A0A077YYD0_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YYD0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 64 aa.

						>A0A077YYD0_TRITR|A0A077YYD0
MLAQATHNAGNLATALMSHAVPDAAYVRDMIRRAKASDKTVSINNQCLFIDYQFVCYVPPNMVT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.5	Low	55.4	Low	223 Å²	223	109.4 Å²	109.4	100%	1.099	63%	0.63	S	S	*	*				0	-5.4	0	-80.3	-166.6	-85	0	0	114.8
2	L	52.3	Low	55.6	Low	154 Å²	154	110.3 Å²	110.3	81%	0.806	63%	0.63	S	S	*	*	H	α-helix	trans	-67.2	-38.3	178.9	-78.4	142.9	0	0	0	114	Q4 A5 T6	L2-Q4 PolarHBondContact O-N 3.49Å; L2-A5 PolarHBondContact O-N 3.21Å; L2-T6 PolarHBondContact O-N 3.13Å; L2-T6 PolarHBondContact O-OG1 3.27Å
3	A	55.5	Low	55.5	Low	64 Å²	64	105.7 Å²	105.7	53%	0.529	61%	0.614	S	S	.	*	H	α-helix	trans	-61.6	-39.5	-177.4	0	0	0	0	0	113.6	A5 T6 H7	A3-A5 VanDerWaalsContact C-N 3.32Å; A3-A5 PolarHBondContact O-N 3.27Å; A3-T6 PolarHBondContact O-N 3.09Å; A3-H7 PolarHBondContact O-CD2 3.42Å; A3-H7 PolarHBondContact O-N 3.24Å
4	Q	53.7	Low	55.6	Low	141 Å²	141	104.6 Å²	104.6	66%	0.659	61%	0.61	S	S	*	*	H	α-helix	trans	-64.5	-37.5	-178.9	-156.1	81.2	4.6	0	0	112.1	L2 T6 H7 N8	L2-Q4 PolarHBondContact O-N 3.49Å; Q4-T6 VanDerWaalsContact C-N 3.34Å; Q4-H7 PolarHBondContact O-N 2.99Å; Q4-N8 PolarHBondContact O-N 3.45Å
5	A	50	Low	55.5	Low	66 Å²	66	100.9 Å²	100.9	55%	0.545	60%	0.596	S	S	.	*	H	α-helix	trans	-67.8	-36	177.3	0	0	0	0	0	111.6	L2 A3 N8 A9	L2-A5 PolarHBondContact O-N 3.21Å; A3-A5 VanDerWaalsContact C-N 3.32Å; A3-A5 PolarHBondContact O-N 3.27Å; A5-N8 PolarHBondContact O-N 3.49Å; A5-A9 PolarHBondContact O-N 3.24Å; A5-A9 VanDerWaalsContact O-N 3.11Å
6	T	56	Low	55.4	Low	95 Å²	95	101.3 Å²	101.3	58%	0.583	59%	0.594	S	S	*	*	H	α-helix	trans	-68.5	-38.3	176.5	-23.3	0	0	0	0	111.9	L2 A3 Q4 A9 G10	L2-T6 PolarHBondContact O-N 3.13Å; L2-T6 PolarHBondContact O-OG1 3.27Å; A3-T6 PolarHBondContact O-N 3.09Å; Q4-T6 VanDerWaalsContact C-N 3.34Å; T6-A9 PolarHBondContact O-N 2.74Å; T6-G10 PolarHBondContact O-N 3.28Å
7	H	57.5	Low	55.4	Low	135 Å²	135	105.3 Å²	105.3	63%	0.625	61%	0.608	S	S	*	*	H	α-helix	trans	-63.8	-42.3	175.3	-79.8	-72.5	0	0	0	112.4	A3 Q4 G10 N11	A3-H7 PolarHBondContact O-CD2 3.42Å; A3-H7 PolarHBondContact O-N 3.24Å; Q4-H7 PolarHBondContact O-N 2.99Å; H7-G10 PolarHBondContact O-N 3.49Å; H7-N11 PolarHBondContact O-N 2.95Å
8	N	57.1	Low	55.3	Low	111 Å²	111	104.3 Å²	104.3	59%	0.594	61%	0.608	S	S	*	*	H	α-helix	trans	-65.6	-40.7	176.4	-82.7	-1.2	0	0	0	112.5	Q4 A5 N11 L12	Q4-N8 PolarHBondContact O-N 3.45Å; A5-N8 PolarHBondContact O-N 3.49Å; N8-N11 PolarHBondContact O-N 3.12Å; N8-L12 PolarHBondContact O-N 3.44Å; N8-L12 VanDerWaalsContact O-N 3.14Å
9	A	57	Low	55.3	Low	62 Å²	62	106.2 Å²	106.2	51%	0.512	61%	0.611	S	S	.	*	H	α-helix	trans	-65.8	-41	176.2	0	0	0	0	0	112.2	A5 T6 L12 A13	A5-A9 PolarHBondContact O-N 3.24Å; A5-A9 VanDerWaalsContact O-N 3.11Å; T6-A9 PolarHBondContact O-N 2.74Å; A9-L12 PolarHBondContact O-N 3.01Å; A9-A13 PolarHBondContact O-N 3.36Å
10	G	55.5	Low	55.6	Low	34 Å²	34	105.3 Å²	105.3	35%	0.351	62%	0.616	S	S	.	*	H	α-helix	trans	-61.4	-44.4	175.6	0	0	0	0	0	112.3	T6 H7 L12 A13 T14	T6-G10 PolarHBondContact O-N 3.28Å; H7-G10 PolarHBondContact O-N 3.49Å; G10-L12 VanDerWaalsContact C-N 3.32Å; G10-L12 PolarHBondContact O-N 3.49Å; G10-A13 PolarHBondContact O-N 2.9Å; G10-T14 PolarHBondContact O-N 3.3Å; G10-T14 PolarHBondContact O-OG1 3.33Å; G10-T14 VanDerWaalsContact O-OG1 3.05Å
11	N	58.2	Low	56.2	Low	118 Å²	118	104.4 Å²	104.4	63%	0.631	61%	0.612	S	S	*	*	H	α-helix	trans	-65.3	-35.6	178.7	-123.1	4.3	0	0	0	112.6	H7 N8 A15	H7-N11 PolarHBondContact O-N 2.95Å; N8-N11 PolarHBondContact O-N 3.12Å; N11-A15 VanDerWaalsContact O-CB 3.31Å; N11-A15 WeakPolarHBondContact O-CB 3.47Å; N11-A15 PolarHBondContact O-N 3.48Å
12	L	58.3	Low	57.1	Low	120 Å²	120	95 Å²	95	63%	0.628	57%	0.568	S	S	*	*	H	α-helix	trans	-66.8	-43.4	175.3	-138.6	84.9	0	0	0	111.4	N8 A9 G10 A15 L16	N8-L12 PolarHBondContact O-N 3.44Å; N8-L12 VanDerWaalsContact O-N 3.14Å; A9-L12 PolarHBondContact O-N 3.01Å; G10-L12 VanDerWaalsContact C-N 3.32Å; G10-L12 PolarHBondContact O-N 3.49Å; L12-A15 PolarHBondContact O-N 3.43Å; L12-L16 WeakPolarHBondContact O-CB 3.39Å; L12-L16 WeakPolarHBondContact O-CD1 3.4Å; L12-L16 VanDerWaalsContact O-CG 3.26Å; L12-L16 WeakPolarHBondContact O-CG 3.34Å; L12-L16 PolarHBondContact O-N 3.33Å
13	A	54.4	Low	58.6	Low	51 Å²	51	92.7 Å²	92.7	42%	0.421	56%	0.556	S	S	.	*	H	α-helix	trans	-63.2	-42.5	176.8	0	0	0	0	0	111.6	A9 G10 L16 M17	A9-A13 PolarHBondContact O-N 3.36Å; G10-A13 PolarHBondContact O-N 2.9Å; A13-L16 PolarHBondContact O-N 2.97Å; A13-M17 WeakPolarHBondContact O-CB 3.43Å; A13-M17 VanDerWaalsContact O-CG 3.29Å; A13-M17 WeakPolarHBondContact O-CG 3.41Å; A13-M17 PolarHBondContact O-N 2.93Å
14	T	56.7	Low	60	Low	91 Å²	91	90.5 Å²	90.5	56%	0.558	54%	0.538	S	S	*	.	H	α-helix	trans	-66.2	-40.2	175.6	-53.4	0	0	0	0	112.2	G10 L16 M17 S18	G10-T14 PolarHBondContact O-N 3.3Å; G10-T14 PolarHBondContact O-OG1 3.33Å; G10-T14 VanDerWaalsContact O-OG1 3.05Å; T14-L16 VanDerWaalsContact C-N 3.35Å; T14-L16 PolarHBondContact O-N 3.03Å; T14-M17 PolarHBondContact O-N 2.94Å; T14-S18 PolarHBondContact O-N 3.34Å
15	A	53.9	Low	61.7	Low	49 Å²	49	85.5 Å²	85.5	41%	0.405	52%	0.521	S	S	.	.	H	α-helix	trans	-62.7	-41.9	175.7	0	0	0	0	0	111.7	N11 L12 M17 S18 H19	N11-A15 VanDerWaalsContact O-CB 3.31Å; N11-A15 WeakPolarHBondContact O-CB 3.47Å; N11-A15 PolarHBondContact O-N 3.48Å; L12-A15 PolarHBondContact O-N 3.43Å; A15-M17 VanDerWaalsContact C-N 3.34Å; A15-M17 PolarHBondContact O-N 2.86Å; A15-S18 PolarHBondContact O-N 2.95Å; A15-S18 PolarHBondContact O-OG 3.05Å; A15-H19 PolarHBondContact O-CE1 2.96Å; A15-H19 PolarHBondContact O-ND1 3.26Å
16	L	54.1	Low	63.6	Low	107 Å²	107	88.3 Å²	88.3	56%	0.56	52%	0.518	S	S	*	.	H	α-helix	trans	-66.8	-34.1	175.5	-70.6	164.4	0	0	0	112.4	L12 A13 T14	L12-L16 WeakPolarHBondContact O-CB 3.39Å; L12-L16 WeakPolarHBondContact O-CD1 3.4Å; L12-L16 VanDerWaalsContact O-CG 3.26Å; L12-L16 WeakPolarHBondContact O-CG 3.34Å; L12-L16 PolarHBondContact O-N 3.33Å; A13-L16 PolarHBondContact O-N 2.97Å; T14-L16 VanDerWaalsContact C-N 3.35Å; T14-L16 PolarHBondContact O-N 3.03Å
17	M	54.9	Low	65.2	Low	169 Å²	169	83.8 Å²	83.8	83%	0.833	49%	0.491	S	S	*	.	H	α-helix	trans	-78	-20.7	177.2	-73.8	-167.2	147	0	0	114.4	A13 T14 A15 H19	A13-M17 WeakPolarHBondContact O-CB 3.43Å; A13-M17 VanDerWaalsContact O-CG 3.29Å; A13-M17 WeakPolarHBondContact O-CG 3.41Å; A13-M17 PolarHBondContact O-N 2.93Å; T14-M17 PolarHBondContact O-N 2.94Å; A15-M17 VanDerWaalsContact C-N 3.34Å; A15-M17 PolarHBondContact O-N 2.86Å; M17-H19 VanDerWaalsContact C-N 3.27Å; M17-H19 PolarHBondContact O-N 3.09Å
18	S	53.8	Low	66.8	Low	87 Å²	87	83.8 Å²	83.8	61%	0.608	49%	0.485	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78	-9.7	175.9	70.7	0	0	0	0	113.9	T14 A15 A20	T14-S18 PolarHBondContact O-N 3.34Å; A15-S18 PolarHBondContact O-N 2.95Å; A15-S18 PolarHBondContact O-OG 3.05Å; S18-A20 PolarHBondContact O-N 3.42Å; S18-A20 VanDerWaalsContact O-N 3.08Å
19	H	54.7	Low	68.5	Low	141 Å²	141	82.3 Å²	82.3	65%	0.653	48%	0.477	S	S	*	.	S	Bend	trans	-72.4	105.8	172.8	-74.6	72.6	0	0	0	108.3	A15 M17 V21	A15-H19 PolarHBondContact O-CE1 2.96Å; A15-H19 PolarHBondContact O-ND1 3.26Å; M17-H19 VanDerWaalsContact C-N 3.27Å; M17-H19 PolarHBondContact O-N 3.09Å; H19-V21 PolarHBondContact O-N 3.5Å
20	A	61.6	Low	70.2	Confident	88 Å²	88	80.6 Å²	80.6	73%	0.727	46%	0.459	S	S	*	.			trans	-41.5	125.2	174.9	0	0	0	0	0	110	S18 P22	S18-A20 PolarHBondContact O-N 3.42Å; S18-A20 VanDerWaalsContact O-N 3.08Å; A20-P22 WeakPolarHBondContact O-CD 3.34Å
21	V	69.4	Low	72	Confident	86 Å²	86	80 Å²	80	52%	0.521	45%	0.447	S	S	.	.	P	Polyproline II helix	trans	-51.6	117.1	176.6	178	0	0	0	0	107.2	H19 D23 P59 M62	H19-V21 PolarHBondContact O-N 3.5Å; V21-D23 PolarHBondContact O-N 3.01Å; V21-P59 HydrophobicContact CG1-CG 3.48Å; V21-P59 VanDerWaalsContact CG1-CG 3.48Å; V21-M62 HydrophobicContact CG1-CE 3.75Å; V21-M62 HydrophobicContact CG1-SD 4.47Å
22	P	74.2	Confident	73.8	Confident	27 Å²	27	82.2 Å²	82.2	18%	0.175	45%	0.447	C	S	.	.	P	Polyproline II helix	trans	-62.5	138.8	-176.4	20.3	-27.9	0	0	0	109.4	A20 Y26 V27 C56	A20-P22 WeakPolarHBondContact O-CD 3.34Å; P22-Y26 HydrophobicContact CB-CD1 3.88Å; P22-Y26 HydrophobicContact CB-CE1 4.48Å; P22-V27 HydrophobicContact CB-CG2 3.89Å; P22-V27 HydrophobicContact CG-CG2 3.8Å; P22-C56 HydrophobicContact CG-CB 3.8Å
23	D	84.4	Confident	75.7	Confident	104 Å²	104	82.7 Å²	82.7	56%	0.556	44%	0.44	S	S	*	.	P	Polyproline II helix	trans	-56.9	146.1	177.6	172.8	50.7	0	0	0	111.1	V21 A25 Y26 V27	V21-D23 PolarHBondContact O-N 3.01Å; D23-A25 VanDerWaalsContact C-N 3.25Å; D23-A25 PolarHBondContact O-N 3.01Å; D23-A25 WeakPolarHBondContact OD2-CB 3.35Å; D23-A25 PolarHBondContact OD2-N 2.97Å; D23-A25 VanDerWaalsContact OD2-N 3.09Å; D23-Y26 WeakPolarHBondContact O-CA 3.35Å; D23-Y26 WeakPolarHBondContact O-CB 3.49Å; D23-Y26 PolarHBondContact O-N 2.98Å; D23-V27 PolarHBondContact O-N 3.5Å
24	A	85.5	Confident	77.7	Confident	18 Å²	18	80.6 Å²	80.6	15%	0.149	42%	0.423	C	S	.	.	H	α-helix	trans	-61.5	-34.1	-177	0	0	0	0	0	112	V27 R28 M62	A24-V27 PolarHBondContact O-N 3.42Å; A24-R28 WeakPolarHBondContact O-CB 3.43Å; A24-R28 WeakPolarHBondContact O-CG 3.26Å; A24-R28 PolarHBondContact O-N 2.86Å; A24-M62 HydrophobicContact CB-CB 4.42Å; A24-M62 HydrophobicContact CB-CE 4.47Å; A24-M62 HydrophobicContact CB-CG 4.21Å; A24-M62 HydrophobicContact CB-SD 4.1Å
25	A	88.6	Confident	79.5	Confident	37 Å²	37	82.6 Å²	82.6	31%	0.306	42%	0.424	S	S	.	.	H	α-helix	trans	-66.7	-41.7	175.3	0	0	0	0	0	111.1	D23 V27 R28 D29	D23-A25 VanDerWaalsContact C-N 3.25Å; D23-A25 PolarHBondContact O-N 3.01Å; D23-A25 WeakPolarHBondContact OD2-CB 3.35Å; D23-A25 PolarHBondContact OD2-N 2.97Å; D23-A25 VanDerWaalsContact OD2-N 3.09Å; A25-V27 PolarHBondContact O-N 3.23Å; A25-R28 PolarHBondContact O-N 3.14Å; A25-D29 PolarHBondContact O-N 2.83Å
26	Y	89.2	Confident	81.6	Confident	125 Å²	125	84 Å²	84	49%	0.49	44%	0.436	S	S	.	.	H	α-helix	trans	-61	-45.1	175.7	-178.6	-97.1	0	0	0	112.4	P22 D23 R28 D29 M30	P22-Y26 HydrophobicContact CB-CD1 3.88Å; P22-Y26 HydrophobicContact CB-CE1 4.48Å; D23-Y26 WeakPolarHBondContact O-CA 3.35Å; D23-Y26 WeakPolarHBondContact O-CB 3.49Å; D23-Y26 PolarHBondContact O-N 2.98Å; Y26-R28 PolarHBondContact O-N 3.47Å; Y26-D29 PolarHBondContact O-N 2.93Å; Y26-M30 HydrophobicContact CE1-CE 4.34Å; Y26-M30 HydrophobicContact CE1-SD 4.28Å; Y26-M30 WeakPolarHBondContact O-CB 3.39Å; Y26-M30 PolarHBondContact O-N 2.87Å
27	V	90.5	Very high	83.7	Confident	0 Å²	0	82.8 Å²	82.8	0%	0	44%	0.436	C	S	.	.	H	α-helix	trans	-61	-45.2	176	176.5	0	0	0	0	110.9	P22 D23 A24 A25 D29 M30 I31 L48 V58	P22-V27 HydrophobicContact CB-CG2 3.89Å; P22-V27 HydrophobicContact CG-CG2 3.8Å; D23-V27 PolarHBondContact O-N 3.5Å; A24-V27 PolarHBondContact O-N 3.42Å; A25-V27 PolarHBondContact O-N 3.23Å; V27-D29 PolarHBondContact O-N 2.83Å; V27-M30 PolarHBondContact O-N 3.49Å; V27-I31 HydrophobicContact CG1-CD1 3.91Å; V27-I31 WeakPolarHBondContact O-CG1 3.36Å; V27-I31 PolarHBondContact O-N 3.35Å; V27-L48 HydrophobicContact CG1-CD2 4.22Å; V27-V58 HydrophobicContact CG1-CG1 4.47Å; V27-V58 HydrophobicContact CG1-CG2 4.1Å
28	R	91.5	Very high	85.7	Confident	134 Å²	134	82.1 Å²	82.1	51%	0.506	44%	0.436	S	S	.	.	H	α-helix	trans	-61.3	-44.5	176.9	-75.3	-171.5	-60.7	-97.1	1.9	112.4	A24 A25 Y26 M30 I31 R32	A24-R28 WeakPolarHBondContact O-CB 3.43Å; A24-R28 WeakPolarHBondContact O-CG 3.26Å; A24-R28 PolarHBondContact O-N 2.86Å; A25-R28 PolarHBondContact O-N 3.14Å; Y26-R28 PolarHBondContact O-N 3.47Å; R28-M30 VanDerWaalsContact C-N 3.3Å; R28-M30 PolarHBondContact O-N 3.2Å; R28-I31 PolarHBondContact O-N 3.3Å; R28-R32 WeakPolarHBondContact O-CB 3.3Å; R28-R32 PolarHBondContact O-N 2.74Å
29	D	93	Very high	87.7	Confident	81 Å²	81	82.5 Å²	82.5	43%	0.433	43%	0.426	S	S	.	.	H	α-helix	trans	-65.6	-34.9	178.1	-84.7	-24.6	0	0	0	112.6	A25 Y26 V27 R33	A25-D29 PolarHBondContact O-N 2.83Å; Y26-D29 PolarHBondContact O-N 2.93Å; V27-D29 PolarHBondContact O-N 2.83Å; D29-R33 WeakPolarHBondContact O-CB 3.18Å; D29-R33 WeakPolarHBondContact O-CG 3.5Å; D29-R33 PolarHBondContact O-N 3.03Å; D29-R33 PolarHBondContact O-NE 3.5Å
30	M	92.5	Very high	89.7	Confident	26 Å²	26	78.8 Å²	78.8	13%	0.128	41%	0.414	C	S	.	.	H	α-helix	trans	-67	-46.3	174.4	-174.1	167.4	54.1	0	0	111.6	Y26 V27 R28 R32 R33 A34 L48 I50 V55	Y26-M30 HydrophobicContact CE1-CE 4.34Å; Y26-M30 HydrophobicContact CE1-SD 4.28Å; Y26-M30 WeakPolarHBondContact O-CB 3.39Å; Y26-M30 PolarHBondContact O-N 2.87Å; V27-M30 PolarHBondContact O-N 3.49Å; R28-M30 VanDerWaalsContact C-N 3.3Å; R28-M30 PolarHBondContact O-N 3.2Å; M30-R32 VanDerWaalsContact C-N 3.32Å; M30-R32 PolarHBondContact O-N 3.2Å; M30-R33 PolarHBondContact O-N 2.82Å; M30-A34 WeakPolarHBondContact O-CB 3.5Å; M30-A34 PolarHBondContact O-N 2.96Å; M30-L48 HydrophobicContact CE-CD2 3.57Å; M30-I50 HydrophobicContact CG-CD1 3.9Å; M30-I50 HydrophobicContact SD-CD1 4.46Å; M30-V55 HydrophobicContact CE-CG1 3.52Å; M30-V55 HydrophobicContact SD-CG1 3.43Å; M30-V55 WeakPolarHBondContact SD-CG1 3.35Å
31	I	93.7	Very high	91.4	Very high	20 Å²	20	76.6 Å²	76.6	10%	0.103	39%	0.391	C	S	.	.	H	α-helix	trans	-59.7	-43.9	174.3	-69.2	168.6	0	0	0	110.6	V27 R28 R33 A34 K35 V41 L48 V63	V27-I31 HydrophobicContact CG1-CD1 3.91Å; V27-I31 WeakPolarHBondContact O-CG1 3.36Å; V27-I31 PolarHBondContact O-N 3.35Å; R28-I31 PolarHBondContact O-N 3.3Å; I31-R33 PolarHBondContact O-N 3.08Å; I31-A34 PolarHBondContact O-N 3.4Å; I31-K35 HydrophobicContact CG2-CD 4.11Å; I31-K35 HydrophobicContact CG2-CG 4.46Å; I31-K35 WeakPolarHBondContact O-CG 3.36Å; I31-K35 PolarHBondContact O-N 3.49Å; I31-V41 HydrophobicContact CG1-CG1 4.24Å; I31-V41 HydrophobicContact CG2-CG1 4.24Å; I31-L48 HydrophobicContact CD1-CD1 4.23Å; I31-L48 HydrophobicContact CD1-CD2 4.46Å; I31-L48 HydrophobicContact CG1-CD1 4.05Å; I31-L48 HydrophobicContact CG1-CD2 4.09Å; I31-V63 HydrophobicContact CD1-CG1 3.87Å
32	R	96	Very high	92.6	Very high	165 Å²	165	74.8 Å²	74.8	62%	0.623	38%	0.383	S	S	*	.	H	α-helix	trans	-60.5	-46	179.1	-169.5	-176.7	74.4	88	-1.8	111.6	R28 M30 K35 A36	R28-R32 WeakPolarHBondContact O-CB 3.3Å; R28-R32 PolarHBondContact O-N 2.74Å; M30-R32 VanDerWaalsContact C-N 3.32Å; M30-R32 PolarHBondContact O-N 3.2Å; R32-K35 PolarHBondContact O-N 2.89Å; R32-A36 WeakPolarHBondContact O-CB 3.34Å; R32-A36 PolarHBondContact O-N 3.2Å
33	R	96.5	Very high	93.4	Very high	131 Å²	131	77.4 Å²	77.4	49%	0.494	39%	0.394	S	S	.	.	H	α-helix	trans	-64.6	-43.1	177.3	-75.8	-179.3	-72.9	179.2	-1	112.1	D29 M30 I31 K35 A36 S37	D29-R33 WeakPolarHBondContact O-CB 3.18Å; D29-R33 WeakPolarHBondContact O-CG 3.5Å; D29-R33 PolarHBondContact O-N 3.03Å; D29-R33 PolarHBondContact O-NE 3.5Å; M30-R33 PolarHBondContact O-N 2.82Å; I31-R33 PolarHBondContact O-N 3.08Å; R33-K35 PolarHBondContact O-N 3.39Å; R33-A36 PolarHBondContact O-N 2.95Å; R33-S37 PolarHBondContact O-N 3.05Å; R33-S37 VanDerWaalsContact O-N 3.13Å; R33-S37 PolarHBondContact O-OG 2.92Å
34	A	96.3	Very high	93.6	Very high	6 Å²	6	77 Å²	77	5%	0.05	39%	0.392	C	S	.	.	H	α-helix	trans	-59.6	-48	177.2	0	0	0	0	0	111.7	M30 I31 A36 S37 D38 K39 V41 I50	M30-A34 WeakPolarHBondContact O-CB 3.5Å; M30-A34 PolarHBondContact O-N 2.96Å; I31-A34 PolarHBondContact O-N 3.4Å; A34-A36 VanDerWaalsContact C-N 3.33Å; A34-A36 PolarHBondContact O-N 2.58Å; A34-S37 CarbonylContact O-C 3.52Å; A34-S37 PolarHBondContact O-N 2.96Å; A34-S37 VanDerWaalsContact O-N 3.09Å; A34-D38 PolarHBondContact O-N 3.41Å; A34-K39 HydrophobicContact CB-CB 4.16Å; A34-K39 HydrophobicContact CB-CD 4.39Å; A34-K39 WeakPolarHBondContact O-CB 3.18Å; A34-K39 PolarHBondContact O-N 3.48Å; A34-V41 HydrophobicContact CB-CG2 3.71Å; A34-I50 HydrophobicContact CB-CD1 3.91Å; A34-I50 HydrophobicContact CB-CG1 4.32Å; A34-I50 HydrophobicContact CB-CG2 3.93Å
35	K	96	Very high	93.8	Very high	133 Å²	133	82.7 Å²	82.7	58%	0.578	42%	0.42	S	S	*	.	H	α-helix	trans	-61.2	-39.9	175.8	-71.7	-178.6	176.4	-175	0	112.5	I31 R32 R33 S37 D38 V41	I31-K35 HydrophobicContact CG2-CD 4.11Å; I31-K35 HydrophobicContact CG2-CG 4.46Å; I31-K35 WeakPolarHBondContact O-CG 3.36Å; I31-K35 PolarHBondContact O-N 3.49Å; R32-K35 PolarHBondContact O-N 2.89Å; R33-K35 PolarHBondContact O-N 3.39Å; K35-S37 PolarHBondContact O-N 3.24Å; K35-D38 PolarHBondContact O-N 3.36Å; K35-V41 HydrophobicContact CG-CG2 4.14Å
36	A	97.7	Very high	93.9	Very high	79 Å²	79	85.2 Å²	85.2	65%	0.653	43%	0.426	S	S	*	.	H	α-helix	trans	-68.4	-15.1	177.3	0	0	0	0	0	113.7	R32 R33 A34	R32-A36 WeakPolarHBondContact O-CB 3.34Å; R32-A36 PolarHBondContact O-N 3.2Å; R33-A36 PolarHBondContact O-N 2.95Å; A34-A36 VanDerWaalsContact C-N 3.33Å; A34-A36 PolarHBondContact O-N 2.58Å
37	S	97.4	Very high	93.9	Very high	81 Å²	81	80.6 Å²	80.6	57%	0.566	41%	0.411	S	S	*	.	T	Hydrogen-bonded Turn	trans	-106.1	21.5	174.8	-56.4	0	0	0	0	112.7	R33 A34 K35 K39	R33-S37 PolarHBondContact O-N 3.05Å; R33-S37 VanDerWaalsContact O-N 3.13Å; R33-S37 PolarHBondContact O-OG 2.92Å; A34-S37 CarbonylContact O-C 3.52Å; A34-S37 PolarHBondContact O-N 2.96Å; A34-S37 VanDerWaalsContact O-N 3.09Å; K35-S37 PolarHBondContact O-N 3.24Å; S37-K39 PolarHBondContact O-N 3.35Å; S37-K39 VanDerWaalsContact O-N 3.12Å
38	D	97.1	Very high	94	Very high	156 Å²	156	80.6 Å²	80.6	83%	0.834	41%	0.411	S	S	*	.	T	Hydrogen-bonded Turn	trans	54	30	-179.4	-62.6	-46.1	0	0	0	114.6	A34 K35	A34-D38 PolarHBondContact O-N 3.41Å; K35-D38 PolarHBondContact O-N 3.36Å
39	K	97.1	Very high	94.1	Very high	94 Å²	94	76.9 Å²	76.9	41%	0.409	40%	0.399	S	S	.	.			trans	-84	147.1	176.4	-64	-179.2	163	-95.9	0	111.5	A34 S37 V41 I50 D51	A34-K39 HydrophobicContact CB-CB 4.16Å; A34-K39 HydrophobicContact CB-CD 4.39Å; A34-K39 WeakPolarHBondContact O-CB 3.18Å; A34-K39 PolarHBondContact O-N 3.48Å; S37-K39 PolarHBondContact O-N 3.35Å; S37-K39 VanDerWaalsContact O-N 3.12Å; K39-V41 PolarHBondContact O-N 3.14Å; K39-I50 HydrophobicContact CB-CG2 3.96Å; K39-I50 HydrophobicContact CD-CG2 3.8Å; K39-I50 HydrophobicContact CG-CG2 4.49Å; K39-D51 WeakPolarHBondContact CA-OD1 3.31Å; K39-D51 WeakPolarHBondContact CB-OD1 3.39Å; K39-D51 WeakPolarHBondContact CD-OD2 3.3Å; K39-D51 VanDerWaalsContact CG-OD2 3.26Å; K39-D51 WeakPolarHBondContact CG-OD2 3.43Å; K39-D51 IonicContact NZ-OD2 2.74Å; K39-D51 PolarHBondContact NZ-OD2 2.94Å
40	T	96.5	Very high	94.2	Very high	64 Å²	64	74 Å²	74	39%	0.393	38%	0.383	S	S	.	.			trans	-75.1	123.5	174.2	-63.2	0	0	0	0	109.5	I50 D51 Y52	T40-I50 CarbonylContact O-C 3.53Å; T40-I50 VanDerWaalsContact O-CA 3.3Å; T40-I50 WeakPolarHBondContact O-CA 3.35Å; T40-D51 PolarHBondContact N-OD1 3.43Å; T40-D51 PolarHBondContact O-N 3.48Å; T40-Y52 HydrophobicContact CG2-CE1 4.45Å
41	V	95.9	Very high	94.3	Very high	41 Å²	41	75.6 Å²	75.6	25%	0.248	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.7	125.5	174.6	-179.5	0	0	0	0	109.1	I31 A34 K35 K39 L48 F49 I50	I31-V41 HydrophobicContact CG1-CG1 4.24Å; I31-V41 HydrophobicContact CG2-CG1 4.24Å; A34-V41 HydrophobicContact CB-CG2 3.71Å; K35-V41 HydrophobicContact CG-CG2 4.14Å; K39-V41 PolarHBondContact O-N 3.14Å; V41-L48 HydrophobicContact CG1-CD1 3.69Å; V41-F49 WeakPolarHBondContact CA-O 3.39Å; V41-I50 HydrophobicContact CG2-CG1 4.49Å
42	S	94.9	Very high	94.3	Very high	49 Å²	49	83.6 Å²	83.6	34%	0.343	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.6	150	172.2	78.2	0	0	0	0	111.4	F49	S42-F49 PolarHBondContact N-O 2.91Å; S42-F49 PolarHBondContact O-N 3.42Å
43	I	91.3	Very high	94.2	Very high	81 Å²	81	82.6 Å²	82.6	42%	0.415	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	121	173.1	-59.2	-177.6	0	0	0	107.4	C47 L48 V63	I43-C47 VanDerWaalsContact CA-O 3.3Å; I43-C47 WeakPolarHBondContact CA-O 3.34Å; I43-L48 HydrophobicContact CD1-CD1 4.29Å; I43-L48 HydrophobicContact CG1-CD1 3.84Å; I43-V63 HydrophobicContact CD1-CB 4.46Å; I43-V63 HydrophobicContact CD1-CG2 3.71Å
44	N	89.6	Confident	94	Very high	97 Å²	97	81.6 Å²	81.6	52%	0.519	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.8	135.3	178.6	-169.2	-24.5	0	0	0	109	Q46 C47 F49	N44-Q46 PolarHBondContact O-N 3.27Å; N44-C47 PolarHBondContact N-O 3.01Å; N44-C47 WeakPolarHBondContact O-CB 3.48Å; N44-C47 PolarHBondContact O-N 3.47Å; N44-F49 HydrophobicContact CB-CE2 4.31Å
45	N	89.4	Confident	93.7	Very high	136 Å²	136	83.9 Å²	83.9	73%	0.727	44%	0.438	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.6	44.2	-178.6	-66.3	-26.7	0	0	0	113.3	C47	N45-C47 PolarHBondContact O-N 3.05Å
46	Q	89.3	Confident	93.5	Very high	91 Å²	91	78.3 Å²	78.3	43%	0.425	42%	0.415	S	S	.	.	T	Hydrogen-bonded Turn	trans	61	23.1	-178.9	-58.1	148.5	52.9	0	0	113.3	N44 Y57 V58 P60	N44-Q46 PolarHBondContact O-N 3.27Å; Q46-Y57 HydrophobicContact CB-CD2 3.96Å; Q46-Y57 HydrophobicContact CB-CE2 3.35Å; Q46-Y57 HydrophobicContact CG-CE2 4.32Å; Q46-Y57 CarbonylContact O-C 3.55Å; Q46-Y57 WeakPolarHBondContact O-CA 3.26Å; Q46-Y57 WeakPolarHBondContact O-CD2 3.45Å; Q46-Y57 PolarHBondContact OE1-OH 3.21Å; Q46-V58 WeakPolarHBondContact CB-O 3.29Å; Q46-V58 PolarHBondContact O-N 3.33Å; Q46-P60 HydrophobicContact CG-CG 4.42Å
47	C	90	Very high	93	Very high	28 Å²	28	79.4 Å²	79.4	19%	0.189	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	133	174.5	-65.8	0	0	0	0	109.7	I43 N44 N45 F49 F54	I43-C47 VanDerWaalsContact CA-O 3.3Å; I43-C47 WeakPolarHBondContact CA-O 3.34Å; N44-C47 PolarHBondContact N-O 3.01Å; N44-C47 WeakPolarHBondContact O-CB 3.48Å; N44-C47 PolarHBondContact O-N 3.47Å; N45-C47 PolarHBondContact O-N 3.05Å; C47-F49 HydrophobicContact CB-CD2 4.35Å; C47-F49 HydrophobicContact CB-CE2 3.51Å; C47-F49 HydrophobicContact CB-CZ 3.82Å; C47-F49 WeakPolarHBondContact O-CD2 3.12Å; C47-F49 WeakPolarHBondContact O-CE2 3.43Å; C47-F54 HydrophobicContact CB-CD2 4Å; C47-F54 HydrophobicContact CB-CE2 3.85Å
48	L	91.7	Very high	92.6	Very high	0 Å²	0	75.7 Å²	75.7	0%	0	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87	129	172.2	175.4	65.4	0	0	0	109.9	V27 M30 I31 V41 I43 I50 V55 C56 V58	V27-L48 HydrophobicContact CG1-CD2 4.22Å; M30-L48 HydrophobicContact CE-CD2 3.57Å; I31-L48 HydrophobicContact CD1-CD1 4.23Å; I31-L48 HydrophobicContact CD1-CD2 4.46Å; I31-L48 HydrophobicContact CG1-CD1 4.05Å; I31-L48 HydrophobicContact CG1-CD2 4.09Å; V41-L48 HydrophobicContact CG1-CD1 3.69Å; I43-L48 HydrophobicContact CD1-CD1 4.29Å; I43-L48 HydrophobicContact CG1-CD1 3.84Å; L48-I50 HydrophobicContact CD2-CD1 4.49Å; L48-I50 HydrophobicContact CG-CG1 4.42Å; L48-V55 HydrophobicContact CD2-CB 4.46Å; L48-V55 HydrophobicContact CD2-CG1 4.48Å; L48-V55 HydrophobicContact CG-CB 4.39Å; L48-V55 PolarHBondContact O-N 3.38Å; L48-C56 PolarHBondContact N-O 2.92Å; L48-V58 HydrophobicContact CB-CG2 3.62Å
49	F	94.2	Very high	91.6	Very high	56 Å²	56	69.6 Å²	69.6	25%	0.246	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118	136.5	171.9	-57.1	-95.9	0	0	0	110.4	V41 S42 N44 C47 Q53 F54	V41-F49 WeakPolarHBondContact CA-O 3.39Å; S42-F49 PolarHBondContact N-O 2.91Å; S42-F49 PolarHBondContact O-N 3.42Å; N44-F49 HydrophobicContact CB-CE2 4.31Å; C47-F49 HydrophobicContact CB-CD2 4.35Å; C47-F49 HydrophobicContact CB-CE2 3.51Å; C47-F49 HydrophobicContact CB-CZ 3.82Å; C47-F49 WeakPolarHBondContact O-CD2 3.12Å; C47-F49 WeakPolarHBondContact O-CE2 3.43Å; F49-Q53 CarbonylContact C-O 3.59Å; F49-Q53 WeakPolarHBondContact CA-O 3.45Å; F49-F54 HydrophobicContact CD1-CB 4.19Å; F49-F54 HydrophobicContact CE1-CB 3.93Å; F49-F54 HydrophobicContact CE1-CD2 4.32Å; F49-F54 HydrophobicContact CZ-CD2 4.43Å
50	I	95.3	Very high	90.5	Very high	21 Å²	21	68.6 Å²	68.6	11%	0.108	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	124.9	172.7	-61.1	175.5	0	0	0	107.2	M30 A34 K39 T40 V41 L48 Y52 Q53 V55	M30-I50 HydrophobicContact CG-CD1 3.9Å; M30-I50 HydrophobicContact SD-CD1 4.46Å; A34-I50 HydrophobicContact CB-CD1 3.91Å; A34-I50 HydrophobicContact CB-CG1 4.32Å; A34-I50 HydrophobicContact CB-CG2 3.93Å; K39-I50 HydrophobicContact CB-CG2 3.96Å; K39-I50 HydrophobicContact CD-CG2 3.8Å; K39-I50 HydrophobicContact CG-CG2 4.49Å; T40-I50 CarbonylContact O-C 3.53Å; T40-I50 VanDerWaalsContact O-CA 3.3Å; T40-I50 WeakPolarHBondContact O-CA 3.35Å; V41-I50 HydrophobicContact CG2-CG1 4.49Å; L48-I50 HydrophobicContact CD2-CD1 4.49Å; L48-I50 HydrophobicContact CG-CG1 4.42Å; I50-Y52 PolarHBondContact O-N 3.2Å; I50-Q53 PolarHBondContact N-O 3.41Å; I50-Q53 PolarHBondContact O-N 3.11Å; I50-V55 HydrophobicContact CB-CG2 3.9Å; I50-V55 HydrophobicContact CD1-CG2 3.94Å; I50-V55 HydrophobicContact CG1-CG2 3.81Å
51	D	95.4	Very high	89.5	Confident	59 Å²	59	72.7 Å²	72.7	32%	0.316	37%	0.369	S	S	.	.	T	Hydrogen-bonded Turn	trans	47.8	44.2	-171.9	-62.8	-28.9	0	0	0	112.6	K39 T40 Q53	K39-D51 WeakPolarHBondContact CA-OD1 3.31Å; K39-D51 WeakPolarHBondContact CB-OD1 3.39Å; K39-D51 WeakPolarHBondContact CD-OD2 3.3Å; K39-D51 VanDerWaalsContact CG-OD2 3.26Å; K39-D51 WeakPolarHBondContact CG-OD2 3.43Å; K39-D51 IonicContact NZ-OD2 2.74Å; K39-D51 PolarHBondContact NZ-OD2 2.94Å; T40-D51 PolarHBondContact N-OD1 3.43Å; T40-D51 PolarHBondContact O-N 3.48Å; D51-Q53 PolarHBondContact O-N 3.12Å; D51-Q53 VanDerWaalsContact O-N 3.14Å
52	Y	92.6	Very high	88.3	Confident	187 Å²	187	72.8 Å²	72.8	73%	0.733	37%	0.367	S	S	*	.	T	Hydrogen-bonded Turn	trans	64	12.8	-179.8	-45.5	-80.9	0	0	0	115.1	T40 I50	T40-Y52 HydrophobicContact CG2-CE1 4.45Å; I50-Y52 PolarHBondContact O-N 3.2Å
53	Q	93.9	Very high	86.7	Confident	145 Å²	145	73.1 Å²	73.1	68%	0.678	37%	0.367	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.7	136.5	173.1	-62.6	-172.1	-9.7	0	0	111.1	F49 I50 D51 V55	F49-Q53 CarbonylContact C-O 3.59Å; F49-Q53 WeakPolarHBondContact CA-O 3.45Å; I50-Q53 PolarHBondContact N-O 3.41Å; I50-Q53 PolarHBondContact O-N 3.11Å; D51-Q53 PolarHBondContact O-N 3.12Å; D51-Q53 VanDerWaalsContact O-N 3.14Å; Q53-V55 PolarHBondContact O-N 3.07Å
54	F	91.9	Very high	85	Confident	109 Å²	109	78.9 Å²	78.9	48%	0.478	41%	0.406	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.9	131.5	174.5	173	-99.5	0	0	0	110.3	C47 F49	C47-F54 HydrophobicContact CB-CD2 4Å; C47-F54 HydrophobicContact CB-CE2 3.85Å; F49-F54 HydrophobicContact CD1-CB 4.19Å; F49-F54 HydrophobicContact CE1-CB 3.93Å; F49-F54 HydrophobicContact CE1-CD2 4.32Å; F49-F54 HydrophobicContact CZ-CD2 4.43Å
55	V	91.3	Very high	84.8	Confident	55 Å²	55	78 Å²	78	33%	0.333	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	-55.4	-179.5	-178.6	0	0	0	0	111	M30 L48 I50 Q53	M30-V55 HydrophobicContact CE-CG1 3.52Å; M30-V55 HydrophobicContact SD-CG1 3.43Å; M30-V55 WeakPolarHBondContact SD-CG1 3.35Å; L48-V55 HydrophobicContact CD2-CB 4.46Å; L48-V55 HydrophobicContact CD2-CG1 4.48Å; L48-V55 HydrophobicContact CG-CB 4.39Å; L48-V55 PolarHBondContact O-N 3.38Å; I50-V55 HydrophobicContact CB-CG2 3.9Å; I50-V55 HydrophobicContact CD1-CG2 3.94Å; I50-V55 HydrophobicContact CG1-CG2 3.81Å; Q53-V55 PolarHBondContact O-N 3.07Å
56	C	90.5	Very high	84.6	Confident	16 Å²	16	74.9 Å²	74.9	11%	0.108	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-161.5	162.8	179	65.4	0	0	0	0	111.9	P22 L48	P22-C56 HydrophobicContact CG-CB 3.8Å; L48-C56 PolarHBondContact N-O 2.92Å
57	Y	88.9	Confident	84.3	Confident	101 Å²	101	74.1 Å²	74.1	40%	0.396	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.2	139.1	162.3	179.2	-99.7	0	0	0	109.6	Q46 P59	Q46-Y57 HydrophobicContact CB-CD2 3.96Å; Q46-Y57 HydrophobicContact CB-CE2 3.35Å; Q46-Y57 HydrophobicContact CG-CE2 4.32Å; Q46-Y57 CarbonylContact O-C 3.55Å; Q46-Y57 WeakPolarHBondContact O-CA 3.26Å; Q46-Y57 WeakPolarHBondContact O-CD2 3.45Å; Q46-Y57 PolarHBondContact OE1-OH 3.21Å; Y57-P59 HydrophobicContact CD1-CG 4.07Å; Y57-P59 HydrophobicContact CE1-CB 4.02Å; Y57-P59 HydrophobicContact CE1-CG 3.77Å
58	V	87.3	Confident	84	Confident	4 Å²	4	76.8 Å²	76.8	2%	0.024	39%	0.392	C	S	.	.			trans	-124	101.8	178.7	-176.3	0	0	0	0	106.9	V27 Q46 L48 M62 V63	V27-V58 HydrophobicContact CG1-CG1 4.47Å; V27-V58 HydrophobicContact CG1-CG2 4.1Å; Q46-V58 WeakPolarHBondContact CB-O 3.29Å; Q46-V58 PolarHBondContact O-N 3.33Å; L48-V58 HydrophobicContact CB-CG2 3.62Å; V58-M62 HydrophobicContact CG1-CB 3.75Å; V58-V63 HydrophobicContact CG1-CG2 3.59Å
59	P	77.7	Confident	83.5	Confident	28 Å²	28	81.6 Å²	81.6	18%	0.182	42%	0.417	C	S	.	.			trans	-53.7	151.8	178.6	-20.5	26.2	0	0	0	111.5	V21 Y57 N61 M62	V21-P59 HydrophobicContact CG1-CG 3.48Å; V21-P59 VanDerWaalsContact CG1-CG 3.48Å; Y57-P59 HydrophobicContact CD1-CG 4.07Å; Y57-P59 HydrophobicContact CE1-CB 4.02Å; Y57-P59 HydrophobicContact CE1-CG 3.77Å; P59-N61 PolarHBondContact O-N 3.4Å; P59-M62 HydrophobicContact CB-CG 4.38Å; P59-M62 HydrophobicContact CG-CE 4.05Å; P59-M62 HydrophobicContact CG-CG 4.31Å; P59-M62 HydrophobicContact CG-SD 4.12Å; P59-M62 PolarHBondContact O-N 3.32Å
60	P	72.9	Confident	82.8	Confident	73 Å²	73	83.3 Å²	83.3	47%	0.474	43%	0.428	S	S	.	.	T	Hydrogen-bonded Turn	trans	-48	139.7	166.3	-18.8	28.8	0	0	0	108.6	Q46	Q46-P60 HydrophobicContact CG-CG 4.42Å
61	N	75.5	Confident	81.9	Confident	150 Å²	150	87.7 Å²	87.7	80%	0.802	45%	0.451	S	S	*	.	T	Hydrogen-bonded Turn	trans	86.2	-1.4	176.8	-25.3	-34.9	0	0	0	116.6	P59	P59-N61 PolarHBondContact O-N 3.4Å
62	M	70.5	Confident	80.8	Confident	42 Å²	42	89.9 Å²	89.9	21%	0.207	46%	0.462	C	S	.	.	S	Bend	trans	-84.8	-20.5	179.1	-78	-151.3	169	0	0	115.3	V21 A24 V58 P59	V21-M62 HydrophobicContact CG1-CE 3.75Å; V21-M62 HydrophobicContact CG1-SD 4.47Å; A24-M62 HydrophobicContact CB-CB 4.42Å; A24-M62 HydrophobicContact CB-CE 4.47Å; A24-M62 HydrophobicContact CB-CG 4.21Å; A24-M62 HydrophobicContact CB-SD 4.1Å; V58-M62 HydrophobicContact CG1-CB 3.75Å; P59-M62 HydrophobicContact CB-CG 4.38Å; P59-M62 HydrophobicContact CG-CE 4.05Å; P59-M62 HydrophobicContact CG-CG 4.31Å; P59-M62 HydrophobicContact CG-SD 4.12Å; P59-M62 PolarHBondContact O-N 3.32Å
63	V	61.6	Low	79.9	Confident	57 Å²	57	81.8 Å²	81.8	35%	0.345	44%	0.439	S	S	.	.			trans	-137	103	-178.7	-91.6	0	0	0	0	107.6	I31 I43 V58	I31-V63 HydrophobicContact CD1-CG1 3.87Å; I43-V63 HydrophobicContact CD1-CB 4.46Å; I43-V63 HydrophobicContact CD1-CG2 3.71Å; V58-V63 HydrophobicContact CG1-CG2 3.59Å
64	T	56.4	Low	78.6	Confident	202 Å²	202	76.1 Å²	76.1	100%	1.239	42%	0.417	S	S	*	.			trans	-115.4	0	169.4	50	0	0	0	0	108.7

Retrieved 64 of 64 residues in 33.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).