4	Very high	41 Å²	41	89.6 Å²	89.6	34%	0.339	47%	0.469	S	S	.	.	H	α-helix	trans	-58.8	-45	176.5	0	0	0	0	0	111.6	Y16 S17 K22 I23 V24	Y16-A20 PolarHBondContact O-N 3.28Å; S17-A20 PolarHBondContact O-N 3.33Å; A20-K22 PolarHBondContact O-N 3.17Å; A20-I23 PolarHBondContact O-N 3.12Å; A20-V24 WeakPolarHBondContact O-CG2 3.48Å; A20-V24 PolarHBondContact O-N 3.17Å
21	G	92.5	Very high	91.3	Very high	21 Å²	21	91.1 Å²	91.1	22%	0.216	47%	0.466	C	S	.	.	H	α-helix	trans	-62	-40.6	176.8	0	0	0	0	0	113.4	S17 E18 I19 V24 R25	S17-G21 PolarHBondContact O-N 3.43Å; E18-G21 PolarHBondContact O-N 3.05Å; I19-G21 VanDerWaalsContact C-N 3.33Å; I19-G21 PolarHBondContact O-N 3.46Å; G21-V24 PolarHBondContact O-N 3.26Å; G21-R25 VanDerWaalsContact O-CG 3.29Å; G21-R25 WeakPolarHBondContact O-CG 3.37Å; G21-R25 PolarHBondContact O-N 2.92Å
22	K	91.6	Very high	91.3	Very high	106 Å²	106	94.1 Å²	94.1	46%	0.461	48%	0.48	S	S	.	.	H	α-helix	trans	-60	-45.2	174.1	165.5	167.7	-174.2	116.5	0	112.2	E18 I19 A20 R25 S26 E40	E18-K22 WeakPolarHBondContact O-CB 3.42Å; E18-K22 PolarHBondContact O-N 2.87Å; I19-K22 WeakPolarHBondContact O-CB 3.32Å; I19-K22 PolarHBondContact O-N 3.01Å; A20-K22 PolarHBondContact O-N 3.17Å; K22-R25 PolarHBondContact O-N 2.86Å; K22-S26 WeakPolarHBondContact O-CB 3.37Å; K22-S26 PolarHBondContact O-N 3.25Å; K22-S26 PolarHBondContact O-OG 3.01Å; K22-E40 VanDerWaalsContact CG-OE1 3.29Å; K22-E40 WeakPolarHBondContact CG-OE1 3.46Å; K22-E40 IonicContact NZ-OE2 2.73Å; K22-E40 PolarHBondContact NZ-OE2 3.33Å
23	I	92.3	Very high	91.2	Very high	98 Å²	98	94.7 Å²	94.7	50%	0.503	48%	0.476	S	S	.	.	H	α-helix	trans	-61.4	-49	178	-66.5	167.4	0	0	0	110	I19 A20 R25 S26 C27	I19-I23 HydrophobicContact CG2-CD1 4.02Å; I19-I23 WeakPolarHBondContact O-CG1 3.5Å; I19-I23 PolarHBondContact O-N 3.46Å; A20-I23 PolarHBondContact O-N 3.12Å; I23-R25 VanDerWaalsContact C-N 3.31Å; I23-R25 PolarHBondContact O-N 3.31Å; I23-S26 WeakPolarHBondContact O-CA 3.4Å; I23-S26 WeakPolarHBondContact O-CB 3.33Å; I23-S26 PolarHBondContact O-N 2.9Å; I23-C27 PolarHBondContact O-N 3.2Å; I23-C27 VanDerWaalsContact O-N 3.1Å; I23-C27 PolarHBondContact O-SG 3.46Å
24	V	92.1	Very high	91.1	Very high	99 Å²	99	90.7 Å²	90.7	60%	0.6	47%	0.469	S	S	*	.	H	α-helix	trans	-57.3	-43.5	179	172.5	0	0	0	0	111.8	A20 G21 S26 C27	A20-V24 WeakPolarHBondContact O-CG2 3.48Å; A20-V24 PolarHBondContact O-N 3.17Å; G21-V24 PolarHBondContact O-N 3.26Å; V24-S26 VanDerWaalsContact C-N 3.31Å; V24-S26 PolarHBondContact O-N 3.42Å; V24-C27 PolarHBondContact O-N 3.42Å
25	R	91.4	Very high	91	Very high	80 Å²	80	90.8 Å²	90.8	30%	0.302	47%	0.467	S	S	.	.	H	α-helix	trans	-65.8	-34.1	176.8	-66.9	175.7	-159.5	134.2	2.3	112.6	G21 K22 I23 C27 L28 A36	G21-R25 VanDerWaalsContact O-CG 3.29Å; G21-R25 WeakPolarHBondContact O-CG 3.37Å; G21-R25 PolarHBondContact O-N 2.92Å; K22-R25 PolarHBondContact O-N 2.86Å; I23-R25 VanDerWaalsContact C-N 3.31Å; I23-R25 PolarHBondContact O-N 3.31Å; R25-C27 VanDerWaalsContact C-N 3.28Å; R25-C27 PolarHBondContact O-N 3.08Å; R25-L28 WeakPolarHBondContact O-CB 3.45Å; R25-L28 PolarHBondContact O-N 3.23Å; R25-A36 HydrophobicContact CB-CB 3.9Å; R25-A36 HydrophobicContact CG-CB 3.89Å
26	S	90.2	Very high	90.9	Very high	44 Å²	44	84.4 Å²	84.4	31%	0.308	44%	0.444	S	S	.	.	H	α-helix	trans	-70.3	-24.6	178.1	-60.8	0	0	0	0	112.9	K22 I23 V24 L28	K22-S26 WeakPolarHBondContact O-CB 3.37Å; K22-S26 PolarHBondContact O-N 3.25Å; K22-S26 PolarHBondContact O-OG 3.01Å; I23-S26 WeakPolarHBondContact O-CA 3.4Å; I23-S26 WeakPolarHBondContact O-CB 3.33Å; I23-S26 PolarHBondContact O-N 2.9Å; V24-S26 VanDerWaalsContact C-N 3.31Å; V24-S26 PolarHBondContact O-N 3.42Å; S26-L28 VanDerWaalsContact C-N 3.32Å
27	C	92.9	Very high	90.6	Very high	103 Å²	103	82 Å²	82	70%	0.696	44%	0.439	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.1	-8.6	176.9	-63.6	0	0	0	0	113.9	I23 V24 R25	I23-C27 PolarHBondContact O-N 3.2Å; I23-C27 VanDerWaalsContact O-N 3.1Å; I23-C27 PolarHBondContact O-SG 3.46Å; V24-C27 PolarHBondContact O-N 3.42Å; R25-C27 VanDerWaalsContact C-N 3.28Å; R25-C27 PolarHBondContact O-N 3.08Å
28	L	91.4	Very high	90.3	Very high	73 Å²	73	87.3 Å²	87.3	38%	0.382	45%	0.454	S	S	.	.	S	Bend	trans	-69.8	152.4	177.1	-65.9	168.9	0	0	0	111.1	R25 S26 L32 R33 A36	R25-L28 WeakPolarHBondContact O-CB 3.45Å; R25-L28 PolarHBondContact O-N 3.23Å; S26-L28 VanDerWaalsContact C-N 3.32Å; L28-L32 HydrophobicContact CB-CB 4.42Å; L28-R33 HydrophobicContact CB-CB 4.13Å; L28-R33 WeakPolarHBondContact O-CB 3.5Å; L28-A36 HydrophobicContact CD1-CB 3.87Å
29	K	91.9	Very high	89.8	Confident	182 Å²	182	91 Å²	91	79%	0.791	46%	0.464	S	S	*	.	P	Polyproline II helix	trans	-82.1	154.9	171.6	-164.6	173.1	180	178.3	0	110.3	L32 R33	K29-L32 PolarHBondContact O-N 3.36Å; K29-L32 VanDerWaalsContact O-N 3.09Å; K29-R33 PolarHBondContact O-N 2.94Å; K29-R33 VanDerWaalsContact O-N 3.14Å
30	E	91.5	Very high	89.2	Confident	97 Å²	97	90 Å²	90	45%	0.453	46%	0.457	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.3	142.2	168.4	-64.8	-55.7	151.6	0	0	110.8	R33 S34	E30-R33 WeakPolarHBondContact OE1-CB 3.35Å; E30-R33 WeakPolarHBondContact OE1-CD 3.23Å; E30-S34 PolarHBondContact OE1-OG 3.2Å; E30-S34 WeakPolarHBondContact OE2-CB 3.29Å; E30-S34 PolarHBondContact OE2-N 3.03Å; E30-S34 PolarHBondContact OE2-OG 2.78Å
31	P	88.5	Confident	88.3	Confident	104 Å²	104	91 Å²	91	68%	0.675	47%	0.472	S	S	*	.	T	Hydrogen-bonded Turn	cis	-90.1	-5.3	7.6	35.2	-36.1	0	0	0	115.3	R33 S34 E35	P31-R33 VanDerWaalsContact C-N 3.27Å; P31-R33 PolarHBondContact O-N 3.32Å; P31-S34 PolarHBondContact O-N 3.49Å; P31-E35 PolarHBondContact O-N 3.06Å
32	L	89.1	Confident	87.6	Confident	100 Å²	100	95.8 Å²	95.8	52%	0.524	50%	0.497	S	S	.	.	H	α-helix	trans	-64.6	-32	-173.5	-62.9	175.6	0	0	0	112.6	L28 K29 E35 A36	L28-L32 HydrophobicContact CB-CB 4.42Å; K29-L32 PolarHBondContact O-N 3.36Å; K29-L32 VanDerWaalsContact O-N 3.09Å; L32-E35 PolarHBondContact O-N 3.43Å; L32-A36 VanDerWaalsContact O-CB 3.28Å; L32-A36 WeakPolarHBondContact O-CB 3.48Å; L32-A36 PolarHBondContact O-N 3.45Å
33	R	88.6	Confident	86.9	Confident	103 Å²	103	97.1 Å²	97.1	39%	0.389	52%	0.515	S	S	.	.	H	α-helix	trans	-59.7	-51.8	174.7	179.4	177.8	178.6	-164	2.5	111.6	L28 K29 E30 P31 E35 A36 L37	L28-R33 HydrophobicContact CB-CB 4.13Å; L28-R33 WeakPolarHBondContact O-CB 3.5Å; K29-R33 PolarHBondContact O-N 2.94Å; K29-R33 VanDerWaalsContact O-N 3.14Å; E30-R33 WeakPolarHBondContact OE1-CB 3.35Å; E30-R33 WeakPolarHBondContact OE1-CD 3.23Å; P31-R33 VanDerWaalsContact C-N 3.27Å; P31-R33 PolarHBondContact O-N 3.32Å; R33-E35 VanDerWaalsContact C-N 3.28Å; R33-E35 PolarHBondContact O-N 2.73Å; R33-A36 PolarHBondContact O-N 3.44Å; R33-A36 VanDerWaalsContact O-N 3.13Å; R33-L37 HydrophobicContact CG-CD1 3.84Å; R33-L37 HydrophobicContact CG-CG 4.2Å; R33-L37 WeakPolarHBondContact O-CB 3.44Å; R33-L37 VanDerWaalsContact O-CG 3.28Å; R33-L37 WeakPolarHBondContact O-CG 3.42Å; R33-L37 PolarHBondContact O-N 3.05Å
34	S	88.7	Confident	86.4	Confident	61 Å²	61	97.2 Å²	97.2	43%	0.427	52%	0.519	S	S	.	.	H	α-helix	trans	-57.7	-40.5	178.5	-69.4	0	0	0	0	112.6	E30 P31	E30-S34 PolarHBondContact OE1-OG 3.2Å; E30-S34 WeakPolarHBondContact OE2-CB 3.29Å; E30-S34 PolarHBondContact OE2-N 3.03Å; E30-S34 PolarHBondContact OE2-OG 2.78Å; P31-S34 PolarHBondContact O-N 3.49Å
35	E	89.2	Confident	85.9	Confident	115 Å²	115	102 Å²	102	54%	0.537	53%	0.532	S	S	.	.	H	α-helix	trans	-66.5	-43.1	175.7	-167.2	-174.2	161.5	0	0	112.1	P31 L32 R33 K38	P31-E35 PolarHBondContact O-N 3.06Å; L32-E35 PolarHBondContact O-N 3.43Å; R33-E35 VanDerWaalsContact C-N 3.28Å; R33-E35 PolarHBondContact O-N 2.73Å; E35-K38 PolarHBondContact O-N 3.13Å
36	A	87.7	Confident	85.4	Confident	6 Å²	6	107.5 Å²	107.5	5%	0.05	56%	0.559	C	S	.	*	H	α-helix	trans	-67.9	-37.2	-179.4	0	0	0	0	0	113	R25 L28 L32 R33 K38 R39	R25-A36 HydrophobicContact CB-CB 3.9Å; R25-A36 HydrophobicContact CG-CB 3.89Å; L28-A36 HydrophobicContact CD1-CB 3.87Å; L32-A36 VanDerWaalsContact O-CB 3.28Å; L32-A36 WeakPolarHBondContact O-CB 3.48Å; L32-A36 PolarHBondContact O-N 3.45Å; R33-A36 PolarHBondContact O-N 3.44Å; R33-A36 VanDerWaalsContact O-N 3.13Å; A36-K38 VanDerWaalsContact C-N 3.27Å; A36-K38 PolarHBondContact O-N 3.48Å; A36-R39 WeakPolarHBondContact O-CB 3.27Å; A36-R39 PolarHBondContact O-N 2.98Å
37	L	86	Confident	85.1	Confident	59 Å²	59	107.6 Å²	107.6	31%	0.309	56%	0.562	S	S	.	*	H	α-helix	trans	-66.1	-25.6	180	-73.4	175.4	0	0	0	113.2	R33 R39 E40	R33-L37 HydrophobicContact CG-CD1 3.84Å; R33-L37 HydrophobicContact CG-CG 4.2Å; R33-L37 WeakPolarHBondContact O-CB 3.44Å; R33-L37 VanDerWaalsContact O-CG 3.28Å; R33-L37 WeakPolarHBondContact O-CG 3.42Å; R33-L37 PolarHBondContact O-N 3.05Å; L37-R39 PolarHBondContact O-N 3.24Å; L37-R39 VanDerWaalsContact O-N 3.08Å; L37-E40 WeakPolarHBondContact CD2-OE1 3.37Å; L37-E40 WeakPolarHBondContact O-CB 3.18Å; L37-E40 PolarHBondContact O-N 3.13Å
38	K	85	Confident	84.6	Confident	172 Å²	172	111.9 Å²	111.9	75%	0.748	56%	0.564	S	S	*	*	G	3₁₀ helix	trans	-56.9	-25.9	174.5	-69.1	174.7	-176.3	178.3	0	112.7	E35 A36 E40	E35-K38 PolarHBondContact O-N 3.13Å; A36-K38 VanDerWaalsContact C-N 3.27Å; A36-K38 PolarHBondContact O-N 3.48Å; K38-E40 VanDerWaalsContact C-N 3.28Å; K38-E40 PolarHBondContact O-N 3.01Å
39	R	82.7	Confident	84.3	Confident	173 Å²	173	116.2 Å²	116.2	65%	0.653	58%	0.575	S	S	*	*	G	3₁₀ helix	trans	-75.3	-11.2	178.7	-62.7	-175.8	173.8	111.8	-0.8	114.1	A36 L37	A36-R39 WeakPolarHBondContact O-CB 3.27Å; A36-R39 PolarHBondContact O-N 2.98Å; L37-R39 PolarHBondContact O-N 3.24Å; L37-R39 VanDerWaalsContact O-N 3.08Å
40	E	78.6	Confident	84	Confident	52 Å²	52	113.9 Å²	113.9	24%	0.243	57%	0.565	C	S	.	*	G	3₁₀ helix	trans	-80.5	-18	-177.6	-65.2	-170.4	-178.1	0	0	113.7	K22 L37 K38 T42	K22-E40 VanDerWaalsContact CG-OE1 3.29Å; K22-E40 WeakPolarHBondContact CG-OE1 3.46Å; K22-E40 IonicContact NZ-OE2 2.73Å; K22-E40 PolarHBondContact NZ-OE2 3.33Å; L37-E40 WeakPolarHBondContact CD2-OE1 3.37Å; L37-E40 WeakPolarHBondContact O-CB 3.18Å; L37-E40 PolarHBondContact O-N 3.13Å; K38-E40 VanDerWaalsContact C-N 3.28Å; K38-E40 PolarHBondContact O-N 3.01Å; E40-T42 PolarHBondContact O-N 3.17Å; E40-T42 VanDerWaalsContact O-N 3.13Å
41	G	73.1	Confident	83.5	Confident	63 Å²	63	116.1 Å²	116.1	65%	0.649	58%	0.58	S	S	*	*			trans	-69	107.9	-178.4	0	0	0	0	0	112.1
42	T	77.2	Confident	83.1	Confident	121 Å²	121	114.5 Å²	114.5	74%	0.742	58%	0.582	S	S	*	*			trans	-94.7	113.7	167.2	58.2	0	0	0	0	109.8	E40 V44	E40-T42 PolarHBondContact O-N 3.17Å; E40-T42 VanDerWaalsContact O-N 3.13Å; T42-V44 VanDerWaalsContact C-N 3.26Å; T42-V44 PolarHBondContact O-N 3.49Å
43	T	77.7	Confident	82.6	Confident	135 Å²	135	117.7 Å²	117.7	83%	0.828	59%	0.592	S	S	*	*			trans	-85.1	0.3	177.5	-45.3	0	0	0	0	112.8	K45	T43-K45 PolarHBondContact O-N 3.37Å
44	V	82	Confident	82.2	Confident	99 Å²	99	118.3 Å²	118.3	60%	0.6	60%	0.599	S	S	*	*	P	Polyproline II helix	trans	-73.3	122.7	-174.2	-176.7	0	0	0	0	110.4	T42 F46	T42-V44 VanDerWaalsContact C-N 3.26Å; T42-V44 PolarHBondContact O-N 3.49Å; V44-F46 HydrophobicContact CG1-CD2 4.5Å; V44-F46 HydrophobicContact CG1-CE1 4.3Å; V44-F46 HydrophobicContact CG1-CE2 4.04Å; V44-F46 HydrophobicContact CG1-CZ 3.94Å
45	K	80.2	Confident	81.8	Confident	201 Å²	201	118.3 Å²	118.3	87%	0.874	60%	0.596	S	S	*	*	P	Polyproline II helix	trans	-99.5	127.1	171.1	-65.8	-178.3	-179.8	178.3	0	109	T43	T43-K45 PolarHBondContact O-N 3.37Å
46	F	81.6	Confident	80.9	Confident	194 Å²	194	117 Å²	117	85%	0.851	61%	0.605	S	S	*	*	P	Polyproline II helix	trans	-92.2	129.2	174.2	-67.3	-82.1	0	0	0	110.2	V44	V44-F46 HydrophobicContact CG1-CD2 4.5Å; V44-F46 HydrophobicContact CG1-CE1 4.3Å; V44-F46 HydrophobicContact CG1-CE2 4.04Å; V44-F46 HydrophobicContact CG1-CZ 3.94Å
47	A	83.8	Confident	79.6	Confident	46 Å²	46	126.2 Å²	126.2	38%	0.38	64%	0.644	S	S	.	*			trans	-117.8	119.7	173.7	0	0	0	0	0	108.6	Q54	A47-Q54 HydrophobicContact CB-CG 4.11Å; A47-Q54 VanDerWaalsContact CB-NE2 3.28Å
48	R	82.4	Confident	78	Confident	194 Å²	194	127.5 Å²	127.5	73%	0.732	66%	0.663	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-83.6	129	175.3	-170.7	175.5	-174.7	176.3	2.1	108.9	V55	R48-V55 PolarHBondContact O-N 3.34Å
49	W	85.9	Confident	75.9	Confident	163 Å²	163	132 Å²	132	62%	0.617	69%	0.687	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-108.3	137.1	175.9	-68.1	81	0	0	0	109.5	K53 Q54	W49-K53 VanDerWaalsContact CE3-C 3.47Å; W49-Q54 HydrophobicContact CD2-CB 4.21Å; W49-Q54 HydrophobicContact CE3-CB 4.23Å; W49-Q54 HydrophobicContact CH2-CB 4.09Å; W49-Q54 HydrophobicContact CZ2-CB 4.06Å; W49-Q54 HydrophobicContact CZ3-CB 4.18Å
50	K	83.8	Confident	75.6	Confident	133 Å²	133	130 Å²	130	58%	0.578	69%	0.689	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-144.3	135.2	171.4	-161.4	-169.4	172.2	-173.5	0	108.3	G52 K53 V55	K50-G52 PolarHBondContact O-N 3.2Å; K50-G52 VanDerWaalsContact O-N 3.15Å; K50-K53 PolarHBondContact N-O 2.97Å; K50-K53 PolarHBondContact O-N 3Å; K50-V55 HydrophobicContact CB-CG2 3.5Å; K50-V55 VanDerWaalsContact CB-CG2 3.5Å
51	D	80.8	Confident	75.4	Confident	144 Å²	144	134.1 Å²	134.1	77%	0.77	71%	0.712	S	S	*	*	T	Hydrogen-bonded Turn	trans	52.8	39.3	176.4	-50.4	-42.8	0	0	0	113.4	K53	D51-K53 PolarHBondContact O-N 2.84Å
52	G	81.1	Confident	75.5	Confident	70 Å²	70	138.1 Å²	138.1	72%	0.722	72%	0.716	S	S	*	*	T	Hydrogen-bonded Turn	trans	75.8	1.4	177.6	0	0	0	0	0	115.8	K50	K50-G52 PolarHBondContact O-N 3.2Å; K50-G52 VanDerWaalsContact O-N 3.15Å
53	K	77.8	Confident	75.4	Confident	167 Å²	167	139.1 Å²	139.1	73%	0.726	71%	0.714	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-117.1	145.2	175.5	-66.4	-178.6	-178.7	177.9	0	110.8	W49 K50 D51 V55	W49-K53 VanDerWaalsContact CE3-C 3.47Å; K50-K53 PolarHBondContact N-O 2.97Å; K50-K53 PolarHBondContact O-N 3Å; D51-K53 PolarHBondContact O-N 2.84Å; K53-V55 PolarHBondContact O-N 3.15Å
54	Q	82	Confident	75.3	Confident	116 Å²	116	139.3 Å²	139.3	54%	0.542	71%	0.707	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-68.1	117.8	169.5	-174.1	177.6	-5.2	0	0	107.7	A47 W49 A56	A47-Q54 HydrophobicContact CB-CG 4.11Å; A47-Q54 VanDerWaalsContact CB-NE2 3.28Å; W49-Q54 HydrophobicContact CD2-CB 4.21Å; W49-Q54 HydrophobicContact CE3-CB 4.23Å; W49-Q54 HydrophobicContact CH2-CB 4.09Å; W49-Q54 HydrophobicContact CZ2-CB 4.06Å; W49-Q54 HydrophobicContact CZ3-CB 4.18Å; Q54-A56 PolarHBondContact O-N 3.24Å
55	V	79.2	Confident	74.8	Confident	61 Å²	61	142 Å²	142	37%	0.37	71%	0.714	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-74.6	117	173.7	-170.6	0	0	0	0	106	R48 K50 K53 K57	R48-V55 PolarHBondContact O-N 3.34Å; K50-V55 HydrophobicContact CB-CG2 3.5Å; K50-V55 VanDerWaalsContact CB-CG2 3.5Å; K53-V55 PolarHBondContact O-N 3.15Å; V55-K57 PolarHBondContact O-N 3.06Å
56	A	70	Confident	74.5	Confident	87 Å²	87	137.8 Å²	137.8	72%	0.719	70%	0.703	S	S	*	*	P	Polyproline II helix	trans	-55.2	133.9	170.4	0	0	0	0	0	108	Q54 A58	Q54-A56 PolarHBondContact O-N 3.24Å; A56-A58 PolarHBondContact O-N 3.26Å
57	K	59.9	Low	73.9	Confident	201 Å²	201	133.5 Å²	133.5	87%	0.874	69%	0.691	S	S	*	*			trans	-39.4	108.8	-173.2	-161.9	-178.1	-176.5	-168	0	110.2	V55 E59	V55-K57 PolarHBondContact O-N 3.06Å; K57-E59 PolarHBondContact O-N 3.3Å
58	A	53.1	Low	73.1	Confident	86 Å²	86	140.8 Å²	140.8	71%	0.711	72%	0.717	S	S	*	*			trans	-63.3	118.7	167.9	0	0	0	0	0	106.4	A56	A56-A58 PolarHBondContact O-N 3.26Å
59	E	41.2	Very low	72.2	Confident	267 Å²	267	135.9 Å²	135.9	100%	1.248	72%	0.716	S	S	*	*			trans	-58.8	0	163.9	-74.8	-173.3	139.2	0	0	110.7	K57	K57-E59 PolarHBondContact O-N 3.3Å

Retrieved 59 of 59 residues in 17.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).