A0A077YYE7_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YYE7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 106 aa.

						>A0A077YYE7_TRITR|A0A077YYE7
MKFDAIRGPRELVYPSTATSAWRSCPYRSTFCKNPFLGVYFTLGFVVFPYLFHKLDKKLGIEEGRKRMLKERRERKMERIGGEEQFLRDYEYLKHHLLKQWEKEEK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	33.3	Very low	41.8	Very low	239 Å²	239	169.1 Å²	169.1	100%	1.177	83%	0.83	S	S	*	*				0	96	0	-70.9	172.1	170.8	0	0	109.2
2	K	39.2	Very low	42.3	Very low	197 Å²	197	167.3 Å²	167.3	86%	0.857	83%	0.825	S	S	*	*			trans	-128	112.5	160.7	-85	-178.4	175.6	176.8	0	104.8	D4	K2-D4 VanDerWaalsContact C-N 3.29Å; K2-D4 PolarHBondContact O-N 3.06Å
3	F	40.5	Very low	42.8	Very low	203 Å²	203	164.6 Å²	164.6	89%	0.89	82%	0.823	S	S	*	*			trans	-66.5	93.8	174.3	-91.5	-96.1	0	0	0	107.2	A5	F3-A5 PolarHBondContact O-N 3.39Å
4	D	43.9	Very low	43.2	Very low	150 Å²	150	166.6 Å²	166.6	80%	0.802	82%	0.818	S	S	*	*			trans	-69.2	80.7	158.1	-75.6	-34	0	0	0	106.2	K2 I6	K2-D4 VanDerWaalsContact C-N 3.29Å; K2-D4 PolarHBondContact O-N 3.06Å; D4-I6 PolarHBondContact O-N 3.1Å
5	A	46.1	Very low	43.7	Very low	75 Å²	75	158.8 Å²	158.8	62%	0.62	79%	0.785	S	S	*	*			trans	-57.9	99	168.7	0	0	0	0	0	106.2	F3 R7	F3-A5 PolarHBondContact O-N 3.39Å; A5-R7 VanDerWaalsContact C-N 3.29Å; A5-R7 PolarHBondContact O-N 3.49Å
6	I	44.2	Very low	44.8	Very low	163 Å²	163	156.3 Å²	156.3	84%	0.836	79%	0.788	S	S	*	*			trans	-13.3	94.5	147.2	-63.9	162.1	0	0	0	107.4	D4 G8	D4-I6 PolarHBondContact O-N 3.1Å; I6-G8 PolarHBondContact O-N 2.94Å
7	R	42.6	Very low	45.1	Very low	243 Å²	243	151.5 Å²	151.5	92%	0.917	77%	0.769	S	S	*	*			trans	-71.1	82.1	172.1	-73.9	179.7	-179.8	165.2	0.8	104.9	A5	A5-R7 VanDerWaalsContact C-N 3.29Å; A5-R7 PolarHBondContact O-N 3.49Å
8	G	35.3	Very low	45.8	Very low	44 Å²	44	147.8 Å²	147.8	45%	0.454	77%	0.765	S	S	.	*			trans	-50.5	141.3	160	0	0	0	0	0	107.6	I6 R10	I6-G8 PolarHBondContact O-N 2.94Å; G8-R10 PolarHBondContact O-N 3.31Å
9	P	45.7	Very low	46.3	Very low	130 Å²	130	145.4 Å²	145.4	84%	0.844	76%	0.758	S	S	*	*			trans	-53.8	115.3	176.2	23.2	-31.1	0	0	0	106.6	E11	P9-E11 PolarHBondContact O-N 2.84Å
10	R	45	Very low	46.9	Very low	238 Å²	238	140 Å²	140	90%	0.898	73%	0.732	S	S	*	*			trans	-38.1	115.3	-176.9	-74.3	178.3	173.7	178.1	-2.9	108.4	G8 L12	G8-R10 PolarHBondContact O-N 3.31Å; R10-L12 PolarHBondContact O-N 3.48Å
11	E	43.8	Very low	47.3	Very low	178 Å²	178	134.8 Å²	134.8	83%	0.832	71%	0.71	S	S	*	*			trans	-41.8	117.5	169.3	-64.1	-178.6	176.1	0	0	107.3	P9 V13	P9-E11 PolarHBondContact O-N 2.84Å; E11-V13 PolarHBondContact O-N 2.88Å
12	L	48	Very low	48.3	Very low	148 Å²	148	132.6 Å²	132.6	78%	0.775	69%	0.689	S	S	*	*			trans	-54.9	96.1	166.3	-83.2	139.7	0	0	0	105.5	R10 Y14	R10-L12 PolarHBondContact O-N 3.48Å; L12-Y14 HydrophobicContact CB-CD2 4.31Å; L12-Y14 HydrophobicContact CB-CE2 4.44Å; L12-Y14 PolarHBondContact O-N 3.39Å
13	V	49.5	Very low	49	Very low	132 Å²	132	134.2 Å²	134.2	80%	0.8	69%	0.689	S	S	*	*			trans	-63.4	89.9	165.4	-179.3	0	0	0	0	104.2	E11 P15	E11-V13 PolarHBondContact O-N 2.88Å; V13-P15 VanDerWaalsContact O-CD 3.29Å; V13-P15 WeakPolarHBondContact O-CD 3.39Å; V13-P15 VanDerWaalsContact O-N 3.12Å
14	Y	47.8	Very low	49.8	Very low	193 Å²	193	128 Å²	128	76%	0.757	67%	0.671	S	S	*	*			trans	-54.7	120.2	172	-100	-93.4	0	0	0	105.8	L12 S16	L12-Y14 HydrophobicContact CB-CD2 4.31Å; L12-Y14 HydrophobicContact CB-CE2 4.44Å; L12-Y14 PolarHBondContact O-N 3.39Å; Y14-S16 PolarHBondContact O-N 3.28Å
15	P	50.6	Low	50.1	Low	49 Å²	49	123.8 Å²	123.8	32%	0.318	65%	0.653	S	S	.	*			trans	-61.8	100.5	177.6	20.9	-29.3	0	0	0	108.5	V13 T17 S20 A21	V13-P15 VanDerWaalsContact O-CD 3.29Å; V13-P15 WeakPolarHBondContact O-CD 3.39Å; V13-P15 VanDerWaalsContact O-N 3.12Å; P15-T17 PolarHBondContact O-N 3Å; P15-T17 VanDerWaalsContact O-N 3.13Å; P15-S20 VanDerWaalsContact CA-OG 3.23Å; P15-S20 WeakPolarHBondContact CA-OG 3.39Å; P15-S20 WeakPolarHBondContact CB-OG 3.5Å; P15-A21 HydrophobicContact CB-CB 4.16Å; P15-A21 HydrophobicContact CG-CB 3.98Å
16	S	61.4	Low	50.3	Low	119 Å²	119	124.2 Å²	124.2	83%	0.832	65%	0.649	S	S	*	*			trans	-68.9	-7.2	-177.1	56.5	0	0	0	0	113	Y14	Y14-S16 PolarHBondContact O-N 3.28Å
17	T	49.8	Very low	50.6	Low	75 Å²	75	122.9 Å²	122.9	46%	0.46	63%	0.634	S	S	.	*	S	Bend	trans	-126.3	136.8	179.3	34.1	0	0	0	0	110.8	P15 T19 S20 A21	P15-T17 PolarHBondContact O-N 3Å; P15-T17 VanDerWaalsContact O-N 3.13Å; T17-T19 PolarHBondContact O-N 3.3Å; T17-S20 PolarHBondContact N-OG 2.93Å; T17-S20 WeakPolarHBondContact O-CA 3.25Å; T17-S20 PolarHBondContact O-N 2.99Å; T17-S20 PolarHBondContact O-OG 3.44Å; T17-S20 PolarHBondContact OG1-OG 3.47Å; T17-A21 PolarHBondContact O-N 2.92Å
18	A	57.7	Low	51	Low	85 Å²	85	122 Å²	122	70%	0.702	63%	0.631	S	S	*	*	H	α-helix	trans	-52.5	-31.7	178.7	0	0	0	0	0	113	A21 W22	A18-A21 PolarHBondContact O-N 2.94Å; A18-W22 PolarHBondContact O-N 3.1Å
19	T	56.3	Low	51.7	Low	102 Å²	102	121.7 Å²	121.7	63%	0.626	62%	0.622	S	S	*	*	H	α-helix	trans	-67	-40.4	174.1	46.6	0	0	0	0	112.9	T17 W22 R23	T17-T19 PolarHBondContact O-N 3.3Å; T19-W22 PolarHBondContact O-N 3.02Å; T19-R23 PolarHBondContact O-N 3.36Å
20	S	57.4	Low	52.1	Low	36 Å²	36	119 Å²	119	25%	0.252	60%	0.603	S	S	.	*	H	α-helix	trans	-68.8	-37.4	173.1	60.8	0	0	0	0	111.8	P15 T17 W22 R23 S24	P15-S20 VanDerWaalsContact CA-OG 3.23Å; P15-S20 WeakPolarHBondContact CA-OG 3.39Å; P15-S20 WeakPolarHBondContact CB-OG 3.5Å; T17-S20 PolarHBondContact N-OG 2.93Å; T17-S20 WeakPolarHBondContact O-CA 3.25Å; T17-S20 PolarHBondContact O-N 2.99Å; T17-S20 PolarHBondContact O-OG 3.44Å; T17-S20 PolarHBondContact OG1-OG 3.47Å; S20-W22 VanDerWaalsContact C-N 3.32Å; S20-W22 PolarHBondContact O-N 2.9Å; S20-R23 PolarHBondContact O-N 3.05Å; S20-S24 PolarHBondContact O-N 3.08Å; S20-S24 PolarHBondContact O-OG 3.26Å
21	A	54.7	Low	52.3	Low	31 Å²	31	110.8 Å²	110.8	26%	0.256	57%	0.574	S	S	.	*	H	α-helix	trans	-62.9	-38.7	175.4	0	0	0	0	0	111.7	P15 T17 A18 R23 S24 C25	P15-A21 HydrophobicContact CB-CB 4.16Å; P15-A21 HydrophobicContact CG-CB 3.98Å; T17-A21 PolarHBondContact O-N 2.92Å; A18-A21 PolarHBondContact O-N 2.94Å; A21-R23 PolarHBondContact O-N 3.47Å; A21-S24 WeakPolarHBondContact CA-OG 3.21Å; A21-S24 PolarHBondContact O-N 3.43Å; A21-S24 PolarHBondContact O-OG 3.39Å; A21-C25 VanDerWaalsContact O-CB 3.25Å; A21-C25 WeakPolarHBondContact O-CB 3.37Å; A21-C25 PolarHBondContact O-N 2.93Å; A21-C25 PolarHBondContact O-SG 3.04Å
22	W	54.1	Low	52.7	Low	193 Å²	193	107.6 Å²	107.6	73%	0.731	57%	0.57	S	S	*	*	H	α-helix	trans	-64.7	-38.3	176.3	-152.2	-54	0	0	0	112.5	A18 T19 S20	A18-W22 PolarHBondContact O-N 3.1Å; T19-W22 PolarHBondContact O-N 3.02Å; S20-W22 VanDerWaalsContact C-N 3.32Å; S20-W22 PolarHBondContact O-N 2.9Å
23	R	55.8	Low	53.3	Low	232 Å²	232	107.8 Å²	107.8	88%	0.875	56%	0.564	S	S	*	*	H	α-helix	trans	-71.7	-35.8	177.3	-69.4	-176.6	-179.9	-172.8	0.7	112.4	T19 S20 A21	T19-R23 PolarHBondContact O-N 3.36Å; S20-R23 PolarHBondContact O-N 3.05Å; A21-R23 PolarHBondContact O-N 3.47Å
24	S	56.1	Low	54	Low	71 Å²	71	105.7 Å²	105.7	50%	0.497	55%	0.549	S	S	.	.	H	α-helix	trans	-84.5	-21.8	179.9	57.1	0	0	0	0	113.8	S20 A21 P26	S20-S24 PolarHBondContact O-N 3.08Å; S20-S24 PolarHBondContact O-OG 3.26Å; A21-S24 WeakPolarHBondContact CA-OG 3.21Å; A21-S24 PolarHBondContact O-N 3.43Å; A21-S24 PolarHBondContact O-OG 3.39Å; S24-P26 WeakPolarHBondContact O-CD 3.2Å
25	C	51.1	Low	54.9	Low	63 Å²	63	100.9 Å²	100.9	43%	0.426	54%	0.541	S	S	.	.	S	Bend	trans	-69.7	113.8	170.9	-81.1	0	0	0	0	108.1	A21 Y27	A21-C25 VanDerWaalsContact O-CB 3.25Å; A21-C25 WeakPolarHBondContact O-CB 3.37Å; A21-C25 PolarHBondContact O-N 2.93Å; A21-C25 PolarHBondContact O-SG 3.04Å; C25-Y27 HydrophobicContact CB-CD2 4.14Å; C25-Y27 PolarHBondContact O-N 3.49Å
26	P	48.8	Very low	55.7	Low	83 Å²	83	105.2 Å²	105.2	54%	0.539	56%	0.556	S	S	.	*			trans	-75.7	67.3	175.3	35.4	-35.2	0	0	0	108.3	S24 R28 S29 T30	S24-P26 WeakPolarHBondContact O-CD 3.2Å; P26-R28 PolarHBondContact O-N 2.84Å; P26-R28 VanDerWaalsContact O-N 3.16Å; P26-S29 WeakPolarHBondContact CB-OG 3.28Å; P26-S29 WeakPolarHBondContact CG-OG 3.4Å; P26-S29 PolarHBondContact O-N 3.39Å; P26-S29 PolarHBondContact O-OG 3.36Å; P26-T30 PolarHBondContact O-N 2.83Å
27	Y	50.3	Low	55.9	Low	135 Å²	135	103 Å²	103	53%	0.529	53%	0.534	S	S	.	.	H	α-helix	trans	-54.3	-30.5	172.2	-118.5	-92.9	0	0	0	110.3	C25 S29 T30 F31	C25-Y27 HydrophobicContact CB-CD2 4.14Å; C25-Y27 PolarHBondContact O-N 3.49Å; Y27-S29 VanDerWaalsContact C-N 3.28Å; Y27-S29 PolarHBondContact O-N 3.43Å; Y27-T30 PolarHBondContact O-OG1 2.84Å; Y27-F31 AromaticContact CD1-CD2 3.97Å; Y27-F31 HydrophobicContact CD1-CD2 3.97Å; Y27-F31 AromaticContact CD1-CE2 3.52Å; Y27-F31 HydrophobicContact CD1-CE2 3.52Å; Y27-F31 HydrophobicContact CE1-CD2 4.46Å; Y27-F31 AromaticContact CE1-CE2 3.59Å; Y27-F31 HydrophobicContact CE1-CE2 3.59Å; Y27-F31 HydrophobicContact CE1-CZ 4.36Å; Y27-F31 WeakPolarHBondContact O-CD2 3.32Å
28	R	50.9	Low	56.6	Low	226 Å²	226	100.7 Å²	100.7	85%	0.853	53%	0.525	S	S	*	.	H	α-helix	trans	-66.1	-26.8	173.9	-150.2	176.7	-172.2	-176.2	2	113.3	P26	P26-R28 PolarHBondContact O-N 2.84Å; P26-R28 VanDerWaalsContact O-N 3.16Å
29	S	51.2	Low	57.3	Low	37 Å²	37	100.2 Å²	100.2	26%	0.259	51%	0.513	S	S	.	.	H	α-helix	trans	-88.2	-32.1	-178.5	79.1	0	0	0	0	113.4	P26 Y27 K33	P26-S29 WeakPolarHBondContact CB-OG 3.28Å; P26-S29 WeakPolarHBondContact CG-OG 3.4Å; P26-S29 PolarHBondContact O-N 3.39Å; P26-S29 PolarHBondContact O-OG 3.36Å; Y27-S29 VanDerWaalsContact C-N 3.28Å; Y27-S29 PolarHBondContact O-N 3.43Å; S29-K33 WeakPolarHBondContact O-CB 3.41Å; S29-K33 WeakPolarHBondContact O-CD 3.45Å; S29-K33 WeakPolarHBondContact O-CG 3.44Å; S29-K33 PolarHBondContact O-N 2.86Å
30	T	53.1	Low	58.1	Low	73 Å²	73	103.5 Å²	103.5	45%	0.448	52%	0.515	S	S	.	.	H	α-helix	trans	-75.9	-34.6	-177.6	45.8	0	0	0	0	112.4	P26 Y27	P26-T30 PolarHBondContact O-N 2.83Å; Y27-T30 PolarHBondContact O-OG1 2.84Å
31	F	50.1	Low	58.8	Low	66 Å²	66	106.5 Å²	106.5	29%	0.289	52%	0.524	S	S	.	.	H	α-helix	trans	-71.7	-34.7	173.5	-80.4	-67.3	0	0	0	113.6	Y27 F41	Y27-F31 AromaticContact CD1-CD2 3.97Å; Y27-F31 HydrophobicContact CD1-CD2 3.97Å; Y27-F31 AromaticContact CD1-CE2 3.52Å; Y27-F31 HydrophobicContact CD1-CE2 3.52Å; Y27-F31 HydrophobicContact CE1-CD2 4.46Å; Y27-F31 AromaticContact CE1-CE2 3.59Å; Y27-F31 HydrophobicContact CE1-CE2 3.59Å; Y27-F31 HydrophobicContact CE1-CZ 4.36Å; Y27-F31 WeakPolarHBondContact O-CD2 3.32Å; F31-F41 HydrophobicContact CE1-CB 4.38Å; F31-F41 HydrophobicContact CE1-CD1 4.32Å; F31-F41 AromaticContact CE1-CD2 3.52Å; F31-F41 HydrophobicContact CE1-CD2 3.52Å; F31-F41 AromaticContact CE1-CE2 3.76Å; F31-F41 HydrophobicContact CE1-CE2 3.76Å; F31-F41 AromaticContact CE1-CG 3.81Å; F31-F41 HydrophobicContact CE1-CG 3.81Å; F31-F41 HydrophobicContact CE1-CZ 4.26Å; F31-F41 HydrophobicContact CZ-CD1 4.28Å; F31-F41 AromaticContact CZ-CD2 4Å; F31-F41 HydrophobicContact CZ-CD2 4Å; F31-F41 HydrophobicContact CZ-CE1 4.12Å; F31-F41 AromaticContact CZ-CE2 3.81Å; F31-F41 HydrophobicContact CZ-CE2 3.81Å; F31-F41 HydrophobicContact CZ-CG 4.22Å; F31-F41 AromaticContact CZ-CZ 3.88Å; F31-F41 HydrophobicContact CZ-CZ 3.88Å
32	C	52.3	Low	59.9	Low	110 Å²	110	109.4 Å²	109.4	74%	0.743	54%	0.538	S	S	*	.	H	α-helix	trans	-80.3	-19	179	-72.9	0	0	0	0	114.1
33	K	61.4	Low	60.9	Low	152 Å²	152	105.1 Å²	105.1	66%	0.661	53%	0.53	S	S	*	.	H	α-helix	trans	-74.8	-32.9	-179.2	-82.3	172.3	-175.8	-176.4	0	113.4	S29	S29-K33 WeakPolarHBondContact O-CB 3.41Å; S29-K33 WeakPolarHBondContact O-CD 3.45Å; S29-K33 WeakPolarHBondContact O-CG 3.44Å; S29-K33 PolarHBondContact O-N 2.86Å
34	N	64.2	Low	61.8	Low	88 Å²	88	95.5 Å²	95.5	47%	0.471	50%	0.503	S	S	.	.			trans	-127	103.9	-179.6	-82.7	-34.2	0	0	0	109.7	F36 L37	N34-F36 PolarHBondContact O-N 2.9Å; N34-F36 VanDerWaalsContact O-N 3.12Å; N34-L37 HydrophobicContact CB-CB 4.26Å; N34-L37 HydrophobicContact CB-CD1 4.28Å; N34-L37 WeakPolarHBondContact O-CB 3.34Å; N34-L37 PolarHBondContact O-N 2.85Å
35	P	64.7	Low	62.9	Low	93 Å²	93	99.1 Å²	99.1	60%	0.604	51%	0.509	S	S	*	.	H	α-helix	trans	-58	-28.9	176.6	23.8	-33.4	0	0	0	111.8	L37 G38 V39	P35-L37 VanDerWaalsContact C-N 3.33Å; P35-L37 PolarHBondContact O-N 3.43Å; P35-G38 PolarHBondContact O-N 2.9Å; P35-V39 WeakPolarHBondContact O-CG2 3.36Å; P35-V39 PolarHBondContact O-N 3.11Å; P35-V39 VanDerWaalsContact O-N 3.13Å
36	F	69.2	Low	64.3	Low	140 Å²	140	101.3 Å²	101.3	61%	0.614	52%	0.521	S	S	*	.	H	α-helix	trans	-58.4	-39.9	173.1	-62.9	-70.9	0	0	0	113	N34 G38 V39 Y40	N34-F36 PolarHBondContact O-N 2.9Å; N34-F36 VanDerWaalsContact O-N 3.12Å; F36-G38 VanDerWaalsContact C-N 3.3Å; F36-G38 PolarHBondContact O-N 2.95Å; F36-V39 PolarHBondContact O-N 3.16Å; F36-Y40 HydrophobicContact CB-CD2 4.22Å; F36-Y40 HydrophobicContact CB-CE2 3.99Å; F36-Y40 WeakPolarHBondContact O-CD2 3.29Å; F36-Y40 PolarHBondContact O-N 3.44Å
37	L	64.1	Low	65.8	Low	72 Å²	72	100.9 Å²	100.9	38%	0.377	52%	0.517	S	S	.	.	H	α-helix	trans	-62.8	-39.5	179.2	-120.7	87.5	0	0	0	111.4	N34 P35 F41	N34-L37 HydrophobicContact CB-CB 4.26Å; N34-L37 HydrophobicContact CB-CD1 4.28Å; N34-L37 WeakPolarHBondContact O-CB 3.34Å; N34-L37 PolarHBondContact O-N 2.85Å; P35-L37 VanDerWaalsContact C-N 3.33Å; P35-L37 PolarHBondContact O-N 3.43Å; L37-F41 WeakPolarHBondContact O-CB 3.43Å; L37-F41 PolarHBondContact O-N 3.48Å
38	G	66.1	Low	67.2	Low	26 Å²	26	100.5 Å²	100.5	27%	0.268	52%	0.518	S	S	.	.	H	α-helix	trans	-63.2	-44.2	175	0	0	0	0	0	112	P35 F36 F41 T42	P35-G38 PolarHBondContact O-N 2.9Å; F36-G38 VanDerWaalsContact C-N 3.3Å; F36-G38 PolarHBondContact O-N 2.95Å; G38-F41 PolarHBondContact O-N 2.87Å; G38-T42 WeakPolarHBondContact O-CG2 3.39Å; G38-T42 PolarHBondContact O-N 3.32Å; G38-T42 PolarHBondContact O-OG1 3.45Å
39	V	70.9	Confident	68.6	Low	76 Å²	76	93 Å²	93	46%	0.461	50%	0.498	S	S	.	.	H	α-helix	trans	-66.4	-41.1	177.5	176.9	0	0	0	0	111.9	P35 F36 F41 T42 L43	P35-V39 WeakPolarHBondContact O-CG2 3.36Å; P35-V39 PolarHBondContact O-N 3.11Å; P35-V39 VanDerWaalsContact O-N 3.13Å; F36-V39 PolarHBondContact O-N 3.16Å; V39-F41 VanDerWaalsContact C-N 3.31Å; V39-F41 PolarHBondContact O-N 2.93Å; V39-T42 WeakPolarHBondContact CA-OG1 3.28Å; V39-T42 PolarHBondContact O-N 2.86Å; V39-T42 PolarHBondContact O-OG1 3.27Å; V39-T42 VanDerWaalsContact O-OG1 3.08Å; V39-L43 HydrophobicContact CG1-CD1 3.59Å; V39-L43 HydrophobicContact CG1-CG 4.18Å; V39-L43 VanDerWaalsContact O-CB 3.3Å; V39-L43 WeakPolarHBondContact O-CB 3.48Å; V39-L43 WeakPolarHBondContact O-CG 3.39Å; V39-L43 PolarHBondContact O-N 3.41Å
40	Y	73.1	Confident	70.1	Confident	171 Å²	171	97.4 Å²	97.4	67%	0.671	51%	0.51	S	S	*	.	H	α-helix	trans	-64.3	-36.5	173.4	-75	-62	0	0	0	111.8	F36 G44	F36-Y40 HydrophobicContact CB-CD2 4.22Å; F36-Y40 HydrophobicContact CB-CE2 3.99Å; F36-Y40 WeakPolarHBondContact O-CD2 3.29Å; F36-Y40 PolarHBondContact O-N 3.44Å; Y40-G44 WeakPolarHBondContact O-CA 3.13Å; Y40-G44 PolarHBondContact O-N 3.29Å
41	F	73.5	Confident	71.5	Confident	99 Å²	99	98.3 Å²	98.3	43%	0.434	51%	0.512	S	S	.	.	H	α-helix	trans	-67.3	-45.8	174.1	-104.8	-96	0	0	0	111.8	F31 L37 G38 V39 F45	F31-F41 HydrophobicContact CE1-CB 4.38Å; F31-F41 HydrophobicContact CE1-CD1 4.32Å; F31-F41 AromaticContact CE1-CD2 3.52Å; F31-F41 HydrophobicContact CE1-CD2 3.52Å; F31-F41 AromaticContact CE1-CE2 3.76Å; F31-F41 HydrophobicContact CE1-CE2 3.76Å; F31-F41 AromaticContact CE1-CG 3.81Å; F31-F41 HydrophobicContact CE1-CG 3.81Å; F31-F41 HydrophobicContact CE1-CZ 4.26Å; F31-F41 HydrophobicContact CZ-CD1 4.28Å; F31-F41 AromaticContact CZ-CD2 4Å; F31-F41 HydrophobicContact CZ-CD2 4Å; F31-F41 HydrophobicContact CZ-CE1 4.12Å; F31-F41 AromaticContact CZ-CE2 3.81Å; F31-F41 HydrophobicContact CZ-CE2 3.81Å; F31-F41 HydrophobicContact CZ-CG 4.22Å; F31-F41 AromaticContact CZ-CZ 3.88Å; F31-F41 HydrophobicContact CZ-CZ 3.88Å; L37-F41 WeakPolarHBondContact O-CB 3.43Å; L37-F41 PolarHBondContact O-N 3.48Å; G38-F41 PolarHBondContact O-N 2.87Å; V39-F41 VanDerWaalsContact C-N 3.31Å; V39-F41 PolarHBondContact O-N 2.93Å; F41-F45 AromaticContact CD1-CD2 3.97Å; F41-F45 HydrophobicContact CD1-CD2 3.97Å; F41-F45 AromaticContact CD1-CE2 3.74Å; F41-F45 HydrophobicContact CD1-CE2 3.74Å; F41-F45 AromaticContact CE1-CE2 3.93Å; F41-F45 HydrophobicContact CE1-CE2 3.93Å; F41-F45 VanDerWaalsContact O-CB 3.27Å; F41-F45 WeakPolarHBondContact O-CB 3.32Å; F41-F45 WeakPolarHBondContact O-CD2 3.47Å; F41-F45 PolarHBondContact O-N 2.88Å
42	T	76.1	Confident	72.9	Confident	91 Å²	91	100.8 Å²	100.8	56%	0.558	52%	0.523	S	S	*	.	H	α-helix	trans	-69.1	-48.4	-178.7	54.6	0	0	0	0	112.1	G38 V39 F45 V46	G38-T42 WeakPolarHBondContact O-CG2 3.39Å; G38-T42 PolarHBondContact O-N 3.32Å; G38-T42 PolarHBondContact O-OG1 3.45Å; V39-T42 WeakPolarHBondContact CA-OG1 3.28Å; V39-T42 PolarHBondContact O-N 2.86Å; V39-T42 PolarHBondContact O-OG1 3.27Å; V39-T42 VanDerWaalsContact O-OG1 3.08Å; T42-F45 PolarHBondContact O-N 3.43Å; T42-V46 WeakPolarHBondContact O-CG2 3.32Å; T42-V46 PolarHBondContact O-N 2.81Å
43	L	75.7	Confident	74.1	Confident	104 Å²	104	99.6 Å²	99.6	55%	0.545	51%	0.506	S	S	.	.	H	α-helix	trans	-67.3	-41.3	176.4	-68.6	174.6	0	0	0	111.2	V39 F45 V46 V47	V39-L43 HydrophobicContact CG1-CD1 3.59Å; V39-L43 HydrophobicContact CG1-CG 4.18Å; V39-L43 VanDerWaalsContact O-CB 3.3Å; V39-L43 WeakPolarHBondContact O-CB 3.48Å; V39-L43 WeakPolarHBondContact O-CG 3.39Å; V39-L43 PolarHBondContact O-N 3.41Å; L43-F45 PolarHBondContact O-N 3.28Å; L43-V46 PolarHBondContact O-N 3.44Å; L43-V46 VanDerWaalsContact O-N 3.17Å; L43-V47 WeakPolarHBondContact O-CB 3.43Å; L43-V47 VanDerWaalsContact O-CG2 3.29Å; L43-V47 WeakPolarHBondContact O-CG2 3.48Å; L43-V47 PolarHBondContact O-N 3.19Å
44	G	75.4	Confident	74.9	Confident	30 Å²	30	97.3 Å²	97.3	31%	0.309	50%	0.496	S	S	.	.	H	α-helix	trans	-58.8	-45.9	175.2	0	0	0	0	0	111.5	Y40 V46 V47 F48	Y40-G44 WeakPolarHBondContact O-CA 3.13Å; Y40-G44 PolarHBondContact O-N 3.29Å; G44-V46 PolarHBondContact O-N 3.46Å; G44-V47 PolarHBondContact O-N 2.74Å; G44-F48 WeakPolarHBondContact O-CA 3.24Å; G44-F48 WeakPolarHBondContact O-CB 3.07Å; G44-F48 PolarHBondContact O-N 3.49Å
45	F	79.2	Confident	75.5	Confident	146 Å²	146	97.6 Å²	97.6	64%	0.64	50%	0.497	S	S	*	.	H	α-helix	trans	-65.2	-22.4	177.3	-101.1	-94	0	0	0	114.3	F41 T42 L43 P49	F41-F45 AromaticContact CD1-CD2 3.97Å; F41-F45 HydrophobicContact CD1-CD2 3.97Å; F41-F45 AromaticContact CD1-CE2 3.74Å; F41-F45 HydrophobicContact CD1-CE2 3.74Å; F41-F45 AromaticContact CE1-CE2 3.93Å; F41-F45 HydrophobicContact CE1-CE2 3.93Å; F41-F45 VanDerWaalsContact O-CB 3.27Å; F41-F45 WeakPolarHBondContact O-CB 3.32Å; F41-F45 WeakPolarHBondContact O-CD2 3.47Å; F41-F45 PolarHBondContact O-N 2.88Å; T42-F45 PolarHBondContact O-N 3.43Å; L43-F45 PolarHBondContact O-N 3.28Å; F45-P49 WeakPolarHBondContact O-CD 3.11Å; F45-P49 WeakPolarHBondContact O-CG 3.44Å
46	V	79.7	Confident	75.8	Confident	110 Å²	110	95.2 Å²	95.2	67%	0.667	48%	0.479	S	S	*	.	H	α-helix	trans	-87.7	-43.9	175.4	177	0	0	0	0	110.8	T42 L43 G44	T42-V46 WeakPolarHBondContact O-CG2 3.32Å; T42-V46 PolarHBondContact O-N 2.81Å; L43-V46 PolarHBondContact O-N 3.44Å; L43-V46 VanDerWaalsContact O-N 3.17Å; G44-V46 PolarHBondContact O-N 3.46Å
47	V	79.9	Confident	75.8	Confident	74 Å²	74	95.5 Å²	95.5	45%	0.448	48%	0.48	S	S	.	.	H	α-helix	trans	-77.3	-36.4	-175.7	177.3	0	0	0	0	111.7	L43 G44 Y50 L51	L43-V47 WeakPolarHBondContact O-CB 3.43Å; L43-V47 VanDerWaalsContact O-CG2 3.29Å; L43-V47 WeakPolarHBondContact O-CG2 3.48Å; L43-V47 PolarHBondContact O-N 3.19Å; G44-V47 PolarHBondContact O-N 2.74Å; V47-Y50 PolarHBondContact O-N 3.06Å; V47-L51 HydrophobicContact CG1-CD1 3.7Å; V47-L51 HydrophobicContact CG1-CG 4.04Å; V47-L51 WeakPolarHBondContact O-CG 3.33Å; V47-L51 PolarHBondContact O-N 3.48Å
48	F	80.3	Confident	76.1	Confident	126 Å²	126	100.8 Å²	100.8	55%	0.553	50%	0.5	S	S	*	.	H	α-helix	trans	-64.1	-50.6	-175.9	-170.5	-92.4	0	0	0	112.2	G44 Y50 L51 F52	G44-F48 WeakPolarHBondContact O-CA 3.24Å; G44-F48 WeakPolarHBondContact O-CB 3.07Å; G44-F48 PolarHBondContact O-N 3.49Å; F48-Y50 PolarHBondContact O-N 3.43Å; F48-L51 PolarHBondContact O-N 2.92Å; F48-F52 AromaticContact CD1-CD2 3.62Å; F48-F52 HydrophobicContact CD1-CD2 3.62Å; F48-F52 AromaticContact CD1-CE2 3.74Å; F48-F52 HydrophobicContact CD1-CE2 3.74Å; F48-F52 HydrophobicContact CD2-CD2 4.2Å; F48-F52 AromaticContact CD2-CE2 3.87Å; F48-F52 HydrophobicContact CD2-CE2 3.87Å; F48-F52 AromaticContact CE1-CD2 3.52Å; F48-F52 HydrophobicContact CE1-CD2 3.52Å; F48-F52 AromaticContact CE1-CE2 3.21Å; F48-F52 HydrophobicContact CE1-CE2 3.21Å; F48-F52 HydrophobicContact CE1-CG 4.4Å; F48-F52 AromaticContact CE1-CZ 3.83Å; F48-F52 HydrophobicContact CE1-CZ 3.83Å; F48-F52 HydrophobicContact CE2-CD2 4.14Å; F48-F52 AromaticContact CE2-CE2 3.37Å; F48-F52 HydrophobicContact CE2-CE2 3.37Å; F48-F52 HydrophobicContact CE2-CZ 4.2Å; F48-F52 AromaticContact CG-CD2 3.97Å; F48-F52 HydrophobicContact CG-CD2 3.97Å; F48-F52 HydrophobicContact CG-CE2 4.05Å; F48-F52 AromaticContact CZ-CD2 3.82Å; F48-F52 HydrophobicContact CZ-CD2 3.82Å; F48-F52 AromaticContact CZ-CE2 3.02Å; F48-F52 HydrophobicContact CZ-CE2 3.02Å; F48-F52 AromaticContact CZ-CZ 3.55Å; F48-F52 HydrophobicContact CZ-CZ 3.55Å; F48-F52 WeakPolarHBondContact O-CB 3.22Å; F48-F52 VanDerWaalsContact O-CD2 3.3Å; F48-F52 WeakPolarHBondContact O-CD2 3.28Å; F48-F52 PolarHBondContact O-N 2.96Å
49	P	80.8	Confident	76.2	Confident	69 Å²	69	105.2 Å²	105.2	45%	0.448	52%	0.517	S	S	.	.	H	α-helix	trans	-61.2	-34.8	175.1	-20.7	33.2	0	0	0	112.4	F45 F52 H53	F45-P49 WeakPolarHBondContact O-CD 3.11Å; F45-P49 WeakPolarHBondContact O-CG 3.44Å; P49-F52 PolarHBondContact O-N 3.45Å; P49-H53 WeakPolarHBondContact O-CB 3.42Å; P49-H53 PolarHBondContact O-N 3.36Å
50	Y	81.8	Confident	76	Confident	130 Å²	130	102.9 Å²	102.9	51%	0.51	51%	0.508	S	S	.	.	H	α-helix	trans	-67.3	-43.6	178.5	-175.7	-98.6	0	0	0	112.4	V47 F48 K54	V47-Y50 PolarHBondContact O-N 3.06Å; F48-Y50 PolarHBondContact O-N 3.43Å; Y50-K54 HydrophobicContact CD1-CD 4.33Å; Y50-K54 HydrophobicContact CE1-CD 3.67Å; Y50-K54 HydrophobicContact CE1-CG 4.44Å; Y50-K54 WeakPolarHBondContact O-CB 3.29Å; Y50-K54 PolarHBondContact O-N 2.9Å; Y50-K54 WeakPolarHBondContact OH-CE 3.38Å; Y50-K54 PolarHBondContact OH-NZ 3.31Å
51	L	83.5	Confident	76	Confident	91 Å²	91	99.2 Å²	99.2	48%	0.476	50%	0.5	S	S	.	.	H	α-helix	trans	-64.7	-44.5	173.7	-73.2	173.2	0	0	0	111.2	V47 F48 K54 L55	V47-L51 HydrophobicContact CG1-CD1 3.7Å; V47-L51 HydrophobicContact CG1-CG 4.04Å; V47-L51 WeakPolarHBondContact O-CG 3.33Å; V47-L51 PolarHBondContact O-N 3.48Å; F48-L51 PolarHBondContact O-N 2.92Å; L51-K54 PolarHBondContact O-N 3.4Å; L51-L55 WeakPolarHBondContact O-CB 3.43Å; L51-L55 VanDerWaalsContact O-CG 3.27Å; L51-L55 WeakPolarHBondContact O-CG 3.36Å; L51-L55 PolarHBondContact O-N 3Å
52	F	79.4	Confident	75.8	Confident	119 Å²	119	98.1 Å²	98.1	52%	0.522	50%	0.496	S	S	.	.	H	α-helix	trans	-59.4	-47.7	175.7	-94.1	-95.7	0	0	0	111.5	F48 P49 K54 L55 D56	F48-F52 AromaticContact CD1-CD2 3.62Å; F48-F52 HydrophobicContact CD1-CD2 3.62Å; F48-F52 AromaticContact CD1-CE2 3.74Å; F48-F52 HydrophobicContact CD1-CE2 3.74Å; F48-F52 HydrophobicContact CD2-CD2 4.2Å; F48-F52 AromaticContact CD2-CE2 3.87Å; F48-F52 HydrophobicContact CD2-CE2 3.87Å; F48-F52 AromaticContact CE1-CD2 3.52Å; F48-F52 HydrophobicContact CE1-CD2 3.52Å; F48-F52 AromaticContact CE1-CE2 3.21Å; F48-F52 HydrophobicContact CE1-CE2 3.21Å; F48-F52 HydrophobicContact CE1-CG 4.4Å; F48-F52 AromaticContact CE1-CZ 3.83Å; F48-F52 HydrophobicContact CE1-CZ 3.83Å; F48-F52 HydrophobicContact CE2-CD2 4.14Å; F48-F52 AromaticContact CE2-CE2 3.37Å; F48-F52 HydrophobicContact CE2-CE2 3.37Å; F48-F52 HydrophobicContact CE2-CZ 4.2Å; F48-F52 AromaticContact CG-CD2 3.97Å; F48-F52 HydrophobicContact CG-CD2 3.97Å; F48-F52 HydrophobicContact CG-CE2 4.05Å; F48-F52 AromaticContact CZ-CD2 3.82Å; F48-F52 HydrophobicContact CZ-CD2 3.82Å; F48-F52 AromaticContact CZ-CE2 3.02Å; F48-F52 HydrophobicContact CZ-CE2 3.02Å; F48-F52 AromaticContact CZ-CZ 3.55Å; F48-F52 HydrophobicContact CZ-CZ 3.55Å; F48-F52 WeakPolarHBondContact O-CB 3.22Å; F48-F52 VanDerWaalsContact O-CD2 3.3Å; F48-F52 WeakPolarHBondContact O-CD2 3.28Å; F48-F52 PolarHBondContact O-N 2.96Å; P49-F52 PolarHBondContact O-N 3.45Å; F52-K54 VanDerWaalsContact C-N 3.35Å; F52-K54 PolarHBondContact O-N 2.85Å; F52-L55 PolarHBondContact O-N 2.77Å; F52-D56 VanDerWaalsContact O-CB 3.3Å; F52-D56 WeakPolarHBondContact O-CB 3.3Å; F52-D56 PolarHBondContact O-N 3.2Å
53	H	76.1	Confident	75.5	Confident	85 Å²	85	99.6 Å²	99.6	39%	0.394	50%	0.496	S	S	.	.	H	α-helix	trans	-64.6	-37.2	178.8	176.9	-100.2	0	0	0	112.5	P49 K57	P49-H53 WeakPolarHBondContact O-CB 3.42Å; P49-H53 PolarHBondContact O-N 3.36Å; H53-K57 WeakPolarHBondContact CE1-CE 3.27Å; H53-K57 PolarHBondContact CE1-NZ 3.42Å; H53-K57 WeakPolarHBondContact NE2-CE 3.37Å; H53-K57 WeakPolarHBondContact O-CB 3.33Å; H53-K57 WeakPolarHBondContact O-CG 3.31Å; H53-K57 PolarHBondContact O-N 3.48Å
54	K	78.6	Confident	75.4	Confident	104 Å²	104	96.2 Å²	96.2	45%	0.452	49%	0.486	S	S	.	.	H	α-helix	trans	-67	-40.9	172.5	-90.6	-173.6	166.7	174.7	0	112.5	Y50 L51 F52 K58	Y50-K54 HydrophobicContact CD1-CD 4.33Å; Y50-K54 HydrophobicContact CE1-CD 3.67Å; Y50-K54 HydrophobicContact CE1-CG 4.44Å; Y50-K54 WeakPolarHBondContact O-CB 3.29Å; Y50-K54 PolarHBondContact O-N 2.9Å; Y50-K54 WeakPolarHBondContact OH-CE 3.38Å; Y50-K54 PolarHBondContact OH-NZ 3.31Å; L51-K54 PolarHBondContact O-N 3.4Å; F52-K54 VanDerWaalsContact C-N 3.35Å; F52-K54 PolarHBondContact O-N 2.85Å; K54-K58 WeakPolarHBondContact O-CG 3.45Å; K54-K58 PolarHBondContact O-N 3.42Å
55	L	77.4	Confident	75.3	Confident	93 Å²	93	103.1 Å²	103.1	49%	0.487	50%	0.503	S	S	.	.	H	α-helix	trans	-67.1	-41.1	176.7	-73.7	169.1	0	0	0	111.2	L51 F52 K58 L59	L51-L55 WeakPolarHBondContact O-CB 3.43Å; L51-L55 VanDerWaalsContact O-CG 3.27Å; L51-L55 WeakPolarHBondContact O-CG 3.36Å; L51-L55 PolarHBondContact O-N 3Å; F52-L55 PolarHBondContact O-N 2.77Å; L55-K58 PolarHBondContact O-N 2.99Å; L55-L59 HydrophobicContact CB-CD1 4.49Å; L55-L59 VanDerWaalsContact O-CB 3.31Å; L55-L59 WeakPolarHBondContact O-CB 3.43Å; L55-L59 WeakPolarHBondContact O-CG 3.44Å; L55-L59 PolarHBondContact O-N 3.39Å
56	D	70.1	Confident	75.3	Confident	44 Å²	44	102.5 Å²	102.5	24%	0.235	50%	0.5	C	S	.	.	H	α-helix	trans	-63.9	-44.1	178.3	-154.3	-20.6	0	0	0	111.1	F52 K58 L59 G60 I61 E62	F52-D56 VanDerWaalsContact O-CB 3.3Å; F52-D56 WeakPolarHBondContact O-CB 3.3Å; F52-D56 PolarHBondContact O-N 3.2Å; D56-K58 PolarHBondContact O-N 3.05Å; D56-L59 PolarHBondContact O-N 2.96Å; D56-G60 PolarHBondContact O-N 3.23Å; D56-I61 PolarHBondContact O-N 3.49Å; D56-I61 WeakPolarHBondContact OD1-CB 3.46Å; D56-E62 PolarHBondContact OD1-N 3.06Å
57	K	70.1	Confident	75.4	Confident	146 Å²	146	105.2 Å²	105.2	64%	0.635	50%	0.498	S	S	*	.	H	α-helix	trans	-61	-38.9	171.7	-79.1	-172.6	173.6	-174.2	0	113.5	H53	H53-K57 WeakPolarHBondContact CE1-CE 3.27Å; H53-K57 PolarHBondContact CE1-NZ 3.42Å; H53-K57 WeakPolarHBondContact NE2-CE 3.37Å; H53-K57 WeakPolarHBondContact O-CB 3.33Å; H53-K57 WeakPolarHBondContact O-CG 3.31Å; H53-K57 PolarHBondContact O-N 3.48Å
58	K	70.8	Confident	75.3	Confident	182 Å²	182	106.5 Å²	106.5	79%	0.791	50%	0.501	S	S	*	.	H	α-helix	trans	-73.9	-39.3	178.7	-79.7	-169.8	177.6	-169.2	0	112.9	K54 L55 D56 G60	K54-K58 WeakPolarHBondContact O-CG 3.45Å; K54-K58 PolarHBondContact O-N 3.42Å; L55-K58 PolarHBondContact O-N 2.99Å; D56-K58 PolarHBondContact O-N 3.05Å; K58-G60 VanDerWaalsContact C-N 3.26Å
59	L	68.4	Low	75.4	Confident	119 Å²	119	104.5 Å²	104.5	62%	0.623	50%	0.495	S	S	*	.	H	α-helix	trans	-79.9	-12	180	-69.4	163.6	0	0	0	111.9	L55 D56 I61	L55-L59 HydrophobicContact CB-CD1 4.49Å; L55-L59 VanDerWaalsContact O-CB 3.31Å; L55-L59 WeakPolarHBondContact O-CB 3.43Å; L55-L59 WeakPolarHBondContact O-CG 3.44Å; L55-L59 PolarHBondContact O-N 3.39Å; D56-L59 PolarHBondContact O-N 2.96Å; L59-I61 HydrophobicContact CB-CD1 3.61Å; L59-I61 HydrophobicContact CB-CG1 3.72Å; L59-I61 HydrophobicContact CD1-CD1 3.77Å; L59-I61 HydrophobicContact CG-CD1 4.28Å; L59-I61 PolarHBondContact O-N 3.41Å; L59-I61 VanDerWaalsContact O-N 3.16Å
60	G	67.2	Low	75.5	Confident	27 Å²	27	107.6 Å²	107.6	28%	0.278	50%	0.502	S	S	.	.	T	Hydrogen-bonded Turn	trans	62.4	20.3	-179.2	0	0	0	0	0	112.8	D56 K58 E62 E63 G64	D56-G60 PolarHBondContact O-N 3.23Å; K58-G60 VanDerWaalsContact C-N 3.26Å; G60-E62 VanDerWaalsContact C-N 3.34Å; G60-E62 PolarHBondContact O-N 3.42Å; G60-E63 PolarHBondContact O-N 2.96Å; G60-G64 PolarHBondContact O-N 2.87Å
61	I	71.7	Confident	75.5	Confident	95 Å²	95	105.3 Å²	105.3	49%	0.487	50%	0.496	S	S	.	.	H	α-helix	trans	-67.1	-39.4	-175.1	-66.8	163.1	0	0	0	109.5	D56 L59 G64 R65	D56-I61 PolarHBondContact O-N 3.49Å; D56-I61 WeakPolarHBondContact OD1-CB 3.46Å; L59-I61 HydrophobicContact CB-CD1 3.61Å; L59-I61 HydrophobicContact CB-CG1 3.72Å; L59-I61 HydrophobicContact CD1-CD1 3.77Å; L59-I61 HydrophobicContact CG-CD1 4.28Å; L59-I61 PolarHBondContact O-N 3.41Å; L59-I61 VanDerWaalsContact O-N 3.16Å; I61-G64 PolarHBondContact O-N 3.42Å; I61-R65 WeakPolarHBondContact O-CB 3.4Å; I61-R65 PolarHBondContact O-N 2.9Å
62	E	69	Low	75.4	Confident	76 Å²	76	108.7 Å²	108.7	36%	0.355	50%	0.502	S	S	.	.	H	α-helix	trans	-58.5	-46.8	172.5	-97	-173	-157	0	0	113.2	D56 G60 R65 K66	D56-E62 PolarHBondContact OD1-N 3.06Å; G60-E62 VanDerWaalsContact C-N 3.34Å; G60-E62 PolarHBondContact O-N 3.42Å; E62-R65 PolarHBondContact O-N 3.01Å; E62-K66 WeakPolarHBondContact O-CB 3.22Å; E62-K66 VanDerWaalsContact O-CG 3.28Å; E62-K66 WeakPolarHBondContact O-CG 3.46Å; E62-K66 PolarHBondContact O-N 3.27Å
63	E	70.7	Confident	75.2	Confident	122 Å²	122	112 Å²	112	57%	0.57	51%	0.511	S	S	*	.	H	α-helix	trans	-67.5	-43.4	178.7	-68.7	-172.7	-174.4	0	0	111.1	G60 R65 K66 R67	G60-E63 PolarHBondContact O-N 2.96Å; E63-R65 VanDerWaalsContact C-N 3.33Å; E63-R65 PolarHBondContact O-N 2.88Å; E63-K66 PolarHBondContact O-N 3.28Å; E63-R67 WeakPolarHBondContact O-CB 3.41Å; E63-R67 VanDerWaalsContact O-CG 3.32Å; E63-R67 WeakPolarHBondContact O-CG 3.49Å; E63-R67 PolarHBondContact O-N 3.47Å
64	G	74.5	Confident	75.1	Confident	32 Å²	32	112.6 Å²	112.6	33%	0.33	51%	0.514	S	S	.	.	H	α-helix	trans	-60.5	-40.9	174	0	0	0	0	0	112.2	G60 I61 R67 M68	G60-G64 PolarHBondContact O-N 2.87Å; I61-G64 PolarHBondContact O-N 3.42Å; G64-R67 PolarHBondContact O-N 2.89Å; G64-M68 VanDerWaalsContact O-CB 3.28Å; G64-M68 WeakPolarHBondContact O-CB 3.5Å; G64-M68 VanDerWaalsContact O-CG 3.29Å; G64-M68 WeakPolarHBondContact O-CG 3.31Å; G64-M68 PolarHBondContact O-N 2.83Å
65	R	73.3	Confident	74.9	Confident	175 Å²	175	113.7 Å²	113.7	66%	0.66	52%	0.516	S	S	*	.	H	α-helix	trans	-68	-40.9	175.7	-176.7	178.9	142.1	-174.3	-5.8	111.5	I61 E62 E63 M68 L69	I61-R65 WeakPolarHBondContact O-CB 3.4Å; I61-R65 PolarHBondContact O-N 2.9Å; E62-R65 PolarHBondContact O-N 3.01Å; E63-R65 VanDerWaalsContact C-N 3.33Å; E63-R65 PolarHBondContact O-N 2.88Å; R65-M68 PolarHBondContact O-N 3.45Å; R65-L69 HydrophobicContact CG-CD1 4.12Å; R65-L69 VanDerWaalsContact O-CB 3.29Å; R65-L69 WeakPolarHBondContact O-CB 3.27Å; R65-L69 VanDerWaalsContact O-CG 3.22Å; R65-L69 WeakPolarHBondContact O-CG 3.3Å; R65-L69 PolarHBondContact O-N 3.16Å
66	K	78.6	Confident	74.5	Confident	134 Å²	134	115.9 Å²	115.9	58%	0.583	52%	0.521	S	S	*	.	H	α-helix	trans	-63.2	-43.4	174	-75.3	173.6	-173.6	170.7	0	111.2	E62 E63 L69 K70	E62-K66 WeakPolarHBondContact O-CB 3.22Å; E62-K66 VanDerWaalsContact O-CG 3.28Å; E62-K66 WeakPolarHBondContact O-CG 3.46Å; E62-K66 PolarHBondContact O-N 3.27Å; E63-K66 PolarHBondContact O-N 3.28Å; K66-L69 PolarHBondContact O-N 3.43Å; K66-K70 WeakPolarHBondContact O-CB 3.46Å; K66-K70 PolarHBondContact O-N 3.2Å
67	R	81.1	Confident	74.1	Confident	166 Å²	166	120.1 Å²	120.1	63%	0.626	54%	0.541	S	S	*	.	H	α-helix	trans	-62.6	-49	174.4	-71.5	178.2	-171.5	-168.7	5.4	111.6	E63 G64 L69 K70 E71	E63-R67 WeakPolarHBondContact O-CB 3.41Å; E63-R67 VanDerWaalsContact O-CG 3.32Å; E63-R67 WeakPolarHBondContact O-CG 3.49Å; E63-R67 PolarHBondContact O-N 3.47Å; G64-R67 PolarHBondContact O-N 2.89Å; R67-L69 VanDerWaalsContact C-N 3.32Å; R67-L69 PolarHBondContact O-N 3.3Å; R67-K70 WeakPolarHBondContact O-CB 3.42Å; R67-K70 PolarHBondContact O-N 3.12Å; R67-K70 VanDerWaalsContact O-N 3.11Å; R67-E71 PolarHBondContact O-N 3.25Å
68	M	78.2	Confident	73.8	Confident	101 Å²	101	120.7 Å²	120.7	50%	0.498	55%	0.546	S	S	.	.	H	α-helix	trans	-59.1	-39.5	175	-81	-76.1	-75.5	0	0	113	G64 R65 R72	G64-M68 VanDerWaalsContact O-CB 3.28Å; G64-M68 WeakPolarHBondContact O-CB 3.5Å; G64-M68 VanDerWaalsContact O-CG 3.29Å; G64-M68 WeakPolarHBondContact O-CG 3.31Å; G64-M68 PolarHBondContact O-N 2.83Å; R65-M68 PolarHBondContact O-N 3.45Å; M68-R72 WeakPolarHBondContact O-CB 3.43Å; M68-R72 WeakPolarHBondContact O-CG 3.11Å; M68-R72 PolarHBondContact O-N 2.91Å
69	L	81.7	Confident	73.5	Confident	84 Å²	84	122 Å²	122	44%	0.44	55%	0.546	S	S	.	.	H	α-helix	trans	-68.1	-39.3	175.2	-77.9	169.5	0	0	0	111.8	R65 K66 R67 R72 R73	R65-L69 HydrophobicContact CG-CD1 4.12Å; R65-L69 VanDerWaalsContact O-CB 3.29Å; R65-L69 WeakPolarHBondContact O-CB 3.27Å; R65-L69 VanDerWaalsContact O-CG 3.22Å; R65-L69 WeakPolarHBondContact O-CG 3.3Å; R65-L69 PolarHBondContact O-N 3.16Å; K66-L69 PolarHBondContact O-N 3.43Å; R67-L69 VanDerWaalsContact C-N 3.32Å; R67-L69 PolarHBondContact O-N 3.3Å; L69-R72 PolarHBondContact O-N 3.24Å; L69-R73 WeakPolarHBondContact O-CG 3.37Å; L69-R73 PolarHBondContact O-N 3.27Å
70	K	83.3	Confident	73	Confident	135 Å²	135	120.4 Å²	120.4	59%	0.587	54%	0.537	S	S	*	.	H	α-helix	trans	-65	-49.4	176	-171.6	178.5	175.6	-173.2	0	111	K66 R67 R72 R73 E74	K66-K70 WeakPolarHBondContact O-CB 3.46Å; K66-K70 PolarHBondContact O-N 3.2Å; R67-K70 WeakPolarHBondContact O-CB 3.42Å; R67-K70 PolarHBondContact O-N 3.12Å; R67-K70 VanDerWaalsContact O-N 3.11Å; K70-R72 VanDerWaalsContact C-N 3.32Å; K70-R72 PolarHBondContact O-N 2.77Å; K70-R73 WeakPolarHBondContact O-CB 3.21Å; K70-R73 PolarHBondContact O-N 2.86Å; K70-E74 WeakPolarHBondContact CE-OE1 3.45Å; K70-E74 PolarHBondContact O-N 2.91Å
71	E	82.9	Confident	72.6	Confident	82 Å²	82	121 Å²	121	38%	0.383	54%	0.544	S	S	.	.	H	α-helix	trans	-59.5	-40.8	174.5	-74.3	-177.5	-155.7	0	0	112.1	R67 R73 E74 R75	R67-E71 PolarHBondContact O-N 3.25Å; E71-R73 VanDerWaalsContact C-N 3.3Å; E71-R73 PolarHBondContact O-N 2.81Å; E71-E74 PolarHBondContact O-N 2.89Å; E71-R75 WeakPolarHBondContact O-CB 3.44Å; E71-R75 VanDerWaalsContact O-CG 3.25Å; E71-R75 WeakPolarHBondContact O-CG 3.37Å; E71-R75 PolarHBondContact O-N 2.91Å; E71-R75 IonicContact OE2-CZ 3.89Å; E71-R75 IonicContact OE2-NH2 2.84Å; E71-R75 PolarHBondContact OE2-NH2 2.98Å
72	R	79.6	Confident	72.2	Confident	161 Å²	161	117.3 Å²	117.3	61%	0.608	53%	0.529	S	S	*	.	H	α-helix	trans	-63.1	-35.6	174.8	-84.5	-173.1	-177.3	-167.2	2.1	112.5	M68 L69 K70 K76	M68-R72 WeakPolarHBondContact O-CB 3.43Å; M68-R72 WeakPolarHBondContact O-CG 3.11Å; M68-R72 PolarHBondContact O-N 2.91Å; L69-R72 PolarHBondContact O-N 3.24Å; K70-R72 VanDerWaalsContact C-N 3.32Å; K70-R72 PolarHBondContact O-N 2.77Å; R72-K76 WeakPolarHBondContact O-CB 3.49Å; R72-K76 WeakPolarHBondContact O-CG 3.42Å; R72-K76 PolarHBondContact O-N 3.38Å; R72-K76 VanDerWaalsContact O-N 3.1Å
73	R	75.8	Confident	72.1	Confident	188 Å²	188	121.8 Å²	121.8	71%	0.709	55%	0.55	S	S	*	.	H	α-helix	trans	-68.3	-48.1	175.2	-76.5	-176.8	-170.1	-164.5	2.7	110.6	L69 K70 E71 R75 K76 M77	L69-R73 WeakPolarHBondContact O-CG 3.37Å; L69-R73 PolarHBondContact O-N 3.27Å; K70-R73 WeakPolarHBondContact O-CB 3.21Å; K70-R73 PolarHBondContact O-N 2.86Å; E71-R73 VanDerWaalsContact C-N 3.3Å; E71-R73 PolarHBondContact O-N 2.81Å; R73-R75 PolarHBondContact O-N 3.05Å; R73-K76 WeakPolarHBondContact O-CB 2.91Å; R73-K76 PolarHBondContact O-N 3.13Å; R73-K76 VanDerWaalsContact O-N 3.08Å; R73-M77 WeakPolarHBondContact O-CG 3.36Å; R73-M77 PolarHBondContact O-N 2.65Å
74	E	75.1	Confident	72.3	Confident	98 Å²	98	121.9 Å²	121.9	46%	0.458	55%	0.55	S	S	.	.	H	α-helix	trans	-58.7	-48.4	178.2	-71.3	168.4	-179.3	0	0	111.2	K70 E71 K76 M77 E78	K70-E74 WeakPolarHBondContact CE-OE1 3.45Å; K70-E74 PolarHBondContact O-N 2.91Å; E71-E74 PolarHBondContact O-N 2.89Å; E74-K76 VanDerWaalsContact C-N 3.26Å; E74-K76 PolarHBondContact O-N 3Å; E74-M77 WeakPolarHBondContact O-CB 2.9Å; E74-M77 PolarHBondContact O-N 2.86Å; E74-E78 PolarHBondContact O-N 3.31Å
75	R	73	Confident	72.2	Confident	128 Å²	128	124.2 Å²	124.2	48%	0.483	55%	0.552	S	S	.	*	H	α-helix	trans	-61.4	-32	174.8	-68.4	-179	-149.8	-170.3	7.6	113.4	E71 R73 R79	E71-R75 WeakPolarHBondContact O-CB 3.44Å; E71-R75 VanDerWaalsContact O-CG 3.25Å; E71-R75 WeakPolarHBondContact O-CG 3.37Å; E71-R75 PolarHBondContact O-N 2.91Å; E71-R75 IonicContact OE2-CZ 3.89Å; E71-R75 IonicContact OE2-NH2 2.84Å; E71-R75 PolarHBondContact OE2-NH2 2.98Å; R73-R75 PolarHBondContact O-N 3.05Å; R75-R79 WeakPolarHBondContact O-CB 3.05Å; R75-R79 WeakPolarHBondContact O-CG 3.29Å; R75-R79 PolarHBondContact O-N 2.99Å; R75-R79 VanDerWaalsContact O-N 3.1Å
76	K	68.9	Low	72.5	Confident	139 Å²	139	123.1 Å²	123.1	60%	0.604	55%	0.553	S	S	*	*	H	α-helix	trans	-70.8	-40.4	173.6	-83.3	-174.9	176.5	-166.4	0	111.1	R72 R73 E74 E78 R79 I80	R72-K76 WeakPolarHBondContact O-CB 3.49Å; R72-K76 WeakPolarHBondContact O-CG 3.42Å; R72-K76 PolarHBondContact O-N 3.38Å; R72-K76 VanDerWaalsContact O-N 3.1Å; R73-K76 WeakPolarHBondContact O-CB 2.91Å; R73-K76 PolarHBondContact O-N 3.13Å; R73-K76 VanDerWaalsContact O-N 3.08Å; E74-K76 VanDerWaalsContact C-N 3.26Å; E74-K76 PolarHBondContact O-N 3Å; K76-E78 VanDerWaalsContact C-N 3.35Å; K76-R79 PolarHBondContact O-N 3.27Å; K76-I80 HydrophobicContact CB-CD1 4.39Å; K76-I80 WeakPolarHBondContact O-CB 3.39Å; K76-I80 WeakPolarHBondContact O-CG1 3.41Å; K76-I80 PolarHBondContact O-N 3.48Å
77	M	61.7	Low	72.6	Confident	133 Å²	133	121.5 Å²	121.5	66%	0.655	55%	0.55	S	S	*	.	H	α-helix	trans	-62	-43.3	175.3	-64.2	-55.7	-128.4	0	0	111.3	R73 E74 G81 G82	R73-M77 WeakPolarHBondContact O-CG 3.36Å; R73-M77 PolarHBondContact O-N 2.65Å; E74-M77 WeakPolarHBondContact O-CB 2.9Å; E74-M77 PolarHBondContact O-N 2.86Å; M77-G81 PolarHBondContact O-N 2.79Å; M77-G82 PolarHBondContact O-N 3.05Å
78	E	65.3	Low	72.7	Confident	157 Å²	157	119.9 Å²	119.9	73%	0.734	54%	0.544	S	S	*	.	H	α-helix	trans	-63.9	-45.7	177.2	-72.8	179.2	167.1	0	0	112.8	E74 K76	E74-E78 PolarHBondContact O-N 3.31Å; K76-E78 VanDerWaalsContact C-N 3.35Å
79	R	64.3	Low	73.1	Confident	211 Å²	211	119.2 Å²	119.2	80%	0.796	54%	0.542	S	S	*	.	H	α-helix	trans	-72.5	-28.3	-178.4	-74.2	-171.1	-151.6	-158.4	0.8	114.1	R75 K76	R75-R79 WeakPolarHBondContact O-CB 3.05Å; R75-R79 WeakPolarHBondContact O-CG 3.29Å; R75-R79 PolarHBondContact O-N 2.99Å; R75-R79 VanDerWaalsContact O-N 3.1Å; K76-R79 PolarHBondContact O-N 3.27Å
80	I	56.3	Low	73.5	Confident	85 Å²	85	121.7 Å²	121.7	44%	0.436	55%	0.547	S	S	.	.	H	α-helix	trans	-92.4	-6.4	-171.6	-64.4	176.2	0	0	0	111	K76 G82 Q85	K76-I80 HydrophobicContact CB-CD1 4.39Å; K76-I80 WeakPolarHBondContact O-CB 3.39Å; K76-I80 WeakPolarHBondContact O-CG1 3.41Å; K76-I80 PolarHBondContact O-N 3.48Å; I80-G82 PolarHBondContact O-N 2.93Å; I80-Q85 HydrophobicContact CG2-CB 4.47Å
81	G	60.7	Low	73.7	Confident	40 Å²	40	121.3 Å²	121.3	41%	0.412	55%	0.547	S	S	.	.	T	Hydrogen-bonded Turn	trans	53.9	42.4	-170.2	0	0	0	0	0	109.2	M77 E83 E84 Q85	M77-G81 PolarHBondContact O-N 2.79Å; G81-E83 PolarHBondContact O-N 2.85Å; G81-E84 PolarHBondContact O-N 3.48Å; G81-Q85 PolarHBondContact O-N 3.44Å
82	G	62	Low	74.1	Confident	17 Å²	17	124.7 Å²	124.7	18%	0.175	56%	0.557	C	S	.	*	H	α-helix	trans	-58.2	-27.4	-153.6	0	0	0	0	0	114.8	M77 I80 F86	M77-G82 PolarHBondContact O-N 3.05Å; I80-G82 PolarHBondContact O-N 2.93Å; G82-F86 WeakPolarHBondContact O-CB 3.25Å; G82-F86 PolarHBondContact O-N 2.76Å
83	E	68.1	Low	74.7	Confident	170 Å²	170	122 Å²	122	79%	0.794	55%	0.554	S	S	*	*	H	α-helix	trans	-67.7	-44.2	175.4	-65.6	-172.3	163.6	0	0	112.1	G81 F86 L87	G81-E83 PolarHBondContact O-N 2.85Å; E83-F86 PolarHBondContact O-N 2.89Å; E83-L87 WeakPolarHBondContact O-CB 3.49Å; E83-L87 VanDerWaalsContact O-CG 3.28Å; E83-L87 WeakPolarHBondContact O-CG 3.44Å; E83-L87 PolarHBondContact O-N 3.17Å
84	E	73.3	Confident	75.5	Confident	123 Å²	123	118.5 Å²	118.5	58%	0.575	54%	0.544	S	S	*	.	H	α-helix	trans	-68.9	-39.7	178.6	-64.9	-173	-178.9	0	0	112	G81 L87 R88	G81-E84 PolarHBondContact O-N 3.48Å; E84-L87 PolarHBondContact O-N 3.29Å; E84-R88 WeakPolarHBondContact O-CG 3.16Å; E84-R88 PolarHBondContact O-N 2.73Å; E84-R88 IonicContact OE2-NH1 3.39Å; E84-R88 PolarHBondContact OE2-NH1 3.01Å
85	Q	73.6	Confident	76.2	Confident	82 Å²	82	118.9 Å²	118.9	38%	0.383	55%	0.546	S	S	.	.	H	α-helix	trans	-69.9	-39.1	177.7	-167.9	164.7	1.2	0	0	111.3	I80 G81 L87 R88 D89	I80-Q85 HydrophobicContact CG2-CB 4.47Å; G81-Q85 PolarHBondContact O-N 3.44Å; Q85-L87 VanDerWaalsContact C-N 3.33Å; Q85-L87 PolarHBondContact O-N 3.03Å; Q85-R88 PolarHBondContact O-N 2.99Å; Q85-D89 WeakPolarHBondContact O-CB 3.33Å; Q85-D89 VanDerWaalsContact O-CG 3.32Å; Q85-D89 PolarHBondContact O-N 2.82Å
86	F	78.4	Confident	77.1	Confident	152 Å²	152	116.7 Å²	116.7	67%	0.667	54%	0.541	S	S	*	.	H	α-helix	trans	-62.2	-40.7	173.5	-173.4	-92.5	0	0	0	112	G82 E83 D89 Y90	G82-F86 WeakPolarHBondContact O-CB 3.25Å; G82-F86 PolarHBondContact O-N 2.76Å; E83-F86 PolarHBondContact O-N 2.89Å; F86-D89 PolarHBondContact O-N 3.15Å; F86-Y90 VanDerWaalsContact O-CB 3.24Å; F86-Y90 WeakPolarHBondContact O-CB 3.03Å; F86-Y90 PolarHBondContact O-N 3.01Å
87	L	81.9	Confident	78.2	Confident	100 Å²	100	115.1 Å²	115.1	52%	0.524	54%	0.539	S	S	.	.	H	α-helix	trans	-62	-45.1	174.2	-78.9	165.9	0	0	0	111.8	E83 E84 Q85 Y90 E91	E83-L87 WeakPolarHBondContact O-CB 3.49Å; E83-L87 VanDerWaalsContact O-CG 3.28Å; E83-L87 WeakPolarHBondContact O-CG 3.44Å; E83-L87 PolarHBondContact O-N 3.17Å; E84-L87 PolarHBondContact O-N 3.29Å; Q85-L87 VanDerWaalsContact C-N 3.33Å; Q85-L87 PolarHBondContact O-N 3.03Å; L87-Y90 PolarHBondContact O-N 3.41Å; L87-E91 WeakPolarHBondContact O-CG 3.3Å; L87-E91 PolarHBondContact O-N 3.49Å
88	R	83.6	Confident	79.6	Confident	132 Å²	132	113 Å²	113	50%	0.498	53%	0.53	S	S	.	.	H	α-helix	trans	-61.3	-44.8	176	-74.3	-174.7	-70.6	-102.7	1.1	112.1	E84 Q85 Y90 E91 Y92	E84-R88 WeakPolarHBondContact O-CG 3.16Å; E84-R88 PolarHBondContact O-N 2.73Å; E84-R88 IonicContact OE2-NH1 3.39Å; E84-R88 PolarHBondContact OE2-NH1 3.01Å; Q85-R88 PolarHBondContact O-N 2.99Å; R88-Y90 VanDerWaalsContact C-N 3.34Å; R88-E91 PolarHBondContact O-N 3.21Å; R88-Y92 WeakPolarHBondContact O-CB 2.97Å; R88-Y92 PolarHBondContact O-N 3.42Å
89	D	86.4	Confident	80.8	Confident	87 Å²	87	110.7 Å²	110.7	47%	0.465	52%	0.517	S	S	.	.	H	α-helix	trans	-66	-38.7	178.3	-71.2	-13.5	0	0	0	111.3	Q85 F86 Y92 L93	Q85-D89 WeakPolarHBondContact O-CB 3.33Å; Q85-D89 VanDerWaalsContact O-CG 3.32Å; Q85-D89 PolarHBondContact O-N 2.82Å; F86-D89 PolarHBondContact O-N 3.15Å; D89-Y92 PolarHBondContact O-N 3.48Å; D89-L93 WeakPolarHBondContact O-CB 3.27Å; D89-L93 WeakPolarHBondContact O-CG 3.43Å; D89-L93 PolarHBondContact O-N 3.32Å
90	Y	88.7	Confident	82	Confident	136 Å²	136	105 Å²	105	53%	0.533	50%	0.5	S	S	.	.	H	α-helix	trans	-63.9	-47.7	175.2	174.2	-98.9	0	0	0	112.1	F86 L87 R88 Y92 L93 K94	F86-Y90 VanDerWaalsContact O-CB 3.24Å; F86-Y90 WeakPolarHBondContact O-CB 3.03Å; F86-Y90 PolarHBondContact O-N 3.01Å; L87-Y90 PolarHBondContact O-N 3.41Å; R88-Y90 VanDerWaalsContact C-N 3.34Å; Y90-Y92 VanDerWaalsContact C-N 3.33Å; Y90-Y92 PolarHBondContact O-N 3.21Å; Y90-L93 PolarHBondContact O-N 3.39Å; Y90-K94 HydrophobicContact CE1-CD 4.44Å; Y90-K94 WeakPolarHBondContact O-CB 3.29Å; Y90-K94 PolarHBondContact O-N 3.39Å
91	E	89.2	Confident	83.6	Confident	127 Å²	127	108 Å²	108	59%	0.593	51%	0.505	S	S	*	.	H	α-helix	trans	-62.2	-41.4	176.7	-75.3	-177.7	171.5	0	0	111.8	L87 R88 K94 H95	L87-E91 WeakPolarHBondContact O-CG 3.3Å; L87-E91 PolarHBondContact O-N 3.49Å; R88-E91 PolarHBondContact O-N 3.21Å; E91-K94 PolarHBondContact O-N 3.39Å; E91-H95 WeakPolarHBondContact O-CB 2.93Å; E91-H95 PolarHBondContact O-N 3.25Å
92	Y	90.2	Very high	85	Confident	152 Å²	152	111.7 Å²	111.7	60%	0.596	51%	0.512	S	S	*	.	H	α-helix	trans	-59.4	-49.9	175.2	-179.7	-95.1	0	0	0	111.7	R88 D89 Y90 H95 H96	R88-Y92 WeakPolarHBondContact O-CB 2.97Å; R88-Y92 PolarHBondContact O-N 3.42Å; D89-Y92 PolarHBondContact O-N 3.48Å; Y90-Y92 VanDerWaalsContact C-N 3.33Å; Y90-Y92 PolarHBondContact O-N 3.21Å; Y92-H95 PolarHBondContact O-N 3.4Å; Y92-H96 WeakPolarHBondContact O-CB 3.23Å; Y92-H96 PolarHBondContact O-N 2.83Å
93	L	92.3	Very high	86.2	Confident	105 Å²	105	118.8 Å²	118.8	55%	0.55	54%	0.538	S	S	.	.	H	α-helix	trans	-62.5	-43.9	178.3	-79.2	165.5	0	0	0	111.9	D89 Y90 H95 H96 L97	D89-L93 WeakPolarHBondContact O-CB 3.27Å; D89-L93 WeakPolarHBondContact O-CG 3.43Å; D89-L93 PolarHBondContact O-N 3.32Å; Y90-L93 PolarHBondContact O-N 3.39Å; L93-H95 PolarHBondContact O-N 2.94Å; L93-H96 PolarHBondContact O-N 3.21Å; L93-L97 WeakPolarHBondContact O-CB 3.25Å; L93-L97 VanDerWaalsContact O-CG 3.31Å; L93-L97 WeakPolarHBondContact O-CG 3.42Å; L93-L97 PolarHBondContact O-N 3.38Å
94	K	92.4	Very high	87	Confident	114 Å²	114	118 Å²	118	50%	0.496	53%	0.534	S	S	.	.	H	α-helix	trans	-58.2	-48	177.6	-178.4	-179.4	177.1	-177.1	0	111.4	Y90 E91 H96 L97 L98	Y90-K94 HydrophobicContact CE1-CD 4.44Å; Y90-K94 WeakPolarHBondContact O-CB 3.29Å; Y90-K94 PolarHBondContact O-N 3.39Å; E91-K94 PolarHBondContact O-N 3.39Å; K94-H96 VanDerWaalsContact C-N 3.33Å; K94-H96 PolarHBondContact O-N 3.12Å; K94-L97 PolarHBondContact O-N 3.25Å; K94-L98 HydrophobicContact CG-CD1 4.32Å; K94-L98 WeakPolarHBondContact O-CG 3.44Å; K94-L98 PolarHBondContact O-N 3.08Å
95	H	91	Very high	87.2	Confident	106 Å²	106	118.2 Å²	118.2	49%	0.491	54%	0.535	S	S	.	.	H	α-helix	trans	-66.2	-36.5	178.7	-178.3	-105.4	0	0	0	112.2	E91 Y92 L93 K99	E91-H95 WeakPolarHBondContact O-CB 2.93Å; E91-H95 PolarHBondContact O-N 3.25Å; Y92-H95 PolarHBondContact O-N 3.4Å; L93-H95 PolarHBondContact O-N 2.94Å; H95-K99 WeakPolarHBondContact CE1-CE 3.47Å; H95-K99 PolarHBondContact CE1-NZ 2.71Å; H95-K99 WeakPolarHBondContact O-CB 3.45Å; H95-K99 WeakPolarHBondContact O-CG 3.42Å; H95-K99 PolarHBondContact O-N 2.91Å
96	H	91.8	Very high	86.5	Confident	83 Å²	83	125.6 Å²	125.6	38%	0.384	57%	0.566	S	S	.	*	H	α-helix	trans	-68.6	-39.5	177.1	-154.5	-66.4	0	0	0	112.5	Y92 L93 K94 K99 Q100	Y92-H96 WeakPolarHBondContact O-CB 3.23Å; Y92-H96 PolarHBondContact O-N 2.83Å; L93-H96 PolarHBondContact O-N 3.21Å; K94-H96 VanDerWaalsContact C-N 3.33Å; K94-H96 PolarHBondContact O-N 3.12Å; H96-K99 PolarHBondContact O-N 3.13Å; H96-Q100 WeakPolarHBondContact O-CG 3.39Å; H96-Q100 PolarHBondContact O-N 2.9Å
97	L	91.9	Very high	86.9	Confident	106 Å²	106	124.3 Å²	124.3	56%	0.555	56%	0.561	S	S	*	*	H	α-helix	trans	-66.4	-43.6	175.7	-74	168.7	0	0	0	111.6	L93 K94 K99 Q100 W101	L93-L97 WeakPolarHBondContact O-CB 3.25Å; L93-L97 VanDerWaalsContact O-CG 3.31Å; L93-L97 WeakPolarHBondContact O-CG 3.42Å; L93-L97 PolarHBondContact O-N 3.38Å; K94-L97 PolarHBondContact O-N 3.25Å; L97-K99 VanDerWaalsContact C-N 3.32Å; L97-K99 PolarHBondContact O-N 2.99Å; L97-Q100 PolarHBondContact O-N 3.37Å; L97-Q100 VanDerWaalsContact O-N 3.16Å; L97-W101 WeakPolarHBondContact O-CB 3.18Å; L97-W101 PolarHBondContact O-N 2.84Å
98	L	91.2	Very high	87.2	Confident	89 Å²	89	125.5 Å²	125.5	47%	0.466	56%	0.563	S	S	.	*	H	α-helix	trans	-58.3	-44.7	173.9	-75.3	169.6	0	0	0	111.4	K94 Q100 W101 E102	K94-L98 HydrophobicContact CG-CD1 4.32Å; K94-L98 WeakPolarHBondContact O-CG 3.44Å; K94-L98 PolarHBondContact O-N 3.08Å; L98-Q100 VanDerWaalsContact C-N 3.34Å; L98-Q100 PolarHBondContact O-N 2.89Å; L98-W101 PolarHBondContact O-N 3.16Å; L98-E102 WeakPolarHBondContact O-CG 3.45Å; L98-E102 PolarHBondContact O-N 3.17Å
99	K	90.6	Very high	87.4	Confident	107 Å²	107	125.2 Å²	125.2	47%	0.465	57%	0.567	S	S	.	*	H	α-helix	trans	-63.8	-34.7	175.3	-82.9	-175.6	170.6	-176.9	0	114	H95 H96 L97 K103	H95-K99 WeakPolarHBondContact CE1-CE 3.47Å; H95-K99 PolarHBondContact CE1-NZ 2.71Å; H95-K99 WeakPolarHBondContact O-CB 3.45Å; H95-K99 WeakPolarHBondContact O-CG 3.42Å; H95-K99 PolarHBondContact O-N 2.91Å; H96-K99 PolarHBondContact O-N 3.13Å; L97-K99 VanDerWaalsContact C-N 3.32Å; L97-K99 PolarHBondContact O-N 2.99Å; K99-K103 WeakPolarHBondContact O-CG 3.41Å; K99-K103 PolarHBondContact O-N 3.39Å
100	Q	89.4	Confident	87.4	Confident	93 Å²	93	127.4 Å²	127.4	44%	0.435	57%	0.573	S	S	.	*	H	α-helix	trans	-69.1	-42.1	174.5	-78.6	-177.5	-60.5	0	0	110.6	H96 L97 L98 K103 E104	H96-Q100 WeakPolarHBondContact O-CG 3.39Å; H96-Q100 PolarHBondContact O-N 2.9Å; L97-Q100 PolarHBondContact O-N 3.37Å; L97-Q100 VanDerWaalsContact O-N 3.16Å; L98-Q100 VanDerWaalsContact C-N 3.34Å; L98-Q100 PolarHBondContact O-N 2.89Å; Q100-K103 WeakPolarHBondContact O-CB 3.44Å; Q100-K103 PolarHBondContact O-N 2.78Å; Q100-K103 VanDerWaalsContact O-N 3.12Å; Q100-E104 WeakPolarHBondContact O-CG 3.13Å; Q100-E104 PolarHBondContact O-N 2.8Å
101	W	89.5	Confident	87.4	Confident	147 Å²	147	126.9 Å²	126.9	56%	0.557	58%	0.575	S	S	*	*	H	α-helix	trans	-64	-44.9	178.6	-155.1	63.4	0	0	0	112.1	L97 L98 K103 E104 E105	L97-W101 WeakPolarHBondContact O-CB 3.18Å; L97-W101 PolarHBondContact O-N 2.84Å; L98-W101 PolarHBondContact O-N 3.16Å; W101-K103 PolarHBondContact O-N 2.8Å; W101-E104 PolarHBondContact O-N 2.86Å; W101-E105 HydrophobicContact CD2-CG 4.43Å; W101-E105 WeakPolarHBondContact CH2-OE1 3.42Å; W101-E105 VanDerWaalsContact CZ2-OE1 3.25Å; W101-E105 WeakPolarHBondContact CZ2-OE1 3.43Å; W101-E105 WeakPolarHBondContact CZ3-OE2 3.49Å; W101-E105 PolarHBondContact O-N 2.94Å
102	E	88.9	Confident	87.2	Confident	117 Å²	117	126.9 Å²	126.9	55%	0.547	57%	0.574	S	S	.	*	H	α-helix	trans	-60.8	-26.1	172.8	-74.9	178.7	179.2	0	0	113.9	L98	L98-E102 WeakPolarHBondContact O-CG 3.45Å; L98-E102 PolarHBondContact O-N 3.17Å
103	K	88.3	Confident	87	Confident	166 Å²	166	125.1 Å²	125.1	72%	0.722	57%	0.572	S	S	*	*	H	α-helix	trans	-82	-28.7	174.5	-80.7	-178.8	178.8	-174.2	0	112.7	K99 Q100 W101	K99-K103 WeakPolarHBondContact O-CG 3.41Å; K99-K103 PolarHBondContact O-N 3.39Å; Q100-K103 WeakPolarHBondContact O-CB 3.44Å; Q100-K103 PolarHBondContact O-N 2.78Å; Q100-K103 VanDerWaalsContact O-N 3.12Å; W101-K103 PolarHBondContact O-N 2.8Å
104	E	84.6	Confident	86.6	Confident	154 Å²	154	126.6 Å²	126.6	72%	0.72	57%	0.574	S	S	*	*	H	α-helix	trans	-83	-27.5	177.4	-72.8	179.4	177.7	0	0	112	Q100 W101 K106	Q100-E104 WeakPolarHBondContact O-CG 3.13Å; Q100-E104 PolarHBondContact O-N 2.8Å; W101-E104 PolarHBondContact O-N 2.86Å; E104-K106 VanDerWaalsContact C-N 3.32Å
105	E	76.6	Confident	86.1	Confident	128 Å²	128	127.7 Å²	127.7	60%	0.598	58%	0.58	S	S	*	*			trans	-80.4	-5	174	-72.6	-163.2	142.9	0	0	114.4	W101	W101-E105 HydrophobicContact CD2-CG 4.43Å; W101-E105 WeakPolarHBondContact CH2-OE1 3.42Å; W101-E105 VanDerWaalsContact CZ2-OE1 3.25Å; W101-E105 WeakPolarHBondContact CZ2-OE1 3.43Å; W101-E105 WeakPolarHBondContact CZ3-OE2 3.49Å; W101-E105 PolarHBondContact O-N 2.94Å
106	K	59.9	Low	85.7	Confident	236 Å²	236	129.6 Å²	129.6	100%	1.026	59%	0.589	S	S	*	*			trans	-108.6	0	175.5	-78.3	-177.6	179.6	175.1	0	111.8	E104	E104-K106 VanDerWaalsContact C-N 3.32Å

Retrieved 106 of 106 residues in 106.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).