A0A077YYQ6_TRITR Loading...

Putative Zn(II)2Cys6 transcription factor (Eurofu ng)

AlphaFold DB , UniProt , Accession A0A077YYQ6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 109 aa.

						>A0A077YYQ6_TRITR|A0A077YYQ6
MPTKSGRKCLVHQRDGPPTKGVASGCNMGKSGFYIKQCSCRRRTSLFQPDSSAEDSSTGDPDDRATPAYRNNRRHSRLETYGRLIVCQDGPGTSATSPSLIGPKCIVWT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	30.1	Very low	41.9	Very low	227 Å²	227	102 Å²	102	100%	1.118	55%	0.553	S	S	*	*				0	120.8	0	-61.6	-164.5	175.1	0	0	108.7	T3	M1-T3 PolarHBondContact O-N 2.94Å
2	P	32.6	Very low	42.5	Very low	129 Å²	129	99.4 Å²	99.4	84%	0.838	53%	0.534	S	S	*	.			trans	-75.4	106.4	176.1	29.1	-29.3	0	0	0	109.1	K4	P2-K4 PolarHBondContact O-N 2.67Å
3	T	31.5	Very low	42.6	Very low	127 Å²	127	98.5 Å²	98.5	78%	0.779	52%	0.524	S	S	*	.			trans	-61.8	117.3	171.9	44.2	0	0	0	0	109.2	M1 S5	M1-T3 PolarHBondContact O-N 2.94Å; T3-S5 PolarHBondContact O-N 3.37Å
4	K	38.8	Very low	42.4	Very low	213 Å²	213	105.6 Å²	105.6	93%	0.926	54%	0.54	S	S	*	.			trans	-61.8	75.5	166.7	-80.9	178.2	175.3	174.2	0	109.6	P2 G6	P2-K4 PolarHBondContact O-N 2.67Å; K4-G6 PolarHBondContact O-N 2.98Å
5	S	38.1	Very low	42.5	Very low	86 Å²	86	108.8 Å²	108.8	60%	0.601	56%	0.559	S	S	*	*			trans	-79.1	105.9	166.6	-173	0	0	0	0	106.9	T3 R7	T3-S5 PolarHBondContact O-N 3.37Å; S5-R7 VanDerWaalsContact C-N 3.33Å; S5-R7 PolarHBondContact O-N 3.48Å
6	G	44.4	Very low	42.7	Very low	58 Å²	58	103.4 Å²	103.4	60%	0.598	54%	0.539	S	S	*	.			trans	-64.5	91.8	175.6	0	0	0	0	0	110	K4	K4-G6 PolarHBondContact O-N 2.98Å
7	R	48.6	Very low	42.9	Very low	99 Å²	99	103.8 Å²	103.8	37%	0.374	55%	0.549	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.5	128.3	-179.3	-70.5	179.5	-178.8	-177.6	-2	109.3	S5 A23 M28	S5-R7 VanDerWaalsContact C-N 3.33Å; S5-R7 PolarHBondContact O-N 3.48Å; R7-A23 WeakPolarHBondContact O-CB 2.91Å; R7-A23 PolarHBondContact O-N 2.95Å; R7-M28 PolarHBondContact NH1-SD 3.08Å
8	K	50.9	Low	43.4	Very low	148 Å²	148	102 Å²	102	64%	0.643	54%	0.544	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.3	136.5	173.6	-63.4	173.7	-176.5	170.5	0	108.1
9	C	48.2	Very low	43.9	Very low	3 Å²	3	98.6 Å²	98.6	2%	0.02	53%	0.528	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.6	149	167.7	56.3	0	0	0	0	109.8	G21 A23 C40 C105	C9-G21 PolarHBondContact N-O 2.06Å; C9-G21 CarbonylContact O-C 3.58Å; C9-G21 WeakPolarHBondContact O-CA 3.42Å; C9-G21 PolarHBondContact O-N 2.79Å; C9-G21 VanDerWaalsContact O-O 3.06Å; C9-A23 HydrophobicContact CB-CB 3.97Å; C9-C40 WeakPolarHBondContact CB-SG 3.02Å; C9-C40 WeakPolarHBondContact SG-CB 3.4Å; C9-C40 CovalentContact SG-SG 2.04Å; C9-C40 PolarHBondContact SG-SG 3.11Å; C9-C105 HydrophobicContact CB-CB 4.22Å
10	L	48.7	Very low	44.2	Very low	16 Å²	16	100.6 Å²	100.6	8%	0.084	53%	0.531	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85	145.1	159.9	-81.4	137.9	0	0	0	108.4	P18 L100 K104	L10-P18 HydrophobicContact CD2-CB 3.76Å; L10-L100 HydrophobicContact CD1-CD1 3.96Å; L10-L100 HydrophobicContact CD1-CD2 3.74Å; L10-L100 HydrophobicContact CD1-CG 4.34Å; L10-L100 HydrophobicContact CD2-CD1 4.38Å; L10-L100 HydrophobicContact CG-CD2 4.12Å; L10-K104 HydrophobicContact CD1-CG 4.23Å
11	V	49.4	Very low	44.6	Very low	16 Å²	16	95.9 Å²	95.9	10%	0.097	51%	0.507	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	106.1	170.9	178.3	0	0	0	0	106.4	T19 C40 V107	V11-T19 PolarHBondContact N-O 3.33Å; V11-T19 PolarHBondContact O-N 2.66Å; V11-T19 PolarHBondContact O-OG1 3.41Å; V11-C40 HydrophobicContact CG2-CB 3.92Å; V11-V107 HydrophobicContact CG1-CG2 3.99Å
12	H	48.2	Very low	45.4	Very low	71 Å²	71	87.6 Å²	87.6	33%	0.329	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.7	131.2	169.2	-76	-94.1	0	0	0	109.2	I106	H12-I106 HydrophobicContact CB-CG2 4.39Å
13	Q	43.8	Very low	46.2	Very low	88 Å²	88	82 Å²	82	41%	0.411	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.4	143.8	165.2	-68.3	-170.6	-32.9	0	0	107.3	D15 G16	Q13-D15 PolarHBondContact O-N 2.85Å; Q13-D15 VanDerWaalsContact O-N 3.08Å; Q13-G16 PolarHBondContact O-N 2.64Å
14	R	40.6	Very low	47	Very low	198 Å²	198	79.6 Å²	79.6	75%	0.747	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.5	-36.1	-175.4	-172.9	175.6	173.6	171.8	-4.2	113.1
15	D	43.6	Very low	47.4	Very low	153 Å²	153	72.9 Å²	72.9	82%	0.818	41%	0.414	S	S	*	.	T	Hydrogen-bonded Turn	trans	-126.8	20.8	-174.6	-54.1	-76.9	0	0	0	112.6	Q13	Q13-D15 PolarHBondContact O-N 2.85Å; Q13-D15 VanDerWaalsContact O-N 3.08Å
16	G	45.2	Very low	47.7	Very low	23 Å²	23	70.8 Å²	70.8	24%	0.237	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.1	152	-172.2	0	0	0	0	0	113.9	Q13	Q13-G16 PolarHBondContact O-N 2.64Å
17	P	47.2	Very low	47.7	Very low	109 Å²	109	74.2 Å²	74.2	71%	0.708	40%	0.403	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-59.4	144.5	175.2	25.6	-33.3	0	0	0	110.2	T19	P17-T19 PolarHBondContact O-N 2.73Å
18	P	52	Low	47.5	Very low	72 Å²	72	73.9 Å²	73.9	47%	0.468	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.1	125.8	-179.6	24	-32.8	0	0	0	110.3	L10	L10-P18 HydrophobicContact CD2-CB 3.76Å
19	T	51.4	Low	47.1	Very low	38 Å²	38	68.2 Å²	68.2	23%	0.233	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102	138	-179.8	48.3	0	0	0	0	111	V11 P17 R42	V11-T19 PolarHBondContact N-O 3.33Å; V11-T19 PolarHBondContact O-N 2.66Å; V11-T19 PolarHBondContact O-OG1 3.41Å; P17-T19 PolarHBondContact O-N 2.73Å; T19-R42 PolarHBondContact OG1-NE 3Å; T19-R42 PolarHBondContact OG1-NH2 3Å; T19-R42 VanDerWaalsContact OG1-NH2 3.08Å
20	K	51.4	Low	47	Very low	137 Å²	137	78.6 Å²	78.6	60%	0.596	44%	0.435	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-75.1	127.8	176.9	-68	178.9	-178.7	172	0	110
21	G	52	Low	46.5	Very low	3 Å²	3	81.7 Å²	81.7	3%	0.031	46%	0.458	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.1	164.5	175.2	0	0	0	0	0	112.3	C9 R41	C9-G21 PolarHBondContact N-O 2.06Å; C9-G21 CarbonylContact O-C 3.58Å; C9-G21 WeakPolarHBondContact O-CA 3.42Å; C9-G21 PolarHBondContact O-N 2.79Å; C9-G21 VanDerWaalsContact O-O 3.06Å; G21-R41 CarbonylContact C-O 3.59Å; G21-R41 VanDerWaalsContact CA-O 3.3Å; G21-R41 WeakPolarHBondContact CA-O 3.03Å
22	V	46.4	Very low	46	Very low	53 Å²	53	82.7 Å²	82.7	32%	0.321	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.4	122.5	168.2	-177.3	0	0	0	0	107.4	R41	V22-R41 PolarHBondContact N-O 3.37Å; V22-R41 PolarHBondContact O-N 2.97Å
23	A	49.8	Very low	45.4	Very low	10 Å²	10	86.7 Å²	86.7	8%	0.083	49%	0.489	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.3	125.1	174.3	0	0	0	0	0	109.3	R7 C9	R7-A23 WeakPolarHBondContact O-CB 2.91Å; R7-A23 PolarHBondContact O-N 2.95Å; C9-A23 HydrophobicContact CB-CB 3.97Å
24	S	48.7	Very low	45.4	Very low	78 Å²	78	85.7 Å²	85.7	55%	0.545	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.2	141.7	171.2	-76.2	0	0	0	0	109.7	S39	S24-S39 PolarHBondContact N-O 3.34Å; S24-S39 PolarHBondContact O-N 2.04Å
25	G	46.6	Very low	45.2	Very low	72 Å²	72	82.4 Å²	82.4	74%	0.742	48%	0.478	S	S	*	.	S	Bend	trans	87.2	11.1	177.3	0	0	0	0	0	115.8	N27	G25-N27 PolarHBondContact O-N 3.49Å
26	C	45.8	Very low	45.4	Very low	42 Å²	42	79.2 Å²	79.2	28%	0.284	46%	0.456	S	S	.	.			trans	-82	94.6	179.2	-54.9	0	0	0	0	111.3	C38	C26-C38 PolarHBondContact SG-SG 2.93Å
27	N	43.6	Very low	45.3	Very low	129 Å²	129	87.1 Å²	87.1	69%	0.69	49%	0.487	S	S	*	.			trans	-84.3	107.8	163.5	-88.7	-28.7	0	0	0	109.4	G25 G29 K36	G25-N27 PolarHBondContact O-N 3.49Å; N27-G29 PolarHBondContact O-N 2.89Å; N27-K36 VanDerWaalsContact O-CD 3.31Å; N27-K36 WeakPolarHBondContact O-CD 3.17Å; N27-K36 PolarHBondContact O-NZ 3.25Å
28	M	44.8	Very low	45.2	Very low	92 Å²	92	82.3 Å²	82.3	45%	0.453	46%	0.456	S	S	.	.			trans	-58.9	132.4	167.7	-89.4	171.6	140.7	0	0	109.9	R7 D89	R7-M28 PolarHBondContact NH1-SD 3.08Å; M28-D89 WeakPolarHBondContact CE-OD1 3.3Å; M28-D89 WeakPolarHBondContact CE-OD2 3.31Å
29	G	42.7	Very low	45.1	Very low	29 Å²	29	81.8 Å²	81.8	30%	0.299	45%	0.454	S	S	.	.			trans	-90.9	175.3	155.1	0	0	0	0	0	110.4	N27 S31 Y34	N27-G29 PolarHBondContact O-N 2.89Å; G29-S31 VanDerWaalsContact C-N 3.31Å; G29-S31 PolarHBondContact O-N 2.92Å; G29-Y34 VanDerWaalsContact CA-CE2 3.4Å; G29-Y34 WeakPolarHBondContact CA-OH 3.38Å; G29-Y34 WeakPolarHBondContact O-CE2 3.35Å; G29-Y34 PolarHBondContact O-OH 2.84Å
30	K	44.4	Very low	45	Very low	222 Å²	222	81.4 Å²	81.4	97%	0.965	45%	0.453	S	S	*	.	S	Bend	trans	-75.7	-2.5	-174.2	-78.3	-179.8	170.5	-177.4	0	116.4	Y34	K30-Y34 PolarHBondContact N-OH 2.95Å
31	S	39.5	Very low	44.7	Very low	80 Å²	80	84.4 Å²	84.4	56%	0.559	46%	0.46	S	S	*	.	S	Bend	trans	-126.7	56.8	-161.6	70.3	0	0	0	0	112.9	G29 F33 Y34	G29-S31 VanDerWaalsContact C-N 3.31Å; G29-S31 PolarHBondContact O-N 2.92Å; S31-F33 PolarHBondContact O-N 3.36Å; S31-Y34 WeakPolarHBondContact CA-OH 3.14Å; S31-Y34 WeakPolarHBondContact CB-OH 3.14Å; S31-Y34 PolarHBondContact N-OH 3.5Å; S31-Y34 PolarHBondContact OG-OH 3.25Å
32	G	39.1	Very low	44.6	Very low	38 Å²	38	89.2 Å²	89.2	39%	0.392	48%	0.478	S	S	.	.	S	Bend	trans	55.9	-12.6	154.6	0	0	0	0	0	121.4
33	F	34.9	Very low	44.5	Very low	155 Å²	155	96.5 Å²	96.5	68%	0.68	50%	0.499	S	S	*	.			trans	-154.3	123	-171.9	-63.9	-83.1	0	0	0	108.6	S31	S31-F33 PolarHBondContact O-N 3.36Å
34	Y	43	Very low	44.2	Very low	66 Å²	66	101.4 Å²	101.4	26%	0.259	53%	0.528	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.3	123.6	170.5	-62	-74.5	0	0	0	111.8	G29 K30 S31 K36	G29-Y34 VanDerWaalsContact CA-CE2 3.4Å; G29-Y34 WeakPolarHBondContact CA-OH 3.38Å; G29-Y34 WeakPolarHBondContact O-CE2 3.35Å; G29-Y34 PolarHBondContact O-OH 2.84Å; K30-Y34 PolarHBondContact N-OH 2.95Å; S31-Y34 WeakPolarHBondContact CA-OH 3.14Å; S31-Y34 WeakPolarHBondContact CB-OH 3.14Å; S31-Y34 PolarHBondContact N-OH 3.5Å; S31-Y34 PolarHBondContact OG-OH 3.25Å; Y34-K36 HydrophobicContact CG-CD 4.34Å; Y34-K36 PolarHBondContact O-N 2.88Å
35	I	38.3	Very low	43.8	Very low	130 Å²	130	101.7 Å²	101.7	67%	0.667	53%	0.531	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.4	95	152.6	-57.8	163.7	0	0	0	105.2	L84	I35-L84 HydrophobicContact CB-CD1 4.46Å; I35-L84 HydrophobicContact CD1-CD1 3.94Å; I35-L84 HydrophobicContact CG1-CD1 3.97Å; I35-L84 HydrophobicContact CG1-CG 4.46Å; I35-L84 HydrophobicContact CG2-CD1 3.64Å
36	K	46.6	Very low	43.4	Very low	85 Å²	85	105.6 Å²	105.6	37%	0.37	53%	0.534	S	S	.	.			trans	-123.8	141.7	174.2	-97.1	175.4	173.3	167.9	0	108.6	N27 Y34 C38	N27-K36 VanDerWaalsContact O-CD 3.31Å; N27-K36 WeakPolarHBondContact O-CD 3.17Å; N27-K36 PolarHBondContact O-NZ 3.25Å; Y34-K36 HydrophobicContact CG-CD 4.34Å; Y34-K36 PolarHBondContact O-N 2.88Å; K36-C38 PolarHBondContact O-N 3.21Å; K36-C38 PolarHBondContact O-SG 2.78Å
37	Q	44.1	Very low	43	Very low	189 Å²	189	112.2 Å²	112.2	88%	0.883	56%	0.558	S	S	*	*			trans	-58.9	85.4	171.9	-72.6	-174.8	-15.3	0	0	109.5
38	C	45.3	Very low	42.6	Very low	8 Å²	8	113 Å²	113	5%	0.054	56%	0.558	C	S	.	*			trans	-91.6	123.3	176.1	-63.3	0	0	0	0	107.2	C26 K36 C40 I85	C26-C38 PolarHBondContact SG-SG 2.93Å; K36-C38 PolarHBondContact O-N 3.21Å; K36-C38 PolarHBondContact O-SG 2.78Å; C38-C40 PolarHBondContact O-N 2.89Å; C38-I85 HydrophobicContact CB-CG2 4.27Å; C38-I85 WeakPolarHBondContact O-CD1 3.15Å
39	S	49.3	Very low	42.3	Very low	61 Å²	61	113.9 Å²	113.9	43%	0.427	57%	0.57	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-87.2	95.2	170.1	-69.5	0	0	0	0	108.1	S24 R41	S24-S39 PolarHBondContact N-O 3.34Å; S24-S39 PolarHBondContact O-N 2.04Å; S39-R41 PolarHBondContact O-N 3.08Å
40	C	48.1	Very low	42.1	Very low	31 Å²	31	118.8 Å²	118.8	21%	0.209	59%	0.589	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-84.1	105.5	166.1	-86.1	0	0	0	0	108.6	C9 V11 C38	C9-C40 WeakPolarHBondContact CB-SG 3.02Å; C9-C40 WeakPolarHBondContact SG-CB 3.4Å; C9-C40 CovalentContact SG-SG 2.04Å; C9-C40 PolarHBondContact SG-SG 3.11Å; V11-C40 HydrophobicContact CG2-CB 3.92Å; C38-C40 PolarHBondContact O-N 2.89Å
41	R	47.1	Very low	41.9	Very low	199 Å²	199	113 Å²	113	75%	0.751	58%	0.577	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-87.2	119.7	171.9	-163.6	173.4	-178.3	-174	-0.3	107.8	G21 V22 S39 R43	G21-R41 CarbonylContact C-O 3.59Å; G21-R41 VanDerWaalsContact CA-O 3.3Å; G21-R41 WeakPolarHBondContact CA-O 3.03Å; V22-R41 PolarHBondContact N-O 3.37Å; V22-R41 PolarHBondContact O-N 2.97Å; S39-R41 PolarHBondContact O-N 3.08Å; R41-R43 PolarHBondContact O-N 3.47Å
42	R	48.2	Very low	42.1	Very low	105 Å²	105	114 Å²	114	40%	0.396	58%	0.584	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-53.7	131.2	166.7	-93.2	-176.8	173.8	178.8	-3.5	107.9	T19 T44	T19-R42 PolarHBondContact OG1-NE 3Å; T19-R42 PolarHBondContact OG1-NH2 3Å; T19-R42 VanDerWaalsContact OG1-NH2 3.08Å; R42-T44 PolarHBondContact O-N 3.25Å
43	R	45.5	Very low	42.7	Very low	205 Å²	205	116.6 Å²	116.6	77%	0.774	60%	0.602	S	S	*	*			trans	-74.5	91.4	168.2	-155.8	177.7	-173.9	-169.6	1.6	105.4	R41 S45	R41-R43 PolarHBondContact O-N 3.47Å; R43-S45 VanDerWaalsContact C-N 3.29Å; R43-S45 PolarHBondContact O-N 2.75Å
44	T	42.6	Very low	43.5	Very low	113 Å²	113	118.3 Å²	118.3	69%	0.693	61%	0.612	S	S	*	*			trans	-62	100.9	163.1	44.4	0	0	0	0	105.2	R42 L46	R42-T44 PolarHBondContact O-N 3.25Å; T44-L46 PolarHBondContact O-N 3.18Å
45	S	39.9	Very low	44	Very low	85 Å²	85	122.7 Å²	122.7	59%	0.594	64%	0.64	S	S	*	*			trans	-56.4	129.3	163.7	58.5	0	0	0	0	105.5	R43 F47	R43-S45 VanDerWaalsContact C-N 3.29Å; R43-S45 PolarHBondContact O-N 2.75Å; S45-F47 PolarHBondContact O-N 2.7Å
46	L	39	Very low	44.5	Very low	154 Å²	154	121.5 Å²	121.5	81%	0.806	64%	0.642	S	S	*	*			trans	-62.1	77.9	165.2	-75.2	92.8	0	0	0	107.5	T44	T44-L46 PolarHBondContact O-N 3.18Å
47	F	37	Very low	45.1	Very low	181 Å²	181	122.9 Å²	122.9	79%	0.794	66%	0.663	S	S	*	*			trans	-93.6	91.9	147.8	-97.3	-91.1	0	0	0	103.3	S45 P49	S45-F47 PolarHBondContact O-N 2.7Å; F47-P49 VanDerWaalsContact O-CD 3.31Å; F47-P49 WeakPolarHBondContact O-CD 3.38Å
48	Q	34.6	Very low	45.7	Very low	146 Å²	146	121 Å²	121	68%	0.682	66%	0.664	S	S	*	*			trans	-61.6	120.6	157.3	-67	-175.9	10.7	0	0	104.9	D50	Q48-D50 VanDerWaalsContact C-N 3.31Å; Q48-D50 PolarHBondContact O-N 2.75Å
49	P	40.3	Very low	45.9	Very low	109 Å²	109	124.1 Å²	124.1	71%	0.708	70%	0.698	S	S	*	*			trans	-63.4	108.3	156.1	26.9	-27.2	0	0	0	104.9	F47 S51	F47-P49 VanDerWaalsContact O-CD 3.31Å; F47-P49 WeakPolarHBondContact O-CD 3.38Å; P49-S51 PolarHBondContact O-N 3.32Å
50	D	38.2	Very low	45.8	Very low	133 Å²	133	128.3 Å²	128.3	71%	0.711	72%	0.716	S	S	*	*			trans	-67.6	80.6	167.4	-148.3	-59.1	0	0	0	106.1	Q48 S52	Q48-D50 VanDerWaalsContact C-N 3.31Å; Q48-D50 PolarHBondContact O-N 2.75Å; D50-S52 PolarHBondContact O-N 3.23Å; D50-S52 PolarHBondContact OD1-OG 3.18Å
51	S	39.5	Very low	45.7	Very low	101 Å²	101	132.7 Å²	132.7	71%	0.706	74%	0.744	S	S	*	*			trans	-79.9	75.4	174.5	-74	0	0	0	0	107.8	P49 A53	P49-S51 PolarHBondContact O-N 3.32Å; S51-A53 PolarHBondContact O-N 3.3Å
52	S	43.2	Very low	45.8	Very low	100 Å²	100	130.1 Å²	130.1	70%	0.699	75%	0.745	S	S	*	*			trans	-63	85.7	155.9	-69.2	0	0	0	0	107.8	D50	D50-S52 PolarHBondContact O-N 3.23Å; D50-S52 PolarHBondContact OD1-OG 3.18Å
53	A	52.5	Low	45.8	Very low	93 Å²	93	132.6 Å²	132.6	77%	0.769	77%	0.766	S	S	*	*			trans	-98	89.2	167.4	0	0	0	0	0	107.3	S51 D55	S51-A53 PolarHBondContact O-N 3.3Å; A53-D55 PolarHBondContact O-N 2.87Å
54	E	50.6	Low	45.7	Very low	191 Å²	191	134.2 Å²	134.2	89%	0.893	77%	0.772	S	S	*	*			trans	-76.7	109.9	160.1	-50	-152	114	0	0	106.5
55	D	54.5	Low	45.4	Very low	158 Å²	158	133 Å²	133	85%	0.845	77%	0.774	S	S	*	*			trans	-156.3	129.3	148.3	-159.3	49.2	0	0	0	110.7	A53	A53-D55 PolarHBondContact O-N 2.87Å
56	S	49.3	Very low	45.6	Very low	104 Å²	104	134.6 Å²	134.6	73%	0.727	78%	0.78	S	S	*	*			trans	-93.3	130.2	-177.2	-68.4	0	0	0	0	110.3
57	S	58.1	Low	45.6	Very low	114 Å²	114	133.2 Å²	133.2	80%	0.797	78%	0.78	S	S	*	*			trans	-171.6	109.3	142.7	-92.8	0	0	0	0	113.1
58	T	57.4	Low	45.4	Very low	149 Å²	149	128.6 Å²	128.6	91%	0.914	78%	0.776	S	S	*	*				24.1	115.4	129.9	-40.5	0	0	0	0	118.1
59	G	49.3	Very low	45.4	Very low	74 Å²	74	132 Å²	132	76%	0.763	78%	0.784	S	S	*	*			trans	169.2	96.4	161.3	0	0	0	0	0	115.7
60	D	47.7	Very low	44.9	Very low	150 Å²	150	137.9 Å²	137.9	80%	0.802	79%	0.792	S	S	*	*			trans	77.8	118.4	146.7	-139.8	-110	0	0	0	120.8
61	P	46.5	Very low	44.6	Very low	123 Å²	123	136.7 Å²	136.7	80%	0.799	79%	0.785	S	S	*	*			trans	-101.4	99.3	170	35.5	-22.4	0	0	0	110.5
62	D	47.4	Very low	44.3	Very low	144 Å²	144	138.1 Å²	138.1	77%	0.77	79%	0.785	S	S	*	*			trans	-128.5	105.5	162.9	-151.1	-99.6	0	0	0	110.8	R64	D62-R64 PolarHBondContact O-N 2.93Å
63	D	49.9	Very low	43.6	Very low	158 Å²	158	141.1 Å²	141.1	85%	0.845	78%	0.781	S	S	*	*			trans	-75.2	104.7	178.5	-172.3	-92.8	0	0	0	108.6
64	R	41.5	Very low	42.7	Very low	238 Å²	238	146.5 Å²	146.5	90%	0.898	78%	0.782	S	S	*	*			trans	158.3	74.6	143.4	-173.6	172	-178.8	164.5	0	111.8	D62	D62-R64 PolarHBondContact O-N 2.93Å
65	A	36.4	Very low	41.7	Very low	89 Å²	89	143.4 Å²	143.4	74%	0.736	77%	0.767	S	S	*	*			trans	-132.1	110	172.4	0	0	0	0	0	112
66	T	44.2	Very low	40.5	Very low	118 Å²	118	141 Å²	141	72%	0.724	76%	0.762	S	S	*	*			trans	67.9	118.6	145.8	-34.1	0	0	0	0	117.1	A68	T66-A68 PolarHBondContact O-N 3.06Å
67	P	38.9	Very low	39.7	Very low	124 Å²	124	144.4 Å²	144.4	81%	0.805	76%	0.759	S	S	*	*			trans	-65	94.7	158.2	28.7	-29.2	0	0	0	106	Y69	P67-Y69 PolarHBondContact O-N 3.47Å
68	A	33.7	Very low	38.5	Very low	84 Å²	84	145.6 Å²	145.6	69%	0.694	76%	0.756	S	S	*	*			trans	-56.2	99.8	167.4	0	0	0	0	0	105.2	T66 R70	T66-A68 PolarHBondContact O-N 3.06Å; A68-R70 PolarHBondContact O-N 3.45Å
69	Y	33.5	Very low	37.6	Very low	219 Å²	219	143.3 Å²	143.3	86%	0.859	74%	0.735	S	S	*	*			trans	-32.8	110.4	171.2	-151.6	-97.5	0	0	0	105.7	P67 N71	P67-Y69 PolarHBondContact O-N 3.47Å; Y69-N71 PolarHBondContact O-N 3.28Å
70	R	31.8	Very low	37	Very low	231 Å²	231	145.2 Å²	145.2	87%	0.872	73%	0.732	S	S	*	*			trans	-60.8	86.2	179.9	-86.3	-174.7	175.6	176.3	-0.5	106.2	A68 N72	A68-R70 PolarHBondContact O-N 3.45Å; R70-N72 PolarHBondContact O-N 2.79Å
71	N	31.9	Very low	36.4	Very low	108 Å²	108	149.1 Å²	149.1	58%	0.578	74%	0.737	S	S	*	*			trans	-75.2	65.9	163.7	-159	-9.1	0	0	0	104.6	Y69 R73	Y69-N71 PolarHBondContact O-N 3.28Å; N71-R73 PolarHBondContact O-N 3.24Å; N71-R73 WeakPolarHBondContact OD1-CB 3.3Å; N71-R73 WeakPolarHBondContact OD1-CG 3.46Å; N71-R73 PolarHBondContact OD1-N 2.71Å
72	N	31.7	Very low	35.9	Very low	131 Å²	131	146.2 Å²	146.2	70%	0.701	73%	0.729	S	S	*	*			trans	-63.4	70.8	149.5	-107.8	-13.5	0	0	0	104.8	R70 R74	R70-N72 PolarHBondContact O-N 2.79Å; N72-R74 PolarHBondContact O-N 2.96Å
73	R	28.9	Very low	35.5	Very low	164 Å²	164	147.2 Å²	147.2	62%	0.619	72%	0.722	S	S	*	*			trans	-66	81.2	169.2	-133	171.9	-174.9	-169.9	0.8	103.3	N71 H75	N71-R73 PolarHBondContact O-N 3.24Å; N71-R73 WeakPolarHBondContact OD1-CB 3.3Å; N71-R73 WeakPolarHBondContact OD1-CG 3.46Å; N71-R73 PolarHBondContact OD1-N 2.71Å; R73-H75 WeakPolarHBondContact CD-CE1 3.38Å; R73-H75 WeakPolarHBondContact CD-NE2 3Å; R73-H75 WeakPolarHBondContact CG-NE2 3.07Å; R73-H75 PolarHBondContact NE-CE1 3.24Å; R73-H75 PolarHBondContact NE-NE2 2.96Å; R73-H75 PolarHBondContact O-N 2.74Å
74	R	33.1	Very low	35.2	Very low	206 Å²	206	143.4 Å²	143.4	78%	0.777	70%	0.702	S	S	*	*			trans	-66	65.4	159.5	-74.8	-172.2	174.2	-173.5	0.3	106	N72 S76	N72-R74 PolarHBondContact O-N 2.96Å; R74-S76 PolarHBondContact O-N 2.98Å
75	H	30.1	Very low	35.5	Very low	126 Å²	126	133.4 Å²	133.4	58%	0.583	67%	0.666	S	S	*	*			trans	-71	68	165	-83	173.7	0	0	0	107.7	R73	R73-H75 WeakPolarHBondContact CD-CE1 3.38Å; R73-H75 WeakPolarHBondContact CD-NE2 3Å; R73-H75 WeakPolarHBondContact CG-NE2 3.07Å; R73-H75 PolarHBondContact NE-CE1 3.24Å; R73-H75 PolarHBondContact NE-NE2 2.96Å; R73-H75 PolarHBondContact O-N 2.74Å
76	S	30.4	Very low	36	Very low	107 Å²	107	131.5 Å²	131.5	75%	0.748	65%	0.645	S	S	*	*			trans	-159.3	39	160	54.6	0	0	0	0	107.9	R74	R74-S76 PolarHBondContact O-N 2.98Å
77	R	30.7	Very low	36.2	Very low	176 Å²	176	127.1 Å²	127.1	66%	0.664	62%	0.619	S	S	*	*	S	Bend	trans	-71.5	137.3	151.9	-73.9	171.8	75	177.4	10.8	104.8	E79	R77-E79 HydrophobicContact CB-CB 3.88Å; R77-E79 HydrophobicContact CB-CG 3.5Å; R77-E79 VanDerWaalsContact CB-CG 3.5Å; R77-E79 VanDerWaalsContact CD-OE1 3.25Å; R77-E79 WeakPolarHBondContact CD-OE1 3.31Å; R77-E79 HydrophobicContact CG-CG 4.2Å; R77-E79 IonicContact CZ-OE1 3.09Å; R77-E79 IonicContact NE-OE1 3.25Å; R77-E79 PolarHBondContact NE-OE1 3.05Å; R77-E79 IonicContact NH1-OE1 2.66Å; R77-E79 PolarHBondContact NH1-OE1 2.73Å; R77-E79 PolarHBondContact O-N 2.82Å
78	L	34.3	Very low	36.3	Very low	139 Å²	139	126.5 Å²	126.5	73%	0.728	61%	0.605	S	S	*	*			trans	-62.1	50.7	147.6	-80.7	85.8	0	0	0	109.1	T80	L78-T80 PolarHBondContact O-N 2.83Å
79	E	36.8	Very low	36.6	Very low	101 Å²	101	126.3 Å²	126.3	47%	0.472	59%	0.592	S	S	.	*			trans	-66.6	101.6	157.2	-88.7	167.9	160.3	0	0	102.7	R77	R77-E79 HydrophobicContact CB-CB 3.88Å; R77-E79 HydrophobicContact CB-CG 3.5Å; R77-E79 VanDerWaalsContact CB-CG 3.5Å; R77-E79 VanDerWaalsContact CD-OE1 3.25Å; R77-E79 WeakPolarHBondContact CD-OE1 3.31Å; R77-E79 HydrophobicContact CG-CG 4.2Å; R77-E79 IonicContact CZ-OE1 3.09Å; R77-E79 IonicContact NE-OE1 3.25Å; R77-E79 PolarHBondContact NE-OE1 3.05Å; R77-E79 IonicContact NH1-OE1 2.66Å; R77-E79 PolarHBondContact NH1-OE1 2.73Å; R77-E79 PolarHBondContact O-N 2.82Å
80	T	37.2	Very low	36.9	Very low	114 Å²	114	117.5 Å²	117.5	70%	0.699	57%	0.569	S	S	*	*			cis	-160.3	146.4	46.4	-61.5	0	0	0	0	106.3	L78 G82	L78-T80 PolarHBondContact O-N 2.83Å; T80-G82 PolarHBondContact O-N 3.09Å
81	Y	35.4	Very low	37.1	Very low	231 Å²	231	111.6 Å²	111.6	91%	0.906	56%	0.56	S	S	*	*	S	Bend	trans	-38.7	91.7	165.6	-75.5	-105.6	0	0	0	112.7
82	G	35.5	Very low	37.3	Very low	62 Å²	62	109.3 Å²	109.3	64%	0.639	56%	0.562	S	S	*	*			trans	176.4	6.5	-177.2	0	0	0	0	0	118.1	T80	T80-G82 PolarHBondContact O-N 3.09Å
83	R	40.7	Very low	37.3	Very low	165 Å²	165	108.3 Å²	108.3	62%	0.623	56%	0.561	S	S	*	*			trans	-124.3	116.8	177.9	-65.6	-172.5	173.9	169	-3.1	111.3	I85 V107 W108	R83-I85 PolarHBondContact O-N 3Å; R83-V107 HydrophobicContact CB-CG1 4.15Å; R83-W108 VanDerWaalsContact CA-O 3.3Å; R83-W108 WeakPolarHBondContact CA-O 3.11Å; R83-W108 WeakPolarHBondContact CB-O 3.2Å
84	L	42	Very low	37.5	Very low	79 Å²	79	104.9 Å²	104.9	41%	0.414	56%	0.562	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-79.2	118.9	176.4	-160.9	83.4	0	0	0	108.3	I35 V86 W108	I35-L84 HydrophobicContact CB-CD1 4.46Å; I35-L84 HydrophobicContact CD1-CD1 3.94Å; I35-L84 HydrophobicContact CG1-CD1 3.97Å; I35-L84 HydrophobicContact CG1-CG 4.46Å; I35-L84 HydrophobicContact CG2-CD1 3.64Å; L84-V86 HydrophobicContact CD2-CG2 3.47Å; L84-V86 VanDerWaalsContact CD2-CG2 3.47Å; L84-V86 HydrophobicContact CG-CG2 3.98Å; L84-W108 HydrophobicContact CB-CB 4.3Å; L84-W108 PolarHBondContact N-O 3.41Å; L84-W108 PolarHBondContact O-N 2.74Å
85	I	48.5	Very low	37.5	Very low	27 Å²	27	100.2 Å²	100.2	14%	0.138	57%	0.567	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.3	104.5	172	-54.8	176.5	0	0	0	106.9	C38 R83 C105 V107	C38-I85 HydrophobicContact CB-CG2 4.27Å; C38-I85 WeakPolarHBondContact O-CD1 3.15Å; R83-I85 PolarHBondContact O-N 3Å; I85-C105 HydrophobicContact CG2-CB 4Å; I85-V107 HydrophobicContact CG1-CG2 4.26Å
86	V	47.1	Very low	37.8	Very low	50 Å²	50	100.2 Å²	100.2	30%	0.303	58%	0.577	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-96.8	110.1	176.1	-176.5	0	0	0	0	107.8	L84 C105 I106	L84-V86 HydrophobicContact CD2-CG2 3.47Å; L84-V86 VanDerWaalsContact CD2-CG2 3.47Å; L84-V86 HydrophobicContact CG-CG2 3.98Å; V86-C105 CarbonylContact O-C 3.57Å; V86-C105 WeakPolarHBondContact O-CA 3.41Å; V86-I106 PolarHBondContact N-O 2.75Å; V86-I106 PolarHBondContact O-N 2.9Å
87	C	47.8	Very low	38.1	Very low	26 Å²	26	98.6 Å²	98.6	18%	0.176	57%	0.565	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-95	119.3	171.3	-60.2	0	0	0	0	109.1	K104 C105	C87-K104 CarbonylContact C-O 3.54Å; C87-K104 WeakPolarHBondContact CA-O 3.46Å; C87-C105 HydrophobicContact CB-CB 4.17Å; C87-C105 WeakPolarHBondContact CB-SG 3.25Å; C87-C105 WeakPolarHBondContact SG-CB 3.17Å; C87-C105 CovalentContact SG-SG 2.06Å; C87-C105 PolarHBondContact SG-SG 2.8Å
88	Q	40.8	Very low	38.4	Very low	110 Å²	110	96.5 Å²	96.5	51%	0.514	58%	0.575	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-101.2	127.6	172.2	-164	174.9	24.1	0	0	108.8	G90 K104	Q88-G90 PolarHBondContact O-N 3.38Å; Q88-K104 PolarHBondContact N-O 3.25Å; Q88-K104 PolarHBondContact O-N 2.66Å; Q88-K104 VanDerWaalsContact O-N 3.11Å
89	D	41.3	Very low	38.6	Very low	80 Å²	80	94 Å²	94	43%	0.428	57%	0.569	S	S	.	*			trans	-69.3	88.6	162.4	-81.5	-60.8	0	0	0	107.7	M28	M28-D89 WeakPolarHBondContact CE-OD1 3.3Å; M28-D89 WeakPolarHBondContact CE-OD2 3.31Å
90	G	39.5	Very low	38.5	Very low	35 Å²	35	92 Å²	92	36%	0.361	56%	0.561	S	S	.	*			trans	-69.7	136.8	170.3	0	0	0	0	0	109	Q88 G92	Q88-G90 PolarHBondContact O-N 3.38Å; G90-G92 PolarHBondContact O-N 2.95Å
91	P	35.5	Very low	38.6	Very low	106 Å²	106	94.1 Å²	94.1	69%	0.688	57%	0.566	S	S	*	*			trans	-54.5	137.3	152.9	28	-32.2	0	0	0	106.2	T93	P91-T93 PolarHBondContact O-N 2.72Å
92	G	36.8	Very low	38.7	Very low	61 Å²	61	84.9 Å²	84.9	63%	0.629	54%	0.541	S	S	*	.	S	Bend	trans	-67	52.6	-177.6	0	0	0	0	0	113.3	G90	G90-G92 PolarHBondContact O-N 2.95Å
93	T	30.7	Very low	39.1	Very low	110 Å²	110	83.4 Å²	83.4	68%	0.675	52%	0.52	S	S	*	.			trans	-148.6	78.1	-165.3	56.4	0	0	0	0	109.6	P91	P91-T93 PolarHBondContact O-N 2.72Å
94	S	32.9	Very low	39.4	Very low	91 Å²	91	80 Å²	80	64%	0.636	51%	0.51	S	S	*	.			trans	-144	116.3	147.1	-165	0	0	0	0	107.9	T96	S94-T96 VanDerWaalsContact C-N 3.28Å; S94-T96 PolarHBondContact O-N 3.44Å
95	A	33.2	Very low	39.6	Very low	108 Å²	108	76.4 Å²	76.4	89%	0.893	49%	0.491	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.8	49.6	-151.3	0	0	0	0	0	114.6
96	T	37.6	Very low	39.6	Very low	127 Å²	127	78.3 Å²	78.3	78%	0.779	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-133.1	3.8	-179.3	-26.7	0	0	0	0	114.2	S94	S94-T96 VanDerWaalsContact C-N 3.28Å; S94-T96 PolarHBondContact O-N 3.44Å
97	S	36.6	Very low	39.5	Very low	73 Å²	73	77 Å²	77	51%	0.51	49%	0.494	S	S	.	.			trans	-158.4	107.1	167.4	-90.4	0	0	0	0	111.1	S99	S97-S99 PolarHBondContact O-N 2.75Å
98	P	36.5	Very low	39.1	Very low	132 Å²	132	84 Å²	84	86%	0.857	52%	0.516	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.5	-0.7	-178	25.4	-32.7	0	0	0	114.3
99	S	37.7	Very low	39.1	Very low	86 Å²	86	83.2 Å²	83.2	60%	0.601	52%	0.519	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.2	8.7	-172.6	-49	0	0	0	0	115.4	S97	S97-S99 PolarHBondContact O-N 2.75Å
100	L	36.4	Very low	39	Very low	59 Å²	59	83.4 Å²	83.4	31%	0.309	52%	0.524	S	S	.	.			trans	-131.8	67.3	-170.3	-75.7	156.4	0	0	0	112.2	L10 G102	L10-L100 HydrophobicContact CD1-CD1 3.96Å; L10-L100 HydrophobicContact CD1-CD2 3.74Å; L10-L100 HydrophobicContact CD1-CG 4.34Å; L10-L100 HydrophobicContact CD2-CD1 4.38Å; L10-L100 HydrophobicContact CG-CD2 4.12Å; L100-G102 PolarHBondContact O-N 3.47Å
101	I	37.4	Very low	39	Very low	158 Å²	158	85.9 Å²	85.9	81%	0.81	53%	0.532	S	S	*	.			trans	-87.1	98.5	164.5	-56.4	170.8	0	0	0	106.8
102	G	39.4	Very low	39.2	Very low	37 Å²	37	84.8 Å²	84.8	38%	0.381	52%	0.523	S	S	.	.	S	Bend	trans	168.2	164.5	178.9	0	0	0	0	0	114	L100 K104	L100-G102 PolarHBondContact O-N 3.47Å; G102-K104 PolarHBondContact O-N 2.59Å
103	P	43.5	Very low	39.3	Very low	31 Å²	31	86.2 Å²	86.2	20%	0.201	52%	0.517	C	S	.	.	P	Polyproline II helix	trans	-57.4	132.6	-178.4	23.8	-33.7	0	0	0	111.2
104	K	46.9	Very low	39.8	Very low	95 Å²	95	84.7 Å²	84.7	41%	0.413	51%	0.507	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.8	118.7	175.1	-70.4	-176.8	178.6	176.3	0	107.9	L10 C87 Q88 G102	L10-K104 HydrophobicContact CD1-CG 4.23Å; C87-K104 CarbonylContact C-O 3.54Å; C87-K104 WeakPolarHBondContact CA-O 3.46Å; Q88-K104 PolarHBondContact N-O 3.25Å; Q88-K104 PolarHBondContact O-N 2.66Å; Q88-K104 VanDerWaalsContact O-N 3.11Å; G102-K104 PolarHBondContact O-N 2.59Å
105	C	46.7	Very low	40.3	Very low	2 Å²	2	84.3 Å²	84.3	1%	0.014	50%	0.499	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100	128	170.7	-57.9	0	0	0	0	109	C9 I85 V86 C87	C9-C105 HydrophobicContact CB-CB 4.22Å; I85-C105 HydrophobicContact CG2-CB 4Å; V86-C105 CarbonylContact O-C 3.57Å; V86-C105 WeakPolarHBondContact O-CA 3.41Å; C87-C105 HydrophobicContact CB-CB 4.17Å; C87-C105 WeakPolarHBondContact CB-SG 3.25Å; C87-C105 WeakPolarHBondContact SG-CB 3.17Å; C87-C105 CovalentContact SG-SG 2.06Å; C87-C105 PolarHBondContact SG-SG 2.8Å
106	I	47.8	Very low	40.8	Very low	68 Å²	68	82.6 Å²	82.6	35%	0.349	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.5	123.7	172.9	-55.6	175.6	0	0	0	106.1	H12 V86	H12-I106 HydrophobicContact CB-CG2 4.39Å; V86-I106 PolarHBondContact N-O 2.75Å; V86-I106 PolarHBondContact O-N 2.9Å
107	V	44.8	Very low	41.1	Very low	23 Å²	23	79.2 Å²	79.2	14%	0.139	45%	0.447	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.9	113.1	172.2	-176.4	0	0	0	0	106.7	V11 R83 I85	V11-V107 HydrophobicContact CG1-CG2 3.99Å; R83-V107 HydrophobicContact CB-CG1 4.15Å; I85-V107 HydrophobicContact CG1-CG2 4.26Å
108	W	38.6	Very low	41.4	Very low	171 Å²	171	79.7 Å²	79.7	65%	0.648	44%	0.442	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85	121.2	169.9	-74.4	56.7	0	0	0	107.8	R83 L84	R83-W108 VanDerWaalsContact CA-O 3.3Å; R83-W108 WeakPolarHBondContact CA-O 3.11Å; R83-W108 WeakPolarHBondContact CB-O 3.2Å; L84-W108 HydrophobicContact CB-CB 4.3Å; L84-W108 PolarHBondContact N-O 3.41Å; L84-W108 PolarHBondContact O-N 2.74Å
109	T	41.6	Very low	41.9	Very low	94 Å²	94	74.9 Å²	74.9	58%	0.577	40%	0.404	S	S	*	.			trans	-97.2	0	170.9	60.8	0	0	0	0	110.5

Retrieved 109 of 109 residues in 20.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).