A0A077YYI3_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YYI3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 31 aa.

						>A0A077YYI3_TRITR|A0A077YYI3
MHRTLAVAPESHSSSWEQKRDRLAAALRKTL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.9	Low	67.4	Low	246 Å²	246	146.6 Å²	146.6	100%	1.212	81%	0.812	S	S	*	*				0	110.8	0	-66.3	-148.6	-178	0	0	108.5	R3	M1-R3 PolarHBondContact O-N 2.87Å
2	H	56.5	Low	67	Low	192 Å²	192	145 Å²	145	89%	0.889	79%	0.794	S	S	*	*			trans	-87.3	99.8	-176.7	-135.2	-113.7	0	0	0	108.6	T4	H2-T4 PolarHBondContact O-N 3.45Å
3	R	65.4	Low	66.6	Low	219 Å²	219	138.5 Å²	138.5	83%	0.826	77%	0.765	S	S	*	*			trans	-87.4	99.6	176.3	-170	175.9	-148.2	169.2	6.3	108.2	M1 L5	M1-R3 PolarHBondContact O-N 2.87Å; R3-L5 PolarHBondContact O-N 2.9Å
4	T	74.1	Confident	66.8	Low	123 Å²	123	135.8 Å²	135.8	76%	0.755	76%	0.761	S	S	*	*			trans	-66	102.8	167.8	-50.2	0	0	0	0	107.6	H2 A6	H2-T4 PolarHBondContact O-N 3.45Å; T4-A6 PolarHBondContact O-N 3.42Å
5	L	71.3	Confident	67.6	Low	136 Å²	136	130.3 Å²	130.3	71%	0.712	74%	0.735	S	S	*	*			trans	-68.3	101	168.1	-66.2	171.2	0	0	0	106.2	R3 V7	R3-L5 PolarHBondContact O-N 2.9Å; L5-V7 PolarHBondContact O-N 2.95Å
6	A	72	Confident	68.6	Low	96 Å²	96	132.9 Å²	132.9	79%	0.793	73%	0.73	S	S	*	*			trans	-65	92.4	164.7	0	0	0	0	0	106.5	T4 A8	T4-A6 PolarHBondContact O-N 3.42Å; A6-A8 PolarHBondContact O-N 3.41Å
7	V	70.7	Confident	69.6	Low	122 Å²	122	130.5 Å²	130.5	74%	0.739	71%	0.712	S	S	*	*			trans	-58.5	111.3	168.1	177.8	0	0	0	0	105.2	L5	L5-V7 PolarHBondContact O-N 2.95Å
8	A	69.9	Low	70.5	Confident	76 Å²	76	129.2 Å²	129.2	63%	0.628	70%	0.7	S	S	*	*			trans	-54.1	130.9	174.3	0	0	0	0	0	107.3	A6 E10	A6-A8 PolarHBondContact O-N 3.41Å; A8-E10 PolarHBondContact O-N 2.96Å
9	P	69.9	Low	71.5	Confident	116 Å²	116	128.3 Å²	128.3	75%	0.753	69%	0.689	S	S	*	*			trans	-61.7	106.6	176.6	24.1	-30.9	0	0	0	107.5	S11	P9-S11 PolarHBondContact O-N 3.39Å
10	E	68.1	Low	72.5	Confident	163 Å²	163	129.3 Å²	129.3	76%	0.762	68%	0.683	S	S	*	*			trans	-49	132.7	170.4	-58.9	-123.1	89.4	0	0	107.2	A8 H12	A8-E10 PolarHBondContact O-N 2.96Å; E10-H12 PolarHBondContact O-CD2 3.46Å; E10-H12 PolarHBondContact O-N 3.49Å
11	S	64.3	Low	73.3	Confident	124 Å²	124	127 Å²	127	87%	0.867	67%	0.671	S	S	*	*	S	Bend	trans	-47.7	58.2	-162.3	-55.7	0	0	0	0	118.2	P9 S13	P9-S11 PolarHBondContact O-N 3.39Å; S11-S13 VanDerWaalsContact C-N 3.33Å
12	H	63.1	Low	74.9	Confident	127 Å²	127	123.1 Å²	123.1	59%	0.588	64%	0.643	S	S	*	*			trans	-93.3	8.7	172.3	-80.4	-112.1	0	0	0	111.9	E10 S14 S15 W16	E10-H12 PolarHBondContact O-CD2 3.46Å; E10-H12 PolarHBondContact O-N 3.49Å; H12-S14 PolarHBondContact O-N 2.91Å; H12-S15 PolarHBondContact O-N 3.29Å; H12-S15 VanDerWaalsContact O-N 3.11Å; H12-W16 PolarHBondContact O-N 3.25Å
13	S	61.7	Low	76.7	Confident	61 Å²	61	119.1 Å²	119.1	43%	0.427	63%	0.627	S	S	.	*	H	α-helix	trans	-53	-39.6	-177.4	-61.4	0	0	0	0	112	S11 S15 W16 E17	S11-S13 VanDerWaalsContact C-N 3.33Å; S13-S15 VanDerWaalsContact C-N 3.32Å; S13-S15 PolarHBondContact O-N 3.17Å; S13-W16 PolarHBondContact O-N 3.01Å; S13-E17 PolarHBondContact O-N 3.07Å; S13-E17 WeakPolarHBondContact O-CG 3.45Å; S13-E17 WeakPolarHBondContact CB-OE2 3.38Å; S13-E17 VanDerWaalsContact CB-OE2 3.27Å; S13-E17 VanDerWaalsContact C-OE2 3.24Å; S13-E17 WeakPolarHBondContact O-CB 3.31Å
14	S	69.3	Low	78.1	Confident	100 Å²	100	110.1 Å²	110.1	70%	0.699	60%	0.6	S	S	*	*	H	α-helix	trans	-59.5	-38.8	-179.2	-169	0	0	0	0	113.8	H12 Q18	H12-S14 PolarHBondContact O-N 2.91Å; S14-Q18 WeakPolarHBondContact O-CB 3.43Å; S14-Q18 PolarHBondContact O-N 3.33Å
15	S	79.5	Confident	79	Confident	54 Å²	54	106.9 Å²	106.9	38%	0.378	59%	0.586	S	S	.	*	H	α-helix	trans	-78.3	-41.6	179.8	-168.4	0	0	0	0	112.3	H12 S13 K19	H12-S15 PolarHBondContact O-N 3.29Å; H12-S15 VanDerWaalsContact O-N 3.11Å; S13-S15 VanDerWaalsContact C-N 3.32Å; S13-S15 PolarHBondContact O-N 3.17Å; S15-K19 VanDerWaalsContact O-CG 3.31Å; S15-K19 WeakPolarHBondContact O-CG 3.44Å; S15-K19 PolarHBondContact O-N 3.23Å
16	W	82.9	Confident	80	Confident	172 Å²	172	103 Å²	103	65%	0.652	57%	0.573	S	S	*	*	H	α-helix	trans	-72	-39.2	-179.4	-80	109.6	0	0	0	112.6	H12 S13 K19 R20	H12-W16 PolarHBondContact O-N 3.25Å; S13-W16 PolarHBondContact O-N 3.01Å; W16-K19 PolarHBondContact O-N 3.04Å; W16-K19 HydrophobicContact CE3-CD 4.49Å; W16-R20 VanDerWaalsContact O-CB 3.26Å; W16-R20 WeakPolarHBondContact O-CB 3.36Å; W16-R20 PolarHBondContact O-N 3.19Å
17	E	85.2	Confident	81.1	Confident	92 Å²	92	103 Å²	103	43%	0.43	56%	0.559	S	S	.	*	H	α-helix	trans	-62.2	-46.5	174.5	-69.9	177.3	107.9	0	0	110.4	S13 K19 R20 D21	S13-E17 PolarHBondContact O-N 3.07Å; S13-E17 WeakPolarHBondContact O-CG 3.45Å; S13-E17 WeakPolarHBondContact CB-OE2 3.38Å; S13-E17 VanDerWaalsContact CB-OE2 3.27Å; S13-E17 VanDerWaalsContact C-OE2 3.24Å; S13-E17 WeakPolarHBondContact O-CB 3.31Å; E17-K19 VanDerWaalsContact C-N 3.34Å; E17-K19 PolarHBondContact O-N 3.31Å; E17-R20 WeakPolarHBondContact O-CB 3.35Å; E17-R20 PolarHBondContact O-N 2.81Å; E17-D21 WeakPolarHBondContact O-CB 3.31Å; E17-D21 PolarHBondContact O-N 3.24Å
18	Q	86.3	Confident	82.1	Confident	106 Å²	106	106.3 Å²	106.3	50%	0.495	56%	0.559	S	S	.	*	H	α-helix	trans	-60.8	-41.8	176	-174.1	178.4	91	0	0	112.3	S14 R22	S14-Q18 WeakPolarHBondContact O-CB 3.43Å; S14-Q18 PolarHBondContact O-N 3.33Å; Q18-R22 WeakPolarHBondContact O-CB 3.39Å; Q18-R22 PolarHBondContact O-N 2.82Å; Q18-R22 WeakPolarHBondContact O-CG 3.36Å; Q18-R22 VanDerWaalsContact O-CG 3.31Å
19	K	89.1	Confident	82.9	Confident	113 Å²	113	111.7 Å²	111.7	49%	0.491	57%	0.568	S	S	.	*	H	α-helix	trans	-64.4	-42.7	175.4	-75.2	175	-176.6	178.2	0	111.7	S15 W16 E17 R22 L23	S15-K19 VanDerWaalsContact O-CG 3.31Å; S15-K19 WeakPolarHBondContact O-CG 3.44Å; S15-K19 PolarHBondContact O-N 3.23Å; W16-K19 PolarHBondContact O-N 3.04Å; W16-K19 HydrophobicContact CE3-CD 4.49Å; E17-K19 VanDerWaalsContact C-N 3.34Å; E17-K19 PolarHBondContact O-N 3.31Å; K19-R22 PolarHBondContact O-N 2.82Å; K19-L23 WeakPolarHBondContact O-CB 3.37Å; K19-L23 PolarHBondContact O-N 2.9Å
20	R	90.9	Very high	83.7	Confident	147 Å²	147	111.8 Å²	111.8	56%	0.555	57%	0.566	S	S	*	*	H	α-helix	trans	-61.4	-46.4	176.8	-176.7	-161.5	67.9	-170.1	-5.4	110.8	W16 E17 L23 A24	W16-R20 VanDerWaalsContact O-CB 3.26Å; W16-R20 WeakPolarHBondContact O-CB 3.36Å; W16-R20 PolarHBondContact O-N 3.19Å; E17-R20 WeakPolarHBondContact O-CB 3.35Å; E17-R20 PolarHBondContact O-N 2.81Å; R20-L23 PolarHBondContact O-N 3.29Å; R20-A24 WeakPolarHBondContact O-CB 3.46Å; R20-A24 PolarHBondContact O-N 3.25Å
21	D	91.1	Very high	83.9	Confident	82 Å²	82	113.7 Å²	113.7	44%	0.439	58%	0.581	S	S	.	*	H	α-helix	trans	-65.6	-40.7	178.6	-88.9	-81.9	0	0	0	111.9	E17 L23 A24 A25	E17-D21 WeakPolarHBondContact O-CB 3.31Å; E17-D21 PolarHBondContact O-N 3.24Å; D21-L23 PolarHBondContact O-N 3.38Å; D21-A24 PolarHBondContact O-N 3.32Å; D21-A25 WeakPolarHBondContact O-CB 3.15Å; D21-A25 PolarHBondContact O-N 3.21Å
22	R	92	Very high	84.9	Confident	164 Å²	164	113.2 Å²	113.2	62%	0.619	57%	0.566	S	S	*	*	H	α-helix	trans	-61.2	-42.9	171.7	-74.8	179.7	-175	-179.9	5.4	112.3	Q18 K19 A25 A26	Q18-R22 WeakPolarHBondContact O-CB 3.39Å; Q18-R22 PolarHBondContact O-N 2.82Å; Q18-R22 WeakPolarHBondContact O-CG 3.36Å; Q18-R22 VanDerWaalsContact O-CG 3.31Å; K19-R22 PolarHBondContact O-N 2.82Å; R22-A25 PolarHBondContact O-N 3.11Å; R22-A26 WeakPolarHBondContact O-CB 3.26Å; R22-A26 PolarHBondContact O-N 3.27Å
23	L	93.8	Very high	86	Confident	108 Å²	108	112.5 Å²	112.5	57%	0.565	57%	0.565	S	S	*	*	H	α-helix	trans	-64.9	-45.8	177	-179.6	63.7	0	0	0	111.3	K19 R20 D21 A25 A26 L27	K19-L23 WeakPolarHBondContact O-CB 3.37Å; K19-L23 PolarHBondContact O-N 2.9Å; R20-L23 PolarHBondContact O-N 3.29Å; D21-L23 PolarHBondContact O-N 3.38Å; L23-A25 VanDerWaalsContact C-N 3.31Å; L23-A25 PolarHBondContact O-N 3.18Å; L23-A26 PolarHBondContact O-N 3.39Å; L23-A26 VanDerWaalsContact O-N 3.17Å; L23-L27 HydrophobicContact CD1-CD1 4.48Å; L23-L27 HydrophobicContact CD1-CG 4.44Å; L23-L27 HydrophobicContact CG-CD1 4.2Å; L23-L27 WeakPolarHBondContact O-CG 3.27Å; L23-L27 PolarHBondContact O-N 2.86Å
24	A	93.9	Very high	87.3	Confident	31 Å²	31	115.3 Å²	115.3	26%	0.256	57%	0.573	S	S	.	*	H	α-helix	trans	-61	-40.2	177.2	0	0	0	0	0	111.7	R20 D21 R28	R20-A24 WeakPolarHBondContact O-CB 3.46Å; R20-A24 PolarHBondContact O-N 3.25Å; D21-A24 PolarHBondContact O-N 3.32Å; A24-R28 PolarHBondContact O-N 2.86Å; A24-R28 WeakPolarHBondContact O-CG 3.12Å
25	A	93.6	Very high	88.4	Confident	55 Å²	55	116.2 Å²	116.2	46%	0.455	57%	0.566	S	S	.	*	H	α-helix	trans	-64.7	-41.5	173.8	0	0	0	0	0	112.3	D21 R22 L23 R28 K29	D21-A25 WeakPolarHBondContact O-CB 3.15Å; D21-A25 PolarHBondContact O-N 3.21Å; R22-A25 PolarHBondContact O-N 3.11Å; L23-A25 VanDerWaalsContact C-N 3.31Å; L23-A25 PolarHBondContact O-N 3.18Å; A25-R28 PolarHBondContact O-N 3.03Å; A25-K29 PolarHBondContact O-N 2.8Å
26	A	93.2	Very high	89	Confident	53 Å²	53	120.1 Å²	120.1	44%	0.438	58%	0.577	S	S	.	*	H	α-helix	trans	-64.1	-41.6	176.9	0	0	0	0	0	112.3	R22 L23 K29 T30	R22-A26 WeakPolarHBondContact O-CB 3.26Å; R22-A26 PolarHBondContact O-N 3.27Å; L23-A26 PolarHBondContact O-N 3.39Å; L23-A26 VanDerWaalsContact O-N 3.17Å; A26-K29 PolarHBondContact O-N 2.6Å; A26-T30 PolarHBondContact O-N 3.33Å; A26-T30 PolarHBondContact O-OG1 3.4Å
27	L	94.5	Very high	89.4	Confident	98 Å²	98	116.7 Å²	116.7	51%	0.513	57%	0.572	S	S	.	*	H	α-helix	trans	-64.9	-43.9	177.1	-71.2	172.1	0	0	0	111.8	L23 K29 T30 L31	L23-L27 HydrophobicContact CD1-CD1 4.48Å; L23-L27 HydrophobicContact CD1-CG 4.44Å; L23-L27 HydrophobicContact CG-CD1 4.2Å; L23-L27 WeakPolarHBondContact O-CG 3.27Å; L23-L27 PolarHBondContact O-N 2.86Å; L27-K29 PolarHBondContact O-N 3.01Å; L27-T30 PolarHBondContact O-N 3.04Å; L27-L31 PolarHBondContact O-N 3.41Å
28	R	91.7	Very high	89.7	Confident	191 Å²	191	118.4 Å²	118.4	72%	0.721	58%	0.583	S	S	*	*	H	α-helix	trans	-62.1	-24.9	175.9	-74.9	178	-174.7	134.7	-0.2	114.1	A24 A25	A24-R28 PolarHBondContact O-N 2.86Å; A24-R28 WeakPolarHBondContact O-CG 3.12Å; A25-R28 PolarHBondContact O-N 3.03Å
29	K	87.2	Confident	89.9	Confident	188 Å²	188	119.4 Å²	119.4	82%	0.817	59%	0.589	S	S	*	*	H	α-helix	trans	-80.8	-21	175.1	-172.3	177.9	177.3	-175.7	0	112.5	A25 A26 L27	A25-K29 PolarHBondContact O-N 2.8Å; A26-K29 PolarHBondContact O-N 2.6Å; L27-K29 PolarHBondContact O-N 3.01Å
30	T	86	Confident	90	Very high	119 Å²	119	119.9 Å²	119.9	73%	0.73	60%	0.598	S	S	*	*	H	α-helix	trans	-94	-24.1	-172.8	-52.5	0	0	0	0	112.7	A26 L27	A26-T30 PolarHBondContact O-N 3.33Å; A26-T30 PolarHBondContact O-OG1 3.4Å; L27-T30 PolarHBondContact O-N 3.04Å
31	L	72.1	Confident	89.9	Confident	203 Å²	203	117.5 Å²	117.5	100%	1.063	60%	0.601	S	S	*	*			trans	-96.7	0	175.3	-63.5	174.5	0	0	0	111.1	L27	L27-L31 PolarHBondContact O-N 3.41Å

Retrieved 31 of 31 residues in 20 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).