A0A077YYZ5_TRITR Loading...

Exocyst complex component Sec8

Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.

AlphaFold DB , UniProt , Accession A0A077YYZ5, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 134 aa.

						>A0A077YYZ5_TRITR|A0A077YYZ5
MGENRPERPPRRFGGQRYQPLRSAGLLVEVVRTLTTSPSQAQKELVKEKLEKDYAATKEVVDHLVDVQHEDVATALQSFRRVSTDVQTARERIKMIKNNLSSCQLLLRCKRDELKKLWLESAELKYVVRLLEQL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.6	Very low	52.6	Low	241 Å²	241	160.1 Å²	160.1	100%	1.187	82%	0.816	S	S	*	*				0	99.6	0	-72.6	-125.8	-81.9	0	0	107.2	E3	M1-E3 PolarHBondContact O-N 3.31Å
2	G	55.8	Low	51.9	Low	80 Å²	80	167.1 Å²	167.1	83%	0.825	83%	0.825	S	S	*	*			trans	-75	110.8	-178.5	0	0	0	0	0	109.6	N4	G2-N4 PolarHBondContact O-N 3.39Å; G2-N4 VanDerWaalsContact O-N 3.12Å
3	E	51.5	Low	51	Low	146 Å²	146	170.5 Å²	170.5	68%	0.682	83%	0.833	S	S	*	*			trans	-67.9	104.3	177.7	-156.5	173	-136	0	0	108.2	M1 R5	M1-E3 PolarHBondContact O-N 3.31Å; E3-R5 HydrophobicContact CG-CG 4.44Å; E3-R5 PolarHBondContact O-N 3.13Å; E3-R5 IonicContact OE2-CZ 3.4Å; E3-R5 IonicContact OE2-NE 3.05Å; E3-R5 PolarHBondContact OE2-NE 2.94Å; E3-R5 IonicContact OE2-NH2 2.83Å; E3-R5 PolarHBondContact OE2-NH2 3.49Å
4	N	59.9	Low	50.3	Low	164 Å²	164	163.2 Å²	163.2	88%	0.877	82%	0.824	S	S	*	*			trans	-70.4	75.5	179.7	-121	-32.9	0	0	0	109	G2	G2-N4 PolarHBondContact O-N 3.39Å; G2-N4 VanDerWaalsContact O-N 3.12Å
5	R	52.9	Low	49.8	Very low	187 Å²	187	157.4 Å²	157.4	71%	0.706	82%	0.821	S	S	*	*			trans	-72.9	126	174.2	-68.7	-174.9	-176.2	-153.8	-1.1	107.9	E3 E7	E3-R5 HydrophobicContact CG-CG 4.44Å; E3-R5 PolarHBondContact O-N 3.13Å; E3-R5 IonicContact OE2-CZ 3.4Å; E3-R5 IonicContact OE2-NE 3.05Å; E3-R5 PolarHBondContact OE2-NE 2.94Å; E3-R5 IonicContact OE2-NH2 2.83Å; E3-R5 PolarHBondContact OE2-NH2 3.49Å; R5-E7 PolarHBondContact O-N 3.22Å
6	P	58	Low	49.6	Very low	129 Å²	129	159.3 Å²	159.3	84%	0.838	83%	0.825	S	S	*	*			trans	-60.8	112	177.1	23	-30.9	0	0	0	108.9	R8	P6-R8 PolarHBondContact O-N 3.35Å
7	E	55.4	Low	49.4	Very low	187 Å²	187	163 Å²	163	87%	0.874	83%	0.826	S	S	*	*	P	Polyproline II helix	trans	-61.3	122.9	173.5	-100.3	-175.2	155.3	0	0	108.7	R5	R5-E7 PolarHBondContact O-N 3.22Å
8	R	48.8	Very low	49.4	Very low	201 Å²	201	165.7 Å²	165.7	76%	0.758	83%	0.826	S	S	*	*	P	Polyproline II helix	trans	-60.4	128	174.9	-178.8	178.4	-116.6	175.6	-3	107.9	P6	P6-R8 PolarHBondContact O-N 3.35Å
9	P	49	Very low	49.6	Very low	105 Å²	105	162.3 Å²	162.3	68%	0.682	81%	0.807	S	S	*	*	P	Polyproline II helix	trans	-52.6	139.6	-179.7	-25.7	32.1	0	0	0	111.2	R11	P9-R11 PolarHBondContact O-N 2.89Å; P9-R11 VanDerWaalsContact O-N 3.15Å
10	P	50	Low	49.6	Very low	125 Å²	125	157.9 Å²	157.9	81%	0.812	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-59	122.4	-177.1	22.9	-31.2	0	0	0	109.1	R12	P10-R12 PolarHBondContact O-N 3.46Å
11	R	51.7	Low	49.7	Very low	196 Å²	196	157.6 Å²	157.6	74%	0.74	79%	0.791	S	S	*	*			trans	-59.1	114.9	171	-63.6	-171.6	-135.8	-161.9	6.1	106.3	P9 F13	P9-R11 PolarHBondContact O-N 2.89Å; P9-R11 VanDerWaalsContact O-N 3.15Å; R11-F13 WeakPolarHBondContact O-CD2 3.4Å; R11-F13 PolarHBondContact O-N 3.17Å
12	R	44	Very low	50.4	Low	244 Å²	244	155 Å²	155	92%	0.921	77%	0.768	S	S	*	*			trans	-47.4	104.1	170	-93.5	-175.9	171.9	-142.3	2	108.3	P10 G14	P10-R12 PolarHBondContact O-N 3.46Å; R12-G14 PolarHBondContact O-N 3Å
13	F	40.5	Very low	50.9	Low	211 Å²	211	153.9 Å²	153.9	93%	0.925	75%	0.748	S	S	*	*			trans	-73	104.9	167.1	-90.3	-92.9	0	0	0	106.2	R11	R11-F13 WeakPolarHBondContact O-CD2 3.4Å; R11-F13 PolarHBondContact O-N 3.17Å
14	G	40.8	Very low	51.9	Low	69 Å²	69	149.4 Å²	149.4	71%	0.711	74%	0.736	S	S	*	*	S	Bend	trans	135.3	108.9	171.9	0	0	0	0	0	113.5	R12	R12-G14 PolarHBondContact O-N 3Å
15	G	43	Very low	52.9	Low	76 Å²	76	143.5 Å²	143.5	78%	0.784	71%	0.714	S	S	*	*	S	Bend	trans	119.1	-60.1	143	0	0	0	0	0	117.8
16	Q	47.2	Very low	54.1	Low	188 Å²	188	139.8 Å²	139.8	88%	0.879	71%	0.707	S	S	*	*			trans	-128.8	93.9	-174.8	-89.3	113.4	1	0	0	111.5	Y18	Q16-Y18 PolarHBondContact O-N 3.06Å; Q16-Y18 VanDerWaalsContact O-N 3.11Å
17	R	46.4	Very low	55.2	Low	222 Å²	222	138.5 Å²	138.5	84%	0.838	69%	0.693	S	S	*	*			trans	-61.4	110.7	157	-79.2	-177.8	170.4	-176.7	-2.2	107.1	Q19	R17-Q19 HydrophobicContact CB-CG 4.23Å; R17-Q19 PolarHBondContact O-N 3.23Å
18	Y	48.6	Very low	56.7	Low	212 Å²	212	134.4 Å²	134.4	83%	0.831	68%	0.68	S	S	*	*			trans	-53.6	110.7	158.7	-161.4	-97.2	0	0	0	106.7	Q16 P20	Q16-Y18 PolarHBondContact O-N 3.06Å; Q16-Y18 VanDerWaalsContact O-N 3.11Å; Y18-P20 VanDerWaalsContact C-CD 3.44Å; Y18-P20 WeakPolarHBondContact O-CD 3.29Å
19	Q	52.8	Low	58.3	Low	100 Å²	100	129.8 Å²	129.8	47%	0.467	67%	0.667	S	S	.	*			trans	-105.4	86	-178	-76.7	-175.6	3.8	0	0	109	R17 L21 R22	R17-Q19 HydrophobicContact CB-CG 4.23Å; R17-Q19 PolarHBondContact O-N 3.23Å; Q19-L21 PolarHBondContact O-N 3.18Å; Q19-L21 VanDerWaalsContact O-N 3.08Å; Q19-R22 HydrophobicContact CB-CB 4.33Å; Q19-R22 PolarHBondContact O-N 3.41Å; Q19-R22 VanDerWaalsContact O-N 3.08Å
20	P	50.6	Low	60.1	Low	75 Å²	75	126.1 Å²	126.1	49%	0.487	64%	0.643	S	S	.	*	H	α-helix	trans	-57.7	-27.5	-177.4	7.1	-15.1	0	0	0	113.4	Y18 S23 A24	Y18-P20 VanDerWaalsContact C-CD 3.44Å; Y18-P20 WeakPolarHBondContact O-CD 3.29Å; P20-S23 PolarHBondContact O-OG 2.91Å; P20-A24 PolarHBondContact O-N 3.3Å
21	L	52.1	Low	61.8	Low	151 Å²	151	124.4 Å²	124.4	79%	0.791	63%	0.63	S	S	*	*	H	α-helix	trans	-70	-34.1	179	-84.4	80.5	0	0	0	113.2	Q19 G25	Q19-L21 PolarHBondContact O-N 3.18Å; Q19-L21 VanDerWaalsContact O-N 3.08Å; L21-G25 PolarHBondContact O-N 3.4Å; L21-G25 VanDerWaalsContact O-N 3.14Å
22	R	59	Low	63.4	Low	186 Å²	186	121.3 Å²	121.3	70%	0.702	62%	0.618	S	S	*	*	H	α-helix	trans	-70.2	-40.1	178.8	-84.6	-161.5	175	-149.5	-2.9	111.6	Q19 G25 L26	Q19-R22 HydrophobicContact CB-CB 4.33Å; Q19-R22 PolarHBondContact O-N 3.41Å; Q19-R22 VanDerWaalsContact O-N 3.08Å; R22-G25 PolarHBondContact O-N 3.03Å; R22-L26 WeakPolarHBondContact O-CG 3.39Å; R22-L26 PolarHBondContact O-N 3.33Å; R22-L26 VanDerWaalsContact O-N 3.11Å
23	S	66.3	Low	65.3	Low	57 Å²	57	110.3 Å²	110.3	40%	0.399	58%	0.579	S	S	.	*	H	α-helix	trans	-65.9	-39.8	177.3	48.9	0	0	0	0	112.2	P20 G25 L26 L27	P20-S23 PolarHBondContact O-OG 2.91Å; S23-G25 VanDerWaalsContact C-N 3.35Å; S23-G25 PolarHBondContact O-N 3.12Å; S23-L26 PolarHBondContact O-N 3.41Å; S23-L27 PolarHBondContact O-N 2.99Å; S23-L27 VanDerWaalsContact O-N 3.13Å
24	A	73.9	Confident	67.4	Low	52 Å²	52	103.1 Å²	103.1	43%	0.43	55%	0.549	S	S	.	.	H	α-helix	trans	-62.1	-43.1	174.9	0	0	0	0	0	111.5	P20 L26 L27 V28	P20-A24 PolarHBondContact O-N 3.3Å; A24-L26 PolarHBondContact O-N 3.06Å; A24-L27 PolarHBondContact O-N 3.13Å; A24-V28 WeakPolarHBondContact O-CG2 3.34Å; A24-V28 PolarHBondContact O-N 3.35Å
25	G	79.2	Confident	69.6	Low	40 Å²	40	104.7 Å²	104.7	41%	0.412	55%	0.545	S	S	.	.	H	α-helix	trans	-59.9	-42.3	176.5	0	0	0	0	0	113.5	L21 R22 S23 V28 E29	L21-G25 PolarHBondContact O-N 3.4Å; L21-G25 VanDerWaalsContact O-N 3.14Å; R22-G25 PolarHBondContact O-N 3.03Å; S23-G25 VanDerWaalsContact C-N 3.35Å; S23-G25 PolarHBondContact O-N 3.12Å; G25-V28 PolarHBondContact O-N 2.97Å; G25-E29 PolarHBondContact O-N 3.12Å
26	L	78.8	Confident	71.7	Confident	109 Å²	109	105.4 Å²	105.4	57%	0.571	53%	0.534	S	S	*	.	H	α-helix	trans	-63.2	-42.2	176.2	-70.7	169.3	0	0	0	112.1	R22 S23 A24 E29 V30	R22-L26 WeakPolarHBondContact O-CG 3.39Å; R22-L26 PolarHBondContact O-N 3.33Å; R22-L26 VanDerWaalsContact O-N 3.11Å; S23-L26 PolarHBondContact O-N 3.41Å; A24-L26 PolarHBondContact O-N 3.06Å; L26-E29 PolarHBondContact O-N 2.93Å; L26-V30 VanDerWaalsContact O-CG2 3.3Å; L26-V30 WeakPolarHBondContact O-CG2 3.48Å; L26-V30 PolarHBondContact O-N 3.44Å
27	L	81.6	Confident	73.5	Confident	102 Å²	102	96.9 Å²	96.9	53%	0.534	50%	0.496	S	S	.	.	H	α-helix	trans	-64.5	-41.4	176.6	-72.5	169.4	0	0	0	111.7	S23 A24 E29 V30 V31	S23-L27 PolarHBondContact O-N 2.99Å; S23-L27 VanDerWaalsContact O-N 3.13Å; A24-L27 PolarHBondContact O-N 3.13Å; L27-E29 VanDerWaalsContact C-N 3.28Å; L27-E29 PolarHBondContact O-N 2.93Å; L27-V30 PolarHBondContact O-N 3.4Å; L27-V31 WeakPolarHBondContact O-CB 3.36Å; L27-V31 VanDerWaalsContact O-CG2 3.28Å; L27-V31 WeakPolarHBondContact O-CG2 3.34Å; L27-V31 PolarHBondContact O-N 3.4Å
28	V	85.7	Confident	75.2	Confident	101 Å²	101	92.8 Å²	92.8	61%	0.612	50%	0.498	S	S	*	.	H	α-helix	trans	-59.9	-42.1	174.4	172	0	0	0	0	110.6	A24 G25 V31 R32	A24-V28 WeakPolarHBondContact O-CG2 3.34Å; A24-V28 PolarHBondContact O-N 3.35Å; G25-V28 PolarHBondContact O-N 2.97Å; V28-V31 PolarHBondContact O-N 2.94Å; V28-R32 VanDerWaalsContact O-CB 3.24Å; V28-R32 WeakPolarHBondContact O-CB 3.44Å; V28-R32 PolarHBondContact O-N 3.29Å
29	E	83.3	Confident	77	Confident	104 Å²	104	85.2 Å²	85.2	49%	0.486	48%	0.476	S	S	.	.	H	α-helix	trans	-65.8	-40.6	177.4	-174.6	170.3	-160.1	0	0	112.8	G25 L26 L27 T33	G25-E29 PolarHBondContact O-N 3.12Å; L26-E29 PolarHBondContact O-N 2.93Å; L27-E29 VanDerWaalsContact C-N 3.28Å; L27-E29 PolarHBondContact O-N 2.93Å; E29-T33 WeakPolarHBondContact O-CB 3.5Å; E29-T33 PolarHBondContact O-N 3.49Å; E29-T33 PolarHBondContact O-OG1 2.98Å
30	V	85.8	Confident	78.6	Confident	29 Å²	29	86 Å²	86	18%	0.176	48%	0.479	C	S	.	.	H	α-helix	trans	-62.8	-50.5	174.3	168.6	0	0	0	0	110.9	L26 L27 R32 T33 L34 V46 L50	L26-V30 VanDerWaalsContact O-CG2 3.3Å; L26-V30 WeakPolarHBondContact O-CG2 3.48Å; L26-V30 PolarHBondContact O-N 3.44Å; L27-V30 PolarHBondContact O-N 3.4Å; V30-R32 VanDerWaalsContact C-N 3.32Å; V30-R32 PolarHBondContact O-N 2.75Å; V30-T33 PolarHBondContact O-N 3.41Å; V30-T33 VanDerWaalsContact O-N 3.14Å; V30-L34 HydrophobicContact CG1-CD1 3.79Å; V30-L34 HydrophobicContact CG1-CG 4.41Å; V30-L34 WeakPolarHBondContact O-CG 3.26Å; V30-L34 PolarHBondContact O-N 3.2Å; V30-V46 HydrophobicContact CB-CG1 4.5Å; V30-V46 HydrophobicContact CG1-CG1 4.02Å; V30-V46 HydrophobicContact CG2-CG1 4.23Å; V30-L50 HydrophobicContact CG1-CD2 4.1Å
31	V	85.5	Confident	80.4	Confident	89 Å²	89	85.5 Å²	85.5	54%	0.539	48%	0.482	S	S	.	.	H	α-helix	trans	-58.7	-45.7	177.8	170	0	0	0	0	110.6	L27 V28 T33 L34 T35	L27-V31 WeakPolarHBondContact O-CB 3.36Å; L27-V31 VanDerWaalsContact O-CG2 3.28Å; L27-V31 WeakPolarHBondContact O-CG2 3.34Å; L27-V31 PolarHBondContact O-N 3.4Å; V28-V31 PolarHBondContact O-N 2.94Å; V31-T33 VanDerWaalsContact C-N 3.34Å; V31-T33 PolarHBondContact O-N 2.95Å; V31-L34 PolarHBondContact O-N 3Å; V31-T35 VanDerWaalsContact O-CB 3.32Å; V31-T35 WeakPolarHBondContact O-CB 3.46Å; V31-T35 PolarHBondContact O-N 3.37Å; V31-T35 PolarHBondContact O-OG1 2.98Å
32	R	86.4	Confident	82	Confident	130 Å²	130	82.8 Å²	82.8	49%	0.491	47%	0.465	S	S	.	.	H	α-helix	trans	-56.8	-49.6	175.2	-175	-172.6	65.2	76.3	0.9	110.4	V28 V30 L34 T35 T36	V28-R32 VanDerWaalsContact O-CB 3.24Å; V28-R32 WeakPolarHBondContact O-CB 3.44Å; V28-R32 PolarHBondContact O-N 3.29Å; V30-R32 VanDerWaalsContact C-N 3.32Å; V30-R32 PolarHBondContact O-N 2.75Å; R32-L34 PolarHBondContact O-N 3.4Å; R32-T35 PolarHBondContact O-N 3.11Å; R32-T36 HydrophobicContact CG-CG2 4.4Å; R32-T36 WeakPolarHBondContact O-CB 3.4Å; R32-T36 PolarHBondContact O-N 3.44Å; R32-T36 PolarHBondContact O-OG1 3.42Å
33	T	84.5	Confident	83.3	Confident	14 Å²	14	76.4 Å²	76.4	9%	0.086	44%	0.443	C	S	.	.	H	α-helix	trans	-64.6	-41.6	-176.9	-55.7	0	0	0	0	112.1	E29 V30 V31 T35 S37 Q42 V46	E29-T33 WeakPolarHBondContact O-CB 3.5Å; E29-T33 PolarHBondContact O-N 3.49Å; E29-T33 PolarHBondContact O-OG1 2.98Å; V30-T33 PolarHBondContact O-N 3.41Å; V30-T33 VanDerWaalsContact O-N 3.14Å; V31-T33 VanDerWaalsContact C-N 3.34Å; V31-T33 PolarHBondContact O-N 2.95Å; T33-T35 VanDerWaalsContact C-N 3.32Å; T33-T35 PolarHBondContact O-N 2.98Å; T33-S37 WeakPolarHBondContact O-CB 3.32Å; T33-S37 PolarHBondContact O-N 3.48Å; T33-Q42 HydrophobicContact CG2-CG 4.27Å; T33-V46 HydrophobicContact CG2-CG2 3.96Å
34	L	83.6	Confident	84.4	Confident	59 Å²	59	78.8 Å²	78.8	31%	0.309	45%	0.447	S	S	.	.	H	α-helix	trans	-67.4	-31.9	176.6	-68.7	172.3	0	0	0	112.8	V30 V31 R32 K43	V30-L34 HydrophobicContact CG1-CD1 3.79Å; V30-L34 HydrophobicContact CG1-CG 4.41Å; V30-L34 WeakPolarHBondContact O-CG 3.26Å; V30-L34 PolarHBondContact O-N 3.2Å; V31-L34 PolarHBondContact O-N 3Å; R32-L34 PolarHBondContact O-N 3.4Å; L34-K43 HydrophobicContact CD2-CB 3.93Å; L34-K43 HydrophobicContact CD2-CG 4.38Å; L34-K43 VanDerWaalsContact O-CD 3.32Å; L34-K43 WeakPolarHBondContact O-CD 3.37Å; L34-K43 WeakPolarHBondContact O-CE 3.43Å; L34-K43 PolarHBondContact O-NZ 3.48Å
35	T	87.2	Confident	85.1	Confident	103 Å²	103	81.6 Å²	81.6	63%	0.632	46%	0.455	S	S	*	.	H	α-helix	trans	-84.8	-44.2	-178.6	-50.5	0	0	0	0	112	V31 R32 T33	V31-T35 VanDerWaalsContact O-CB 3.32Å; V31-T35 WeakPolarHBondContact O-CB 3.46Å; V31-T35 PolarHBondContact O-N 3.37Å; V31-T35 PolarHBondContact O-OG1 2.98Å; R32-T35 PolarHBondContact O-N 3.11Å; T33-T35 VanDerWaalsContact C-N 3.32Å; T33-T35 PolarHBondContact O-N 2.98Å
36	T	87.4	Confident	85.5	Confident	90 Å²	90	81 Å²	81	55%	0.552	44%	0.443	S	S	*	.	H	α-helix	trans	-102.8	-14.7	-168.8	70.7	0	0	0	0	114.7	R32 P38	R32-T36 HydrophobicContact CG-CG2 4.4Å; R32-T36 WeakPolarHBondContact O-CB 3.4Å; R32-T36 PolarHBondContact O-N 3.44Å; R32-T36 PolarHBondContact O-OG1 3.42Å; T36-P38 WeakPolarHBondContact O-CD 3.47Å
37	S	84.1	Confident	85.9	Confident	10 Å²	10	81.2 Å²	81.2	7%	0.07	44%	0.439	C	S	.	.			trans	-68.2	130.5	179.1	-176.8	0	0	0	0	110.2	T33 S39 Q42 K43	T33-S37 WeakPolarHBondContact O-CB 3.32Å; T33-S37 PolarHBondContact O-N 3.48Å; S37-S39 VanDerWaalsContact C-N 3.28Å; S37-S39 PolarHBondContact OG-N 3.49Å; S37-Q42 PolarHBondContact OG-OE1 3.36Å; S37-K43 WeakPolarHBondContact O-CE 3.44Å; S37-K43 PolarHBondContact O-NZ 2.94Å
38	P	81.9	Confident	86.3	Confident	135 Å²	135	83 Å²	83	88%	0.877	45%	0.445	S	S	*	.	S	Bend	trans	-77.4	-17.6	172.1	31.5	-34.3	0	0	0	112.2	T36	T36-P38 WeakPolarHBondContact O-CD 3.47Å
39	S	88	Confident	86.5	Confident	54 Å²	54	84.3 Å²	84.3	38%	0.378	44%	0.442	S	S	.	.			trans	-88.9	112.5	-176.4	178.9	0	0	0	0	110.8	S37 A41 Q42 K43	S37-S39 VanDerWaalsContact C-N 3.28Å; S37-S39 PolarHBondContact OG-N 3.49Å; S39-A41 VanDerWaalsContact C-N 3.28Å; S39-A41 PolarHBondContact O-N 3.21Å; S39-Q42 PolarHBondContact O-N 2.93Å; S39-Q42 PolarHBondContact OG-N 2.92Å; S39-K43 PolarHBondContact O-N 3.33Å
40	Q	86.5	Confident	86.7	Confident	115 Å²	115	82.8 Å²	82.8	54%	0.537	44%	0.437	S	S	.	.	H	α-helix	trans	-58.8	-41	175.1	-178.2	60.8	15.1	0	0	111.8	Q42 K43 E44	Q40-Q42 VanDerWaalsContact C-N 3.29Å; Q40-Q42 PolarHBondContact O-N 3.28Å; Q40-K43 WeakPolarHBondContact O-CB 3.47Å; Q40-K43 PolarHBondContact O-N 2.92Å; Q40-K43 VanDerWaalsContact O-N 3.1Å; Q40-E44 WeakPolarHBondContact CG-OE1 3.35Å; Q40-E44 PolarHBondContact NE2-OE1 3.22Å; Q40-E44 WeakPolarHBondContact O-CG 3.47Å; Q40-E44 PolarHBondContact O-N 2.97Å
41	A	87.4	Confident	87.1	Confident	65 Å²	65	86.7 Å²	86.7	54%	0.537	45%	0.453	S	S	.	.	H	α-helix	trans	-60	-37.5	177.3	0	0	0	0	0	112.6	S39 L45	S39-A41 VanDerWaalsContact C-N 3.28Å; S39-A41 PolarHBondContact O-N 3.21Å; A41-L45 WeakPolarHBondContact O-CB 3.49Å; A41-L45 PolarHBondContact O-N 3.01Å
42	Q	85.6	Confident	87.4	Confident	94 Å²	94	89.9 Å²	89.9	44%	0.439	46%	0.46	S	S	.	.	H	α-helix	trans	-68.2	-39.5	176	-171.6	-176.2	-1.8	0	0	111.6	T33 S37 S39 Q40 L45 V46	T33-Q42 HydrophobicContact CG2-CG 4.27Å; S37-Q42 PolarHBondContact OG-OE1 3.36Å; S39-Q42 PolarHBondContact O-N 2.93Å; S39-Q42 PolarHBondContact OG-N 2.92Å; Q40-Q42 VanDerWaalsContact C-N 3.29Å; Q40-Q42 PolarHBondContact O-N 3.28Å; Q42-L45 PolarHBondContact O-N 3.39Å; Q42-V46 WeakPolarHBondContact O-CG2 2.79Å; Q42-V46 PolarHBondContact O-N 2.9Å
43	K	86.9	Confident	87.6	Confident	53 Å²	53	87.6 Å²	87.6	23%	0.23	46%	0.458	C	S	.	.	H	α-helix	trans	-63.8	-44	176.4	-63.6	-171.8	-172.8	-165.7	0	111.3	L34 S37 S39 Q40 V46 K47	L34-K43 HydrophobicContact CD2-CB 3.93Å; L34-K43 HydrophobicContact CD2-CG 4.38Å; L34-K43 VanDerWaalsContact O-CD 3.32Å; L34-K43 WeakPolarHBondContact O-CD 3.37Å; L34-K43 WeakPolarHBondContact O-CE 3.43Å; L34-K43 PolarHBondContact O-NZ 3.48Å; S37-K43 WeakPolarHBondContact O-CE 3.44Å; S37-K43 PolarHBondContact O-NZ 2.94Å; S39-K43 PolarHBondContact O-N 3.33Å; Q40-K43 WeakPolarHBondContact O-CB 3.47Å; Q40-K43 PolarHBondContact O-N 2.92Å; Q40-K43 VanDerWaalsContact O-N 3.1Å; K43-V46 PolarHBondContact O-N 3.31Å; K43-K47 WeakPolarHBondContact O-CB 3.48Å; K43-K47 PolarHBondContact O-N 3.16Å
44	E	88.5	Confident	87.9	Confident	106 Å²	106	94.8 Å²	94.8	50%	0.495	48%	0.484	S	S	.	.	H	α-helix	trans	-62.4	-45.4	177.6	-74.3	172	-170.8	0	0	111.4	Q40 V46 K47 E48	Q40-E44 WeakPolarHBondContact CG-OE1 3.35Å; Q40-E44 PolarHBondContact NE2-OE1 3.22Å; Q40-E44 WeakPolarHBondContact O-CG 3.47Å; Q40-E44 PolarHBondContact O-N 2.97Å; E44-V46 PolarHBondContact O-N 3.32Å; E44-K47 WeakPolarHBondContact O-CB 3.41Å; E44-K47 PolarHBondContact O-N 3.44Å; E44-E48 WeakPolarHBondContact O-CB 3.26Å; E44-E48 PolarHBondContact O-N 3.31Å
45	L	89.1	Confident	88.4	Confident	112 Å²	112	94.6 Å²	94.6	59%	0.586	49%	0.491	S	S	*	.	H	α-helix	trans	-61.5	-42.5	177	-173.8	150.8	0	0	0	112.5	A41 Q42 K49	A41-L45 WeakPolarHBondContact O-CB 3.49Å; A41-L45 PolarHBondContact O-N 3.01Å; Q42-L45 PolarHBondContact O-N 3.39Å; L45-K49 WeakPolarHBondContact O-CB 3.5Å; L45-K49 PolarHBondContact O-N 3.47Å
46	V	86.9	Confident	88.7	Confident	27 Å²	27	92 Å²	92	16%	0.164	48%	0.481	C	S	.	.	H	α-helix	trans	-66.6	-39.3	176.2	171.6	0	0	0	0	111.1	V30 T33 Q42 K43 E44 L50	V30-V46 HydrophobicContact CB-CG1 4.5Å; V30-V46 HydrophobicContact CG1-CG1 4.02Å; V30-V46 HydrophobicContact CG2-CG1 4.23Å; T33-V46 HydrophobicContact CG2-CG2 3.96Å; Q42-V46 WeakPolarHBondContact O-CG2 2.79Å; Q42-V46 PolarHBondContact O-N 2.9Å; K43-V46 PolarHBondContact O-N 3.31Å; E44-V46 PolarHBondContact O-N 3.32Å; V46-L50 WeakPolarHBondContact O-CB 3.49Å; V46-L50 PolarHBondContact O-N 3.3Å
47	K	87.9	Confident	89	Confident	114 Å²	114	91.9 Å²	91.9	50%	0.496	48%	0.48	S	S	.	.	H	α-helix	trans	-63.4	-49.3	176.1	-178.9	-177.4	169.4	-173.7	0	111.3	K43 E44 K49 L50 E51	K43-K47 WeakPolarHBondContact O-CB 3.48Å; K43-K47 PolarHBondContact O-N 3.16Å; E44-K47 WeakPolarHBondContact O-CB 3.41Å; E44-K47 PolarHBondContact O-N 3.44Å; K47-K49 VanDerWaalsContact C-N 3.34Å; K47-K49 PolarHBondContact O-N 3Å; K47-L50 PolarHBondContact O-N 3.42Å; K47-E51 WeakPolarHBondContact CE-OE1 3.4Å; K47-E51 HydrophobicContact CG-CG 4.48Å; K47-E51 IonicContact NZ-OE1 3.84Å; K47-E51 WeakPolarHBondContact O-CB 3.48Å; K47-E51 WeakPolarHBondContact O-CG 3.49Å; K47-E51 PolarHBondContact O-N 3.05Å
48	E	90.6	Very high	89.5	Confident	138 Å²	138	96.9 Å²	96.9	65%	0.645	50%	0.5	S	S	*	.	H	α-helix	trans	-60.6	-44.1	178.5	-173.4	-173.4	173.6	0	0	111.1	E44 L50 E51 K52	E44-E48 WeakPolarHBondContact O-CB 3.26Å; E44-E48 PolarHBondContact O-N 3.31Å; E48-L50 PolarHBondContact O-N 2.94Å; E48-E51 PolarHBondContact O-N 2.86Å; E48-K52 WeakPolarHBondContact O-CB 3.46Å; E48-K52 PolarHBondContact O-N 2.86Å
49	K	89.5	Confident	90.1	Very high	130 Å²	130	97.3 Å²	97.3	57%	0.565	49%	0.491	S	S	*	.	H	α-helix	trans	-60.4	-45.6	174.9	-175.6	179.4	177.8	-175.8	0	111.7	L45 K47 K52 D53	L45-K49 WeakPolarHBondContact O-CB 3.5Å; L45-K49 PolarHBondContact O-N 3.47Å; K47-K49 VanDerWaalsContact C-N 3.34Å; K47-K49 PolarHBondContact O-N 3Å; K49-K52 PolarHBondContact O-N 3.38Å; K49-D53 WeakPolarHBondContact O-CB 3.45Å; K49-D53 VanDerWaalsContact O-CG 3.27Å; K49-D53 PolarHBondContact O-N 3.42Å
50	L	88.4	Confident	90.4	Very high	72 Å²	72	99.4 Å²	99.4	38%	0.377	50%	0.501	S	S	.	.	H	α-helix	trans	-63.4	-43.2	178.5	-176.7	70.1	0	0	0	111.7	V30 V46 K47 E48 K52 D53 Y54	V30-L50 HydrophobicContact CG1-CD2 4.1Å; V46-L50 WeakPolarHBondContact O-CB 3.49Å; V46-L50 PolarHBondContact O-N 3.3Å; K47-L50 PolarHBondContact O-N 3.42Å; E48-L50 PolarHBondContact O-N 2.94Å; L50-K52 VanDerWaalsContact C-N 3.34Å; L50-D53 PolarHBondContact O-N 2.84Å; L50-Y54 WeakPolarHBondContact O-CB 3.5Å; L50-Y54 PolarHBondContact O-N 3.29Å
51	E	92.3	Very high	90.7	Very high	110 Å²	110	97.6 Å²	97.6	51%	0.514	50%	0.497	S	S	.	.	H	α-helix	trans	-62.8	-41.7	177.2	-75.1	176	174.1	0	0	111.2	K47 E48 Y54 A55	K47-E51 WeakPolarHBondContact CE-OE1 3.4Å; K47-E51 HydrophobicContact CG-CG 4.48Å; K47-E51 IonicContact NZ-OE1 3.84Å; K47-E51 WeakPolarHBondContact O-CB 3.48Å; K47-E51 WeakPolarHBondContact O-CG 3.49Å; K47-E51 PolarHBondContact O-N 3.05Å; E48-E51 PolarHBondContact O-N 2.86Å; E51-Y54 PolarHBondContact O-N 3.39Å; E51-A55 WeakPolarHBondContact O-CB 3.29Å; E51-A55 PolarHBondContact O-N 2.98Å
52	K	93.2	Very high	91.1	Very high	156 Å²	156	98.2 Å²	98.2	68%	0.678	49%	0.492	S	S	*	.	H	α-helix	trans	-63.7	-48	174.8	-175.3	178.7	-180	175.6	0	112.3	E48 K49 L50 Y54 A55 A56	E48-K52 WeakPolarHBondContact O-CB 3.46Å; E48-K52 PolarHBondContact O-N 2.86Å; K49-K52 PolarHBondContact O-N 3.38Å; L50-K52 VanDerWaalsContact C-N 3.34Å; K52-Y54 VanDerWaalsContact C-N 3.3Å; K52-Y54 PolarHBondContact O-N 2.89Å; K52-A55 PolarHBondContact O-N 3.2Å; K52-A56 WeakPolarHBondContact O-CB 3.25Å; K52-A56 PolarHBondContact O-N 3.49Å
53	D	90	Very high	91.4	Very high	83 Å²	83	99.7 Å²	99.7	44%	0.444	50%	0.498	S	S	.	.	H	α-helix	trans	-64.7	-37.4	178.9	-70.9	-13.1	0	0	0	111	K49 L50 T57	K49-D53 WeakPolarHBondContact O-CB 3.45Å; K49-D53 VanDerWaalsContact O-CG 3.27Å; K49-D53 PolarHBondContact O-N 3.42Å; L50-D53 PolarHBondContact O-N 2.84Å; D53-T57 WeakPolarHBondContact O-CB 3.46Å; D53-T57 PolarHBondContact O-N 2.93Å; D53-T57 PolarHBondContact O-OG1 3.45Å
54	Y	90.5	Very high	91.8	Very high	164 Å²	164	102.2 Å²	102.2	64%	0.643	51%	0.514	S	S	*	.	H	α-helix	trans	-66.1	-45.8	175	-178.3	-97	0	0	0	111.8	L50 E51 K52 A56 T57 K58	L50-Y54 WeakPolarHBondContact O-CB 3.5Å; L50-Y54 PolarHBondContact O-N 3.29Å; E51-Y54 PolarHBondContact O-N 3.39Å; K52-Y54 VanDerWaalsContact C-N 3.3Å; K52-Y54 PolarHBondContact O-N 2.89Å; Y54-A56 PolarHBondContact O-N 2.96Å; Y54-T57 PolarHBondContact O-N 3.39Å; Y54-K58 WeakPolarHBondContact O-CB 3.28Å; Y54-K58 PolarHBondContact O-N 3.39Å
55	A	94.5	Very high	92	Very high	55 Å²	55	101.2 Å²	101.2	46%	0.455	52%	0.515	S	S	.	.	H	α-helix	trans	-60.5	-44.9	176.7	0	0	0	0	0	111.7	E51 K52 T57 K58 E59	E51-A55 WeakPolarHBondContact O-CB 3.29Å; E51-A55 PolarHBondContact O-N 2.98Å; K52-A55 PolarHBondContact O-N 3.2Å; A55-T57 PolarHBondContact O-N 3.41Å; A55-K58 PolarHBondContact O-N 3.08Å; A55-E59 PolarHBondContact O-N 2.92Å
56	A	94	Very high	92.2	Very high	50 Å²	50	100.9 Å²	100.9	41%	0.413	51%	0.514	S	S	.	.	H	α-helix	trans	-62.7	-42	175.8	0	0	0	0	0	112.2	K52 Y54 E59 V60	K52-A56 WeakPolarHBondContact O-CB 3.25Å; K52-A56 PolarHBondContact O-N 3.49Å; Y54-A56 PolarHBondContact O-N 2.96Å; A56-E59 PolarHBondContact O-N 3.49Å; A56-V60 WeakPolarHBondContact O-CG2 3.29Å; A56-V60 PolarHBondContact O-N 3.41Å; A56-V60 VanDerWaalsContact O-N 3.13Å
57	T	92.5	Very high	92.4	Very high	87 Å²	87	102.3 Å²	102.3	53%	0.534	52%	0.522	S	S	.	.	H	α-helix	trans	-65.3	-41.8	177.2	-56.8	0	0	0	0	111.3	D53 Y54 A55 V60 V61	D53-T57 WeakPolarHBondContact O-CB 3.46Å; D53-T57 PolarHBondContact O-N 2.93Å; D53-T57 PolarHBondContact O-OG1 3.45Å; Y54-T57 PolarHBondContact O-N 3.39Å; A55-T57 PolarHBondContact O-N 3.41Å; T57-V60 PolarHBondContact O-N 3.48Å; T57-V61 HydrophobicContact CG2-CG2 4.42Å; T57-V61 WeakPolarHBondContact O-CG2 3.32Å; T57-V61 PolarHBondContact O-N 3.36Å
58	K	94.7	Very high	92.6	Very high	115 Å²	115	102.7 Å²	102.7	50%	0.5	53%	0.526	S	S	.	.	H	α-helix	trans	-59	-48.2	176.3	-179.4	-177.9	175.4	-172.6	0	110.9	Y54 A55 V60 V61 D62	Y54-K58 WeakPolarHBondContact O-CB 3.28Å; Y54-K58 PolarHBondContact O-N 3.39Å; A55-K58 PolarHBondContact O-N 3.08Å; K58-V60 VanDerWaalsContact C-N 3.32Å; K58-V60 PolarHBondContact O-N 2.91Å; K58-V61 PolarHBondContact O-N 3.19Å; K58-V61 VanDerWaalsContact O-N 3.15Å; K58-D62 WeakPolarHBondContact CE-OD2 3.34Å; K58-D62 WeakPolarHBondContact CG-OD2 3.44Å; K58-D62 WeakPolarHBondContact O-CB 3.49Å; K58-D62 VanDerWaalsContact O-CG 3.28Å; K58-D62 PolarHBondContact O-N 2.96Å
59	E	95.3	Very high	92.7	Very high	144 Å²	144	102.4 Å²	102.4	67%	0.673	52%	0.524	S	S	*	.	H	α-helix	trans	-58.5	-43	178.4	-172.4	-178.6	179.4	0	0	112.1	A55 A56 D62 H63	A55-E59 PolarHBondContact O-N 2.92Å; A56-E59 PolarHBondContact O-N 3.49Å; E59-D62 PolarHBondContact O-N 2.92Å; E59-H63 VanDerWaalsContact O-CB 3.29Å; E59-H63 WeakPolarHBondContact O-CB 3.43Å; E59-H63 PolarHBondContact O-N 3.04Å
60	V	94	Very high	92.9	Very high	98 Å²	98	102.2 Å²	102.2	59%	0.594	53%	0.525	S	S	*	.	H	α-helix	trans	-64.8	-41.1	176.2	173.6	0	0	0	0	111.8	A56 T57 K58 L64	A56-V60 WeakPolarHBondContact O-CG2 3.29Å; A56-V60 PolarHBondContact O-N 3.41Å; A56-V60 VanDerWaalsContact O-N 3.13Å; T57-V60 PolarHBondContact O-N 3.48Å; K58-V60 VanDerWaalsContact C-N 3.32Å; K58-V60 PolarHBondContact O-N 2.91Å; V60-L64 VanDerWaalsContact O-CB 3.3Å; V60-L64 WeakPolarHBondContact O-CB 3.44Å; V60-L64 PolarHBondContact O-N 3.31Å
61	V	93.6	Very high	93.2	Very high	76 Å²	76	103.9 Å²	103.9	46%	0.461	54%	0.535	S	S	.	.	H	α-helix	trans	-66.6	-47.7	178	169.7	0	0	0	0	110.6	T57 K58 H63 L64 V65	T57-V61 HydrophobicContact CG2-CG2 4.42Å; T57-V61 WeakPolarHBondContact O-CG2 3.32Å; T57-V61 PolarHBondContact O-N 3.36Å; K58-V61 PolarHBondContact O-N 3.19Å; K58-V61 VanDerWaalsContact O-N 3.15Å; V61-H63 VanDerWaalsContact C-N 3.32Å; V61-H63 PolarHBondContact O-N 3.41Å; V61-L64 PolarHBondContact O-N 3.46Å; V61-V65 HydrophobicContact CG1-CG2 4.29Å; V61-V65 WeakPolarHBondContact O-CB 3.39Å; V61-V65 VanDerWaalsContact O-CG2 3.27Å; V61-V65 WeakPolarHBondContact O-CG2 3.35Å; V61-V65 PolarHBondContact O-N 3.34Å
62	D	95	Very high	93.3	Very high	78 Å²	78	102.2 Å²	102.2	42%	0.417	53%	0.532	S	S	.	.	H	α-helix	trans	-59.1	-46.8	178.7	-69.9	-15.8	0	0	0	109.7	K58 E59 L64 V65 D66	K58-D62 WeakPolarHBondContact CE-OD2 3.34Å; K58-D62 WeakPolarHBondContact CG-OD2 3.44Å; K58-D62 WeakPolarHBondContact O-CB 3.49Å; K58-D62 VanDerWaalsContact O-CG 3.28Å; K58-D62 PolarHBondContact O-N 2.96Å; E59-D62 PolarHBondContact O-N 2.92Å; D62-L64 PolarHBondContact O-N 3.43Å; D62-V65 PolarHBondContact O-N 2.8Å; D62-D66 PolarHBondContact O-N 2.99Å
63	H	93	Very high	93.4	Very high	125 Å²	125	97 Å²	97	58%	0.579	52%	0.517	S	S	*	.	H	α-helix	trans	-60.4	-43.6	175.3	-177.3	60.4	0	0	0	113	E59 V61 V65 D66 V67	E59-H63 VanDerWaalsContact O-CB 3.29Å; E59-H63 WeakPolarHBondContact O-CB 3.43Å; E59-H63 PolarHBondContact O-N 3.04Å; V61-H63 VanDerWaalsContact C-N 3.32Å; V61-H63 PolarHBondContact O-N 3.41Å; H63-V65 VanDerWaalsContact C-N 3.33Å; H63-V65 PolarHBondContact O-N 3.17Å; H63-D66 PolarHBondContact O-N 2.88Å; H63-V67 VanDerWaalsContact CE1-CG2 3.49Å; H63-V67 WeakPolarHBondContact CE1-CG2 3.37Å; H63-V67 WeakPolarHBondContact O-CB 3.28Å; H63-V67 VanDerWaalsContact O-CG2 3.32Å; H63-V67 WeakPolarHBondContact O-CG2 3.47Å; H63-V67 PolarHBondContact O-N 3.41Å
64	L	94	Very high	93.7	Very high	107 Å²	107	96.5 Å²	96.5	56%	0.56	52%	0.517	S	S	*	.	H	α-helix	trans	-66.1	-37.2	178.7	-175.9	63.8	0	0	0	111.7	V60 V61 D62 Q68	V60-L64 VanDerWaalsContact O-CB 3.3Å; V60-L64 WeakPolarHBondContact O-CB 3.44Å; V60-L64 PolarHBondContact O-N 3.31Å; V61-L64 PolarHBondContact O-N 3.46Å; D62-L64 PolarHBondContact O-N 3.43Å; L64-Q68 WeakPolarHBondContact O-CB 3.27Å; L64-Q68 PolarHBondContact O-N 2.89Å
65	V	93.2	Very high	94	Very high	84 Å²	84	91.5 Å²	91.5	51%	0.509	51%	0.51	S	S	.	.	H	α-helix	trans	-64.8	-45.9	175.6	168.9	0	0	0	0	110.3	V61 D62 H63 Q68 H69	V61-V65 HydrophobicContact CG1-CG2 4.29Å; V61-V65 WeakPolarHBondContact O-CB 3.39Å; V61-V65 VanDerWaalsContact O-CG2 3.27Å; V61-V65 WeakPolarHBondContact O-CG2 3.35Å; V61-V65 PolarHBondContact O-N 3.34Å; D62-V65 PolarHBondContact O-N 2.8Å; H63-V65 VanDerWaalsContact C-N 3.33Å; H63-V65 PolarHBondContact O-N 3.17Å; V65-Q68 PolarHBondContact O-N 3Å; V65-H69 VanDerWaalsContact O-CB 3.24Å; V65-H69 WeakPolarHBondContact O-CB 3.28Å; V65-H69 PolarHBondContact O-N 3.48Å
66	D	93	Very high	94.1	Very high	106 Å²	106	92.8 Å²	92.8	57%	0.567	51%	0.509	S	S	*	.	H	α-helix	trans	-63.4	-49.7	179.6	-71.6	-17.3	0	0	0	111.6	D62 H63 Q68 H69 E70	D62-D66 PolarHBondContact O-N 2.99Å; H63-D66 PolarHBondContact O-N 2.88Å; D66-Q68 PolarHBondContact O-N 3.4Å; D66-H69 WeakPolarHBondContact O-CB 3.23Å; D66-H69 PolarHBondContact O-N 3.35Å; D66-E70 PolarHBondContact O-N 2.8Å
67	V	91	Very high	94.3	Very high	57 Å²	57	97 Å²	97	35%	0.345	52%	0.52	S	S	.	.	H	α-helix	trans	-62.5	-45.6	178.4	172.4	0	0	0	0	111.1	H63 H69 E70 D71	H63-V67 VanDerWaalsContact CE1-CG2 3.49Å; H63-V67 WeakPolarHBondContact CE1-CG2 3.37Å; H63-V67 WeakPolarHBondContact O-CB 3.28Å; H63-V67 VanDerWaalsContact O-CG2 3.32Å; H63-V67 WeakPolarHBondContact O-CG2 3.47Å; H63-V67 PolarHBondContact O-N 3.41Å; V67-H69 VanDerWaalsContact C-N 3.25Å; V67-H69 PolarHBondContact O-N 3.17Å; V67-E70 PolarHBondContact O-N 2.93Å; V67-D71 WeakPolarHBondContact O-CB 3.39Å; V67-D71 PolarHBondContact O-N 2.94Å
68	Q	93.1	Very high	94.6	Very high	122 Å²	122	96 Å²	96	57%	0.57	52%	0.517	S	S	*	.	H	α-helix	trans	-64.3	-34.5	178.8	-170.6	-179.6	-75.6	0	0	111.5	L64 V65 D66 V72	L64-Q68 WeakPolarHBondContact O-CB 3.27Å; L64-Q68 PolarHBondContact O-N 2.89Å; V65-Q68 PolarHBondContact O-N 3Å; D66-Q68 PolarHBondContact O-N 3.4Å; Q68-V72 HydrophobicContact CG-CG2 4.33Å; Q68-V72 VanDerWaalsContact O-CB 3.31Å; Q68-V72 WeakPolarHBondContact O-CB 3.48Å; Q68-V72 WeakPolarHBondContact O-CG2 3.45Å; Q68-V72 PolarHBondContact O-N 3.31Å
69	H	92.9	Very high	94.8	Very high	131 Å²	131	97.2 Å²	97.2	61%	0.606	52%	0.522	S	S	*	.	H	α-helix	trans	-65.2	-46.9	175.8	-175.8	-85.1	0	0	0	111.5	V65 D66 V67 V72 A73	V65-H69 VanDerWaalsContact O-CB 3.24Å; V65-H69 WeakPolarHBondContact O-CB 3.28Å; V65-H69 PolarHBondContact O-N 3.48Å; D66-H69 WeakPolarHBondContact O-CB 3.23Å; D66-H69 PolarHBondContact O-N 3.35Å; V67-H69 VanDerWaalsContact C-N 3.25Å; V67-H69 PolarHBondContact O-N 3.17Å; H69-V72 PolarHBondContact O-N 3.16Å; H69-A73 VanDerWaalsContact O-CB 3.29Å; H69-A73 WeakPolarHBondContact O-CB 3.25Å; H69-A73 PolarHBondContact O-N 3.47Å
70	E	93.2	Very high	94.9	Very high	126 Å²	126	98.5 Å²	98.5	59%	0.589	52%	0.521	S	S	*	.	H	α-helix	trans	-59.1	-46.9	175.2	-75.6	-74.4	142.5	0	0	112.2	D66 V67 A73 T74	D66-E70 PolarHBondContact O-N 2.8Å; V67-E70 PolarHBondContact O-N 2.93Å; E70-A73 PolarHBondContact O-N 2.96Å; E70-T74 WeakPolarHBondContact O-CB 3.39Å; E70-T74 PolarHBondContact O-N 3.5Å; E70-T74 PolarHBondContact O-OG1 3.31Å
71	D	94.2	Very high	95.1	Very high	108 Å²	108	102.4 Å²	102.4	58%	0.578	53%	0.525	S	S	*	.	H	α-helix	trans	-62.9	-45	179.2	-78	-18.7	0	0	0	111.7	V67 T74 A75	V67-D71 WeakPolarHBondContact O-CB 3.39Å; V67-D71 PolarHBondContact O-N 2.94Å; D71-T74 PolarHBondContact O-N 3.19Å; D71-A75 VanDerWaalsContact O-CB 3.29Å; D71-A75 WeakPolarHBondContact O-CB 3.41Å; D71-A75 PolarHBondContact O-N 3Å
72	V	94.9	Very high	95.4	Very high	75 Å²	75	102.8 Å²	102.8	46%	0.455	53%	0.527	S	S	.	.	H	α-helix	trans	-65.7	-41.6	177.9	169.9	0	0	0	0	110.9	Q68 H69 A75 L76	Q68-V72 HydrophobicContact CG-CG2 4.33Å; Q68-V72 VanDerWaalsContact O-CB 3.31Å; Q68-V72 WeakPolarHBondContact O-CB 3.48Å; Q68-V72 WeakPolarHBondContact O-CG2 3.45Å; Q68-V72 PolarHBondContact O-N 3.31Å; H69-V72 PolarHBondContact O-N 3.16Å; V72-A75 PolarHBondContact O-N 2.88Å; V72-L76 HydrophobicContact CG1-CD1 3.9Å; V72-L76 HydrophobicContact CG1-CG 4.35Å; V72-L76 WeakPolarHBondContact O-CB 3.29Å; V72-L76 VanDerWaalsContact O-CG 3.3Å; V72-L76 WeakPolarHBondContact O-CG 3.33Å; V72-L76 PolarHBondContact O-N 3.34Å
73	A	95.3	Very high	95.5	Very high	45 Å²	45	101.4 Å²	101.4	37%	0.372	52%	0.523	S	S	.	.	H	α-helix	trans	-60.9	-46	176.6	0	0	0	0	0	111.3	H69 E70 L76 Q77	H69-A73 VanDerWaalsContact O-CB 3.29Å; H69-A73 WeakPolarHBondContact O-CB 3.25Å; H69-A73 PolarHBondContact O-N 3.47Å; E70-A73 PolarHBondContact O-N 2.96Å; A73-L76 PolarHBondContact O-N 2.95Å; A73-Q77 WeakPolarHBondContact O-CB 3.35Å; A73-Q77 PolarHBondContact O-N 3.24Å
74	T	96.2	Very high	95.8	Very high	73 Å²	73	99.5 Å²	99.5	45%	0.448	52%	0.521	S	S	.	.	H	α-helix	trans	-63.9	-43.4	177.7	-59.4	0	0	0	0	111.8	E70 D71 Q77 S78	E70-T74 WeakPolarHBondContact O-CB 3.39Å; E70-T74 PolarHBondContact O-N 3.5Å; E70-T74 PolarHBondContact O-OG1 3.31Å; D71-T74 PolarHBondContact O-N 3.19Å; T74-Q77 PolarHBondContact O-N 3.35Å; T74-S78 WeakPolarHBondContact O-CB 3.45Å; T74-S78 PolarHBondContact O-N 2.96Å; T74-S78 PolarHBondContact O-OG 2.89Å
75	A	96.5	Very high	96	Very high	59 Å²	59	98.5 Å²	98.5	49%	0.488	52%	0.516	S	S	.	.	H	α-helix	trans	-63	-43.4	176.4	0	0	0	0	0	111.7	D71 V72 S78 F79	D71-A75 VanDerWaalsContact O-CB 3.29Å; D71-A75 WeakPolarHBondContact O-CB 3.41Å; D71-A75 PolarHBondContact O-N 3Å; V72-A75 PolarHBondContact O-N 2.88Å; A75-S78 PolarHBondContact O-N 3.38Å; A75-F79 WeakPolarHBondContact O-CB 3.3Å; A75-F79 PolarHBondContact O-N 3.46Å
76	L	97.4	Very high	96.3	Very high	83 Å²	83	98.2 Å²	98.2	44%	0.435	51%	0.514	S	S	.	.	H	α-helix	trans	-64.3	-41.7	176	-77.5	171.6	0	0	0	112.1	V72 A73 F79 R80	V72-L76 HydrophobicContact CG1-CD1 3.9Å; V72-L76 HydrophobicContact CG1-CG 4.35Å; V72-L76 WeakPolarHBondContact O-CB 3.29Å; V72-L76 VanDerWaalsContact O-CG 3.3Å; V72-L76 WeakPolarHBondContact O-CG 3.33Å; V72-L76 PolarHBondContact O-N 3.34Å; A73-L76 PolarHBondContact O-N 2.95Å; L76-F79 PolarHBondContact O-N 3.5Å; L76-R80 WeakPolarHBondContact O-CB 3.47Å; L76-R80 VanDerWaalsContact O-CG 3.25Å; L76-R80 WeakPolarHBondContact O-CG 3.24Å; L76-R80 PolarHBondContact O-N 2.79Å
77	Q	98.1	Very high	96.5	Very high	139 Å²	139	97.4 Å²	97.4	65%	0.65	51%	0.507	S	S	*	.	H	α-helix	trans	-62	-45.1	176.2	-173.7	179.9	9.4	0	0	111.2	A73 T74 R80 R81	A73-Q77 WeakPolarHBondContact O-CB 3.35Å; A73-Q77 PolarHBondContact O-N 3.24Å; T74-Q77 PolarHBondContact O-N 3.35Å; Q77-R80 PolarHBondContact O-N 2.87Å; Q77-R81 PolarHBondContact O-N 2.91Å
78	S	98	Very high	96.9	Very high	65 Å²	65	97.8 Å²	97.8	46%	0.455	51%	0.51	S	S	.	.	H	α-helix	trans	-61.6	-45.4	176.3	-60.5	0	0	0	0	111.5	T74 A75 R80 R81 V82	T74-S78 WeakPolarHBondContact O-CB 3.45Å; T74-S78 PolarHBondContact O-N 2.96Å; T74-S78 PolarHBondContact O-OG 2.89Å; A75-S78 PolarHBondContact O-N 3.38Å; S78-R80 PolarHBondContact O-N 3.34Å; S78-R81 PolarHBondContact O-N 2.89Å; S78-V82 WeakPolarHBondContact O-CG2 3.29Å; S78-V82 PolarHBondContact O-N 3.3Å
79	F	98.1	Very high	97.2	Very high	140 Å²	140	94.2 Å²	94.2	61%	0.614	50%	0.501	S	S	*	.	H	α-helix	trans	-61.3	-42.6	176.6	178.8	-98.4	0	0	0	112.6	A75 L76 V82 S83	A75-F79 WeakPolarHBondContact O-CB 3.3Å; A75-F79 PolarHBondContact O-N 3.46Å; L76-F79 PolarHBondContact O-N 3.5Å; F79-V82 PolarHBondContact O-N 2.91Å; F79-S83 VanDerWaalsContact O-CB 3.28Å; F79-S83 WeakPolarHBondContact O-CB 3.31Å; F79-S83 PolarHBondContact O-N 2.95Å; F79-S83 PolarHBondContact O-OG 2.93Å
80	R	98.5	Very high	97.4	Very high	172 Å²	172	95.9 Å²	95.9	65%	0.649	50%	0.502	S	S	*	.	H	α-helix	trans	-60	-49.3	175.7	-75.7	172.4	-176.1	177.3	3.1	110.8	L76 Q77 S78 V82 S83 T84	L76-R80 WeakPolarHBondContact O-CB 3.47Å; L76-R80 VanDerWaalsContact O-CG 3.25Å; L76-R80 WeakPolarHBondContact O-CG 3.24Å; L76-R80 PolarHBondContact O-N 2.79Å; Q77-R80 PolarHBondContact O-N 2.87Å; S78-R80 PolarHBondContact O-N 3.34Å; R80-V82 PolarHBondContact O-N 3.37Å; R80-S83 PolarHBondContact O-N 3.41Å; R80-T84 PolarHBondContact O-N 2.9Å; R80-T84 PolarHBondContact O-OG1 2.88Å
81	R	98.4	Very high	97.7	Very high	180 Å²	180	95.1 Å²	95.1	68%	0.679	50%	0.498	S	S	*	.	H	α-helix	trans	-57.3	-51.9	177.6	179.6	-179	172.8	-177.3	0.9	111.6	Q77 S78 S83 T84 D85	Q77-R81 PolarHBondContact O-N 2.91Å; S78-R81 PolarHBondContact O-N 2.89Å; R81-S83 VanDerWaalsContact C-N 3.28Å; R81-S83 PolarHBondContact O-N 3.38Å; R81-T84 PolarHBondContact O-N 2.88Å; R81-D85 IonicContact NE-OD2 2.75Å; R81-D85 PolarHBondContact O-N 3.12Å
82	V	98.5	Very high	97.9	Very high	84 Å²	84	97.6 Å²	97.6	51%	0.509	50%	0.499	S	S	.	.	H	α-helix	trans	-60.5	-40.6	179.4	172.4	0	0	0	0	110.9	S78 F79 R80 T84 D85 V86	S78-V82 WeakPolarHBondContact O-CG2 3.29Å; S78-V82 PolarHBondContact O-N 3.3Å; F79-V82 PolarHBondContact O-N 2.91Å; R80-V82 PolarHBondContact O-N 3.37Å; V82-T84 PolarHBondContact O-N 3.35Å; V82-D85 PolarHBondContact O-N 2.82Å; V82-V86 HydrophobicContact CG1-CG2 4.27Å; V82-V86 WeakPolarHBondContact O-CB 3.5Å; V82-V86 VanDerWaalsContact O-CG2 3.23Å; V82-V86 WeakPolarHBondContact O-CG2 3.49Å; V82-V86 PolarHBondContact O-N 2.83Å
83	S	98.6	Very high	98.1	Very high	48 Å²	48	98.4 Å²	98.4	34%	0.336	50%	0.5	S	S	.	.	H	α-helix	trans	-62.6	-43.2	177.2	-62.8	0	0	0	0	112.2	F79 R80 R81 Q87	F79-S83 VanDerWaalsContact O-CB 3.28Å; F79-S83 WeakPolarHBondContact O-CB 3.31Å; F79-S83 PolarHBondContact O-N 2.95Å; F79-S83 PolarHBondContact O-OG 2.93Å; R80-S83 PolarHBondContact O-N 3.41Å; R81-S83 VanDerWaalsContact C-N 3.28Å; R81-S83 PolarHBondContact O-N 3.38Å; S83-Q87 WeakPolarHBondContact O-CB 3.32Å; S83-Q87 PolarHBondContact O-N 2.94Å
84	T	98.5	Very high	98.2	Very high	86 Å²	86	103.1 Å²	103.1	53%	0.528	51%	0.512	S	S	.	.	H	α-helix	trans	-64.5	-43.4	175	-60.8	0	0	0	0	111.8	R80 R81 V82 Q87 T88	R80-T84 PolarHBondContact O-N 2.9Å; R80-T84 PolarHBondContact O-OG1 2.88Å; R81-T84 PolarHBondContact O-N 2.88Å; V82-T84 PolarHBondContact O-N 3.35Å; T84-Q87 PolarHBondContact O-N 2.89Å; T84-T88 WeakPolarHBondContact O-CB 3.11Å; T84-T88 PolarHBondContact O-N 3.4Å; T84-T88 PolarHBondContact O-OG1 3.29Å
85	D	98.6	Very high	98.4	Very high	86 Å²	86	104.8 Å²	104.8	46%	0.46	52%	0.516	S	S	.	.	H	α-helix	trans	-62.8	-44.4	178.3	-71	-17.3	0	0	0	110.9	R81 V82 T88 A89	R81-D85 IonicContact NE-OD2 2.75Å; R81-D85 PolarHBondContact O-N 3.12Å; V82-D85 PolarHBondContact O-N 2.82Å; D85-T88 PolarHBondContact O-N 3.05Å; D85-A89 WeakPolarHBondContact O-CB 3.15Å; D85-A89 PolarHBondContact O-N 3.44Å
86	V	98.6	Very high	98.5	Very high	77 Å²	77	106.7 Å²	106.7	47%	0.467	52%	0.517	S	S	.	.	H	α-helix	trans	-62.3	-44.8	175.6	168.7	0	0	0	0	111	V82 A89 R90	V82-V86 HydrophobicContact CG1-CG2 4.27Å; V82-V86 WeakPolarHBondContact O-CB 3.5Å; V82-V86 VanDerWaalsContact O-CG2 3.23Å; V82-V86 WeakPolarHBondContact O-CG2 3.49Å; V82-V86 PolarHBondContact O-N 2.83Å; V86-A89 PolarHBondContact O-N 3.35Å; V86-R90 HydrophobicContact CG1-CG 4.5Å; V86-R90 VanDerWaalsContact O-CG 3.27Å; V86-R90 WeakPolarHBondContact O-CG 3.46Å; V86-R90 PolarHBondContact O-N 2.98Å
87	Q	98.5	Very high	98.5	Very high	90 Å²	90	109.2 Å²	109.2	42%	0.421	53%	0.525	S	S	.	.	H	α-helix	trans	-62	-47.1	178.3	-178.8	58.1	23.1	0	0	111.3	S83 T84 A89 R90 E91	S83-Q87 WeakPolarHBondContact O-CB 3.32Å; S83-Q87 PolarHBondContact O-N 2.94Å; T84-Q87 PolarHBondContact O-N 2.89Å; Q87-A89 VanDerWaalsContact C-N 3.32Å; Q87-A89 PolarHBondContact O-N 2.9Å; Q87-R90 WeakPolarHBondContact O-CB 3.48Å; Q87-R90 PolarHBondContact O-N 3.34Å; Q87-R90 VanDerWaalsContact O-N 3.16Å; Q87-E91 PolarHBondContact NE2-OE1 2.92Å; Q87-E91 WeakPolarHBondContact O-CG 3.37Å; Q87-E91 PolarHBondContact O-N 2.95Å
88	T	98.6	Very high	98.5	Very high	65 Å²	65	106.8 Å²	106.8	40%	0.399	52%	0.516	S	S	.	.	H	α-helix	trans	-59.7	-43.5	177	-55.3	0	0	0	0	111.2	T84 D85 R90 E91 R92	T84-T88 WeakPolarHBondContact O-CB 3.11Å; T84-T88 PolarHBondContact O-N 3.4Å; T84-T88 PolarHBondContact O-OG1 3.29Å; D85-T88 PolarHBondContact O-N 3.05Å; T88-R90 PolarHBondContact O-N 3.49Å; T88-E91 PolarHBondContact O-N 3.01Å; T88-R92 WeakPolarHBondContact O-CG 3.27Å; T88-R92 PolarHBondContact O-N 3.22Å
89	A	98.7	Very high	98.6	Very high	46 Å²	46	108.1 Å²	108.1	38%	0.38	52%	0.518	S	S	.	.	H	α-helix	trans	-62	-42.5	176.5	0	0	0	0	0	111.9	D85 V86 Q87 E91 R92 I93	D85-A89 WeakPolarHBondContact O-CB 3.15Å; D85-A89 PolarHBondContact O-N 3.44Å; V86-A89 PolarHBondContact O-N 3.35Å; Q87-A89 VanDerWaalsContact C-N 3.32Å; Q87-A89 PolarHBondContact O-N 2.9Å; A89-E91 PolarHBondContact O-N 2.99Å; A89-R92 PolarHBondContact O-N 3.49Å; A89-I93 VanDerWaalsContact O-CG1 3.28Å; A89-I93 WeakPolarHBondContact O-CG1 3.48Å; A89-I93 PolarHBondContact O-N 2.86Å
90	R	98.7	Very high	98.6	Very high	167 Å²	167	106.2 Å²	106.2	63%	0.63	51%	0.514	S	S	*	.	H	α-helix	trans	-62.2	-42.2	177	-72	173.3	73.7	167.3	4.2	112	V86 Q87 T88 I93 K94	V86-R90 HydrophobicContact CG1-CG 4.5Å; V86-R90 VanDerWaalsContact O-CG 3.27Å; V86-R90 WeakPolarHBondContact O-CG 3.46Å; V86-R90 PolarHBondContact O-N 2.98Å; Q87-R90 WeakPolarHBondContact O-CB 3.48Å; Q87-R90 PolarHBondContact O-N 3.34Å; Q87-R90 VanDerWaalsContact O-N 3.16Å; T88-R90 PolarHBondContact O-N 3.49Å; R90-I93 PolarHBondContact O-N 3.41Å; R90-K94 PolarHBondContact O-N 3.27Å
91	E	98.6	Very high	98.6	Very high	109 Å²	109	101.3 Å²	101.3	51%	0.509	51%	0.506	S	S	.	.	H	α-helix	trans	-64.3	-44.7	176.3	-72.7	171.9	-169.4	0	0	111.7	Q87 T88 A89 I93 K94 M95	Q87-E91 PolarHBondContact NE2-OE1 2.92Å; Q87-E91 WeakPolarHBondContact O-CG 3.37Å; Q87-E91 PolarHBondContact O-N 2.95Å; T88-E91 PolarHBondContact O-N 3.01Å; A89-E91 PolarHBondContact O-N 2.99Å; E91-I93 VanDerWaalsContact C-N 3.35Å; E91-I93 PolarHBondContact O-N 2.95Å; E91-K94 WeakPolarHBondContact O-CB 3.29Å; E91-K94 PolarHBondContact O-N 3.38Å; E91-K94 VanDerWaalsContact O-N 3.17Å; E91-M95 PolarHBondContact O-N 3.5Å
92	R	98.6	Very high	98.6	Very high	160 Å²	160	95.8 Å²	95.8	60%	0.604	50%	0.495	S	S	*	.	H	α-helix	trans	-59.3	-44.3	174.6	-72.9	175.7	67.6	178.2	1.8	112	T88 A89 K94 M95 I96	T88-R92 WeakPolarHBondContact O-CG 3.27Å; T88-R92 PolarHBondContact O-N 3.22Å; A89-R92 PolarHBondContact O-N 3.49Å; R92-K94 VanDerWaalsContact C-N 3.33Å; R92-K94 PolarHBondContact O-N 3.49Å; R92-M95 PolarHBondContact O-N 3.23Å; R92-I96 VanDerWaalsContact O-CG1 3.28Å; R92-I96 WeakPolarHBondContact O-CG1 3.33Å; R92-I96 PolarHBondContact O-N 3.38Å
93	I	98.7	Very high	98.6	Very high	92 Å²	92	95 Å²	95	47%	0.472	49%	0.492	S	S	.	.	H	α-helix	trans	-60.4	-44.3	176	-70.8	164.5	0	0	0	110.6	A89 R90 E91 M95 I96 K97	A89-I93 VanDerWaalsContact O-CG1 3.28Å; A89-I93 WeakPolarHBondContact O-CG1 3.48Å; A89-I93 PolarHBondContact O-N 2.86Å; R90-I93 PolarHBondContact O-N 3.41Å; E91-I93 VanDerWaalsContact C-N 3.35Å; E91-I93 PolarHBondContact O-N 2.95Å; I93-M95 PolarHBondContact O-N 2.81Å; I93-I96 PolarHBondContact O-N 3.15Å; I93-K97 HydrophobicContact CG2-CD 4.14Å; I93-K97 HydrophobicContact CG2-CG 4.44Å; I93-K97 WeakPolarHBondContact O-CB 3.36Å; I93-K97 WeakPolarHBondContact O-CG 3.43Å; I93-K97 PolarHBondContact O-N 3.19Å
94	K	98.6	Very high	98.6	Very high	145 Å²	145	96.8 Å²	96.8	63%	0.63	50%	0.496	S	S	*	.	H	α-helix	trans	-60.3	-45.8	177.6	-173.3	-179.3	-179.9	-176.7	0	111.3	R90 E91 R92 K97 N98	R90-K94 PolarHBondContact O-N 3.27Å; E91-K94 WeakPolarHBondContact O-CB 3.29Å; E91-K94 PolarHBondContact O-N 3.38Å; E91-K94 VanDerWaalsContact O-N 3.17Å; R92-K94 VanDerWaalsContact C-N 3.33Å; R92-K94 PolarHBondContact O-N 3.49Å; K94-K97 PolarHBondContact O-N 3.45Å; K94-N98 VanDerWaalsContact O-CG 3.29Å; K94-N98 PolarHBondContact O-N 3.15Å
95	M	98.6	Very high	98.6	Very high	108 Å²	108	97.9 Å²	97.9	53%	0.532	50%	0.498	S	S	.	.	H	α-helix	trans	-60.9	-48.4	176.9	-176.8	-179.4	67.6	0	0	111.9	E91 R92 I93 K97 N98 N99	E91-M95 PolarHBondContact O-N 3.5Å; R92-M95 PolarHBondContact O-N 3.23Å; I93-M95 PolarHBondContact O-N 2.81Å; M95-K97 VanDerWaalsContact C-N 3.33Å; M95-K97 PolarHBondContact O-N 2.95Å; M95-N98 PolarHBondContact O-N 2.93Å; M95-N99 PolarHBondContact O-N 3.13Å; M95-N99 PolarHBondContact O-OD1 2.85Å
96	I	98.8	Very high	98.6	Very high	99 Å²	99	99.4 Å²	99.4	51%	0.508	51%	0.505	S	S	.	.	H	α-helix	trans	-60.3	-43.5	178.5	-68.6	165.6	0	0	0	110.9	R92 I93 N98 N99 L100	R92-I96 VanDerWaalsContact O-CG1 3.28Å; R92-I96 WeakPolarHBondContact O-CG1 3.33Å; R92-I96 PolarHBondContact O-N 3.38Å; I93-I96 PolarHBondContact O-N 3.15Å; I96-N98 VanDerWaalsContact C-N 3.34Å; I96-N98 PolarHBondContact O-N 2.93Å; I96-N99 PolarHBondContact O-N 3.33Å; I96-L100 WeakPolarHBondContact O-CB 3.3Å; I96-L100 PolarHBondContact O-N 3.27Å
97	K	98.7	Very high	98.6	Very high	135 Å²	135	101.6 Å²	101.6	59%	0.587	51%	0.513	S	S	*	.	H	α-helix	trans	-58.5	-45.4	175.9	-78	-179.3	173.9	-175.2	0	111.7	I93 K94 M95 L100 S101	I93-K97 HydrophobicContact CG2-CD 4.14Å; I93-K97 HydrophobicContact CG2-CG 4.44Å; I93-K97 WeakPolarHBondContact O-CB 3.36Å; I93-K97 WeakPolarHBondContact O-CG 3.43Å; I93-K97 PolarHBondContact O-N 3.19Å; K94-K97 PolarHBondContact O-N 3.45Å; M95-K97 VanDerWaalsContact C-N 3.33Å; M95-K97 PolarHBondContact O-N 2.95Å; K97-L100 PolarHBondContact O-N 2.95Å; K97-S101 PolarHBondContact O-N 2.8Å; K97-S101 PolarHBondContact O-OG 3.35Å; K97-S101 VanDerWaalsContact O-OG 3.08Å
98	N	98.7	Very high	98.6	Very high	89 Å²	89	103.9 Å²	103.9	48%	0.476	52%	0.518	S	S	.	.	H	α-helix	trans	-64.1	-42.3	178.3	-69.7	-9.5	0	0	0	112.1	K94 M95 I96 S101 S102	K94-N98 VanDerWaalsContact O-CG 3.29Å; K94-N98 PolarHBondContact O-N 3.15Å; M95-N98 PolarHBondContact O-N 2.93Å; I96-N98 VanDerWaalsContact C-N 3.34Å; I96-N98 PolarHBondContact O-N 2.93Å; N98-S101 PolarHBondContact O-N 3.43Å; N98-S102 WeakPolarHBondContact O-CB 3.41Å; N98-S102 PolarHBondContact O-N 3Å; N98-S102 PolarHBondContact O-OG 2.88Å
99	N	98.7	Very high	98.6	Very high	92 Å²	92	104.1 Å²	104.1	49%	0.492	52%	0.522	S	S	.	.	H	α-helix	trans	-62.9	-44.8	176.8	-69.3	-5.5	0	0	0	111	M95 I96 S101 S102 C103	M95-N99 PolarHBondContact O-N 3.13Å; M95-N99 PolarHBondContact O-OD1 2.85Å; I96-N99 PolarHBondContact O-N 3.33Å; N99-S101 PolarHBondContact O-N 3.49Å; N99-S102 WeakPolarHBondContact O-CB 3.33Å; N99-S102 PolarHBondContact O-N 3.34Å; N99-C103 PolarHBondContact O-N 3.41Å; N99-C103 PolarHBondContact O-SG 2.92Å
100	L	98.7	Very high	98.6	Very high	100 Å²	100	107.8 Å²	107.8	52%	0.524	53%	0.529	S	S	.	.	H	α-helix	trans	-62.4	-44.6	177.7	-177.2	61.4	0	0	0	111.7	I96 K97 S102 C103 Q104	I96-L100 WeakPolarHBondContact O-CB 3.3Å; I96-L100 PolarHBondContact O-N 3.27Å; K97-L100 PolarHBondContact O-N 2.95Å; L100-S102 VanDerWaalsContact C-N 3.28Å; L100-S102 PolarHBondContact O-N 3.24Å; L100-C103 PolarHBondContact O-N 2.89Å; L100-Q104 WeakPolarHBondContact O-CB 3.38Å; L100-Q104 VanDerWaalsContact O-CG 3.29Å; L100-Q104 WeakPolarHBondContact O-CG 3.39Å; L100-Q104 PolarHBondContact O-N 3.03Å
101	S	98.5	Very high	98.6	Very high	69 Å²	69	106.8 Å²	106.8	48%	0.483	53%	0.525	S	S	.	.	H	α-helix	trans	-58.9	-40.7	174.9	-64.1	0	0	0	0	111.9	K97 N98 N99 Q104 L105	K97-S101 PolarHBondContact O-N 2.8Å; K97-S101 PolarHBondContact O-OG 3.35Å; K97-S101 VanDerWaalsContact O-OG 3.08Å; N98-S101 PolarHBondContact O-N 3.43Å; N99-S101 PolarHBondContact O-N 3.49Å; S101-Q104 PolarHBondContact O-N 3.46Å; S101-L105 PolarHBondContact O-N 2.77Å
102	S	98.5	Very high	98.6	Very high	65 Å²	65	105.6 Å²	105.6	46%	0.455	52%	0.522	S	S	.	.	H	α-helix	trans	-66.3	-45.5	177.2	-55.7	0	0	0	0	111.6	N98 N99 L100 Q104 L105 L106	N98-S102 WeakPolarHBondContact O-CB 3.41Å; N98-S102 PolarHBondContact O-N 3Å; N98-S102 PolarHBondContact O-OG 2.88Å; N99-S102 WeakPolarHBondContact O-CB 3.33Å; N99-S102 PolarHBondContact O-N 3.34Å; L100-S102 VanDerWaalsContact C-N 3.28Å; L100-S102 PolarHBondContact O-N 3.24Å; S102-Q104 VanDerWaalsContact C-N 3.33Å; S102-Q104 PolarHBondContact O-N 3.46Å; S102-L105 WeakPolarHBondContact O-CB 3.47Å; S102-L105 PolarHBondContact O-N 2.98Å; S102-L106 WeakPolarHBondContact O-CG 3.19Å; S102-L106 PolarHBondContact O-N 3.49Å
103	C	98.6	Very high	98.6	Very high	66 Å²	66	102.4 Å²	102.4	45%	0.446	51%	0.514	S	S	.	.	H	α-helix	trans	-60.3	-42.8	174.7	-69.9	0	0	0	0	111.8	N99 L100 L105 L106 L107	N99-C103 PolarHBondContact O-N 3.41Å; N99-C103 PolarHBondContact O-SG 2.92Å; L100-C103 PolarHBondContact O-N 2.89Å; C103-L105 VanDerWaalsContact C-N 3.31Å; C103-L105 PolarHBondContact O-N 3.36Å; C103-L106 PolarHBondContact O-N 2.86Å; C103-L107 WeakPolarHBondContact O-CB 3.05Å; C103-L107 VanDerWaalsContact O-CG 3.26Å; C103-L107 WeakPolarHBondContact O-CG 3.37Å; C103-L107 PolarHBondContact O-N 2.82Å
104	Q	98.7	Very high	98.6	Very high	87 Å²	87	103.6 Å²	103.6	41%	0.407	52%	0.521	S	S	.	.	H	α-helix	trans	-60.4	-41.2	176.4	-75.8	176.9	-3.2	0	0	111.9	L100 S101 S102 R108	L100-Q104 WeakPolarHBondContact O-CB 3.38Å; L100-Q104 VanDerWaalsContact O-CG 3.29Å; L100-Q104 WeakPolarHBondContact O-CG 3.39Å; L100-Q104 PolarHBondContact O-N 3.03Å; S101-Q104 PolarHBondContact O-N 3.46Å; S102-Q104 VanDerWaalsContact C-N 3.33Å; S102-Q104 PolarHBondContact O-N 3.46Å; Q104-R108 WeakPolarHBondContact O-CB 2.87Å; Q104-R108 VanDerWaalsContact O-CG 3.25Å; Q104-R108 WeakPolarHBondContact O-CG 3.38Å; Q104-R108 PolarHBondContact O-N 2.83Å
105	L	98.7	Very high	98.6	Very high	109 Å²	109	103.2 Å²	103.2	57%	0.571	52%	0.52	S	S	*	.	H	α-helix	trans	-62.8	-49.7	175.8	-180	61.7	0	0	0	111.3	S101 S102 C103 L107 R108 C109	S101-L105 PolarHBondContact O-N 2.77Å; S102-L105 WeakPolarHBondContact O-CB 3.47Å; S102-L105 PolarHBondContact O-N 2.98Å; C103-L105 VanDerWaalsContact C-N 3.31Å; C103-L105 PolarHBondContact O-N 3.36Å; L105-L107 VanDerWaalsContact C-N 3.33Å; L105-L107 PolarHBondContact O-N 2.85Å; L105-R108 WeakPolarHBondContact O-CB 3.48Å; L105-R108 PolarHBondContact O-N 3.01Å; L105-R108 VanDerWaalsContact O-N 3.16Å; L105-C109 PolarHBondContact O-N 3.19Å; L105-C109 PolarHBondContact O-SG 3.11Å
106	L	98.6	Very high	98.7	Very high	118 Å²	118	104.2 Å²	104.2	62%	0.618	52%	0.521	S	S	*	.	H	α-helix	trans	-59	-43.9	178.7	-69.9	173.1	0	0	0	112.2	S102 C103 R108 C109 K110	S102-L106 WeakPolarHBondContact O-CG 3.19Å; S102-L106 PolarHBondContact O-N 3.49Å; C103-L106 PolarHBondContact O-N 2.86Å; L106-R108 VanDerWaalsContact C-N 3.34Å; L106-R108 PolarHBondContact O-N 3.22Å; L106-C109 PolarHBondContact O-N 3.08Å; L106-K110 WeakPolarHBondContact O-CG 3.33Å; L106-K110 PolarHBondContact O-N 3.08Å
107	L	98.8	Very high	98.6	Very high	122 Å²	122	103.9 Å²	103.9	64%	0.639	52%	0.519	S	S	*	.	H	α-helix	trans	-63.6	-39.4	177	-72.4	171.6	0	0	0	112	C103 L105 K110 R111	C103-L107 WeakPolarHBondContact O-CB 3.05Å; C103-L107 VanDerWaalsContact O-CG 3.26Å; C103-L107 WeakPolarHBondContact O-CG 3.37Å; C103-L107 PolarHBondContact O-N 2.82Å; L105-L107 VanDerWaalsContact C-N 3.33Å; L105-L107 PolarHBondContact O-N 2.85Å; L107-K110 PolarHBondContact O-N 3.44Å; L107-R111 VanDerWaalsContact O-CB 3.29Å; L107-R111 WeakPolarHBondContact O-CB 3.33Å; L107-R111 PolarHBondContact O-N 3.34Å
108	R	98.7	Very high	98.6	Very high	139 Å²	139	106 Å²	106	53%	0.525	52%	0.524	S	S	.	.	H	α-helix	trans	-62.5	-49.4	173.9	-74.3	172.2	-175.7	-175	2.7	111.1	Q104 L105 L106 K110 R111 D112	Q104-R108 WeakPolarHBondContact O-CB 2.87Å; Q104-R108 VanDerWaalsContact O-CG 3.25Å; Q104-R108 WeakPolarHBondContact O-CG 3.38Å; Q104-R108 PolarHBondContact O-N 2.83Å; L105-R108 WeakPolarHBondContact O-CB 3.48Å; L105-R108 PolarHBondContact O-N 3.01Å; L105-R108 VanDerWaalsContact O-N 3.16Å; L106-R108 VanDerWaalsContact C-N 3.34Å; L106-R108 PolarHBondContact O-N 3.22Å; R108-K110 VanDerWaalsContact C-N 3.32Å; R108-K110 PolarHBondContact O-N 3.37Å; R108-R111 WeakPolarHBondContact O-CB 3.45Å; R108-R111 PolarHBondContact O-N 2.99Å; R108-D112 WeakPolarHBondContact O-CB 3.42Å; R108-D112 PolarHBondContact O-N 3.29Å
109	C	98.5	Very high	98.6	Very high	70 Å²	70	106.1 Å²	106.1	47%	0.473	52%	0.524	S	S	.	.	H	α-helix	trans	-56.2	-46.5	177.2	-65.7	0	0	0	0	111.7	L105 L106 D112 E113	L105-C109 PolarHBondContact O-N 3.19Å; L105-C109 PolarHBondContact O-SG 3.11Å; L106-C109 PolarHBondContact O-N 3.08Å; C109-D112 PolarHBondContact O-N 3.42Å; C109-E113 WeakPolarHBondContact O-CB 3.3Å; C109-E113 PolarHBondContact O-N 3.28Å
110	K	98.5	Very high	98.6	Very high	123 Å²	123	105.4 Å²	105.4	54%	0.535	52%	0.518	S	S	.	.	H	α-helix	trans	-64.4	-41.2	178.5	-76.6	-73.2	161	-155.6	0	112.9	L106 L107 R108 D112 E113 L114	L106-K110 WeakPolarHBondContact O-CG 3.33Å; L106-K110 PolarHBondContact O-N 3.08Å; L107-K110 PolarHBondContact O-N 3.44Å; R108-K110 VanDerWaalsContact C-N 3.32Å; R108-K110 PolarHBondContact O-N 3.37Å; K110-D112 VanDerWaalsContact C-N 3.33Å; K110-E113 IonicContact NZ-OE2 3.78Å; K110-E113 PolarHBondContact NZ-OE2 2.99Å; K110-E113 PolarHBondContact O-N 3.48Å; K110-L114 WeakPolarHBondContact O-CG 3.28Å; K110-L114 PolarHBondContact O-N 2.93Å
111	R	98.7	Very high	98.6	Very high	145 Å²	145	103 Å²	103	55%	0.547	51%	0.51	S	S	.	.	H	α-helix	trans	-61.2	-43.6	174.6	-179.4	-165.9	64.8	-163.8	-3.3	111.4	L107 R108 L114 K115	L107-R111 VanDerWaalsContact O-CB 3.29Å; L107-R111 WeakPolarHBondContact O-CB 3.33Å; L107-R111 PolarHBondContact O-N 3.34Å; R108-R111 WeakPolarHBondContact O-CB 3.45Å; R108-R111 PolarHBondContact O-N 2.99Å; R111-L114 PolarHBondContact O-N 2.92Å; R111-K115 WeakPolarHBondContact O-CB 3.46Å; R111-K115 PolarHBondContact O-N 3.11Å
112	D	98.7	Very high	98.6	Very high	84 Å²	84	102 Å²	102	45%	0.449	51%	0.505	S	S	.	.	H	α-helix	trans	-70.4	-37	-177.4	-60.2	-13.6	0	0	0	111	R108 C109 K110 K115 K116	R108-D112 WeakPolarHBondContact O-CB 3.42Å; R108-D112 PolarHBondContact O-N 3.29Å; C109-D112 PolarHBondContact O-N 3.42Å; K110-D112 VanDerWaalsContact C-N 3.33Å; D112-K115 PolarHBondContact O-N 2.87Å; D112-K116 PolarHBondContact O-N 3.45Å
113	E	98.6	Very high	98.5	Very high	93 Å²	93	105.1 Å²	105.1	44%	0.435	51%	0.512	S	S	.	.	H	α-helix	trans	-60.5	-48.3	170.8	-176.2	179.1	-163.4	0	0	111.9	C109 K110 K115 K116 L117	C109-E113 WeakPolarHBondContact O-CB 3.3Å; C109-E113 PolarHBondContact O-N 3.28Å; K110-E113 IonicContact NZ-OE2 3.78Å; K110-E113 PolarHBondContact NZ-OE2 2.99Å; K110-E113 PolarHBondContact O-N 3.48Å; E113-K115 VanDerWaalsContact C-N 3.31Å; E113-K115 PolarHBondContact O-N 3.13Å; E113-K116 WeakPolarHBondContact O-CB 3.35Å; E113-K116 PolarHBondContact O-N 3.49Å; E113-L117 HydrophobicContact CG-CD1 4.41Å; E113-L117 WeakPolarHBondContact O-CG 3.5Å; E113-L117 PolarHBondContact O-N 3.42Å
114	L	98.8	Very high	98.5	Very high	117 Å²	117	107.3 Å²	107.3	61%	0.613	52%	0.519	S	S	*	.	H	α-helix	trans	-61	-40.6	176.4	-75.4	171.8	0	0	0	112.1	K110 R111 K116 L117 W118	K110-L114 WeakPolarHBondContact O-CG 3.28Å; K110-L114 PolarHBondContact O-N 2.93Å; R111-L114 PolarHBondContact O-N 2.92Å; L114-K116 VanDerWaalsContact C-N 3.33Å; L114-K116 PolarHBondContact O-N 3.24Å; L114-L117 PolarHBondContact O-N 3.37Å; L114-W118 WeakPolarHBondContact O-CB 3.44Å; L114-W118 PolarHBondContact O-N 3.4Å
115	K	98.6	Very high	98.4	Very high	138 Å²	138	109.3 Å²	109.3	60%	0.6	53%	0.527	S	S	*	.	H	α-helix	trans	-62	-42.4	176.4	-175.7	179.1	178.1	-177.3	0	111.4	R111 D112 E113 W118 L119	R111-K115 WeakPolarHBondContact O-CB 3.46Å; R111-K115 PolarHBondContact O-N 3.11Å; D112-K115 PolarHBondContact O-N 2.87Å; E113-K115 VanDerWaalsContact C-N 3.31Å; E113-K115 PolarHBondContact O-N 3.13Å; K115-W118 PolarHBondContact O-N 3.06Å; K115-L119 HydrophobicContact CG-CD1 4.5Å; K115-L119 WeakPolarHBondContact O-CG 3.33Å; K115-L119 PolarHBondContact O-N 3.49Å; K115-L119 VanDerWaalsContact O-N 3.11Å
116	K	98.6	Very high	98.4	Very high	129 Å²	129	111 Å²	111	56%	0.561	53%	0.527	S	S	*	.	H	α-helix	trans	-60.3	-52.7	175.7	177.8	-179.5	169.2	-179.3	0	111.1	D112 E113 L114 W118 L119 E120	D112-K116 PolarHBondContact O-N 3.45Å; E113-K116 WeakPolarHBondContact O-CB 3.35Å; E113-K116 PolarHBondContact O-N 3.49Å; L114-K116 VanDerWaalsContact C-N 3.33Å; L114-K116 PolarHBondContact O-N 3.24Å; K116-W118 VanDerWaalsContact C-N 3.25Å; K116-W118 PolarHBondContact O-N 2.99Å; K116-L119 PolarHBondContact O-N 3.34Å; K116-L119 VanDerWaalsContact O-N 3.12Å; K116-E120 WeakPolarHBondContact CE-OE1 3.48Å; K116-E120 IonicContact NZ-OE1 3.94Å; K116-E120 WeakPolarHBondContact O-CG 3.4Å; K116-E120 PolarHBondContact O-N 3.14Å
117	L	98.6	Very high	98.3	Very high	91 Å²	91	108.5 Å²	108.5	48%	0.476	52%	0.516	S	S	.	.	H	α-helix	trans	-59.7	-36.7	179.5	-69.6	172.4	0	0	0	112.5	E113 L114 S121	E113-L117 HydrophobicContact CG-CD1 4.41Å; E113-L117 WeakPolarHBondContact O-CG 3.5Å; E113-L117 PolarHBondContact O-N 3.42Å; L114-L117 PolarHBondContact O-N 3.37Å; L117-S121 WeakPolarHBondContact O-CB 3.36Å; L117-S121 PolarHBondContact O-N 2.85Å
118	W	98.5	Very high	98.2	Very high	179 Å²	179	106.1 Å²	106.1	68%	0.678	51%	0.506	S	S	*	.	H	α-helix	trans	-65.1	-43.5	176.2	-179.2	81.6	0	0	0	112.3	L114 K115 K116 S121 A122	L114-W118 WeakPolarHBondContact O-CB 3.44Å; L114-W118 PolarHBondContact O-N 3.4Å; K115-W118 PolarHBondContact O-N 3.06Å; K116-W118 VanDerWaalsContact C-N 3.25Å; K116-W118 PolarHBondContact O-N 2.99Å; W118-S121 PolarHBondContact O-N 2.9Å; W118-A122 PolarHBondContact O-N 3.31Å
119	L	98.6	Very high	98.2	Very high	92 Å²	92	107.2 Å²	107.2	48%	0.482	51%	0.51	S	S	.	.	H	α-helix	trans	-63.6	-46.7	176.2	-71.5	170.5	0	0	0	111.5	K115 K116 S121 A122 E123	K115-L119 HydrophobicContact CG-CD1 4.5Å; K115-L119 WeakPolarHBondContact O-CG 3.33Å; K115-L119 PolarHBondContact O-N 3.49Å; K115-L119 VanDerWaalsContact O-N 3.11Å; K116-L119 PolarHBondContact O-N 3.34Å; K116-L119 VanDerWaalsContact O-N 3.12Å; L119-S121 VanDerWaalsContact C-N 3.31Å; L119-S121 PolarHBondContact O-N 2.94Å; L119-A122 WeakPolarHBondContact O-CB 3.48Å; L119-A122 PolarHBondContact O-N 2.83Å; L119-A122 VanDerWaalsContact O-N 3.13Å; L119-E123 PolarHBondContact O-N 3.43Å
120	E	98.3	Very high	98.1	Very high	77 Å²	77	107.4 Å²	107.4	36%	0.36	51%	0.506	S	S	.	.	H	α-helix	trans	-59.2	-42.4	176.2	-70.7	174.1	175.2	0	0	111.3	K116 A122 E123 L124	K116-E120 WeakPolarHBondContact CE-OE1 3.48Å; K116-E120 IonicContact NZ-OE1 3.94Å; K116-E120 WeakPolarHBondContact O-CG 3.4Å; K116-E120 PolarHBondContact O-N 3.14Å; E120-A122 VanDerWaalsContact C-N 3.33Å; E120-A122 PolarHBondContact O-N 3.46Å; E120-E123 PolarHBondContact O-N 3.18Å; E120-L124 WeakPolarHBondContact O-CB 3.32Å; E120-L124 WeakPolarHBondContact O-CG 3.35Å; E120-L124 PolarHBondContact O-N 2.9Å
121	S	98.2	Very high	98	Very high	51 Å²	51	106.8 Å²	106.8	36%	0.357	51%	0.508	S	S	.	.	H	α-helix	trans	-63.6	-38.3	175.8	-174.4	0	0	0	0	112.5	L117 W118 L119 K125	L117-S121 WeakPolarHBondContact O-CB 3.36Å; L117-S121 PolarHBondContact O-N 2.85Å; W118-S121 PolarHBondContact O-N 2.9Å; L119-S121 VanDerWaalsContact C-N 3.31Å; L119-S121 PolarHBondContact O-N 2.94Å; S121-K125 VanDerWaalsContact O-CG 3.26Å; S121-K125 WeakPolarHBondContact O-CG 3.4Å; S121-K125 PolarHBondContact O-N 3.14Å
122	A	98	Very high	97.8	Very high	46 Å²	46	106.7 Å²	106.7	38%	0.38	51%	0.514	S	S	.	.	H	α-helix	trans	-66.5	-41.7	177	0	0	0	0	0	111.7	W118 L119 E120 K125 Y126	W118-A122 PolarHBondContact O-N 3.31Å; L119-A122 WeakPolarHBondContact O-CB 3.48Å; L119-A122 PolarHBondContact O-N 2.83Å; L119-A122 VanDerWaalsContact O-N 3.13Å; E120-A122 VanDerWaalsContact C-N 3.33Å; E120-A122 PolarHBondContact O-N 3.46Å; A122-K125 PolarHBondContact O-N 2.91Å; A122-Y126 PolarHBondContact O-N 3.49Å; A122-Y126 VanDerWaalsContact O-N 3.12Å
123	E	97.8	Very high	97.6	Very high	131 Å²	131	110.1 Å²	110.1	61%	0.612	53%	0.527	S	S	*	.	H	α-helix	trans	-63.1	-47.9	175.2	-176	174.4	-167	0	0	111.6	L119 E120 K125 Y126 V127	L119-E123 PolarHBondContact O-N 3.43Å; E120-E123 PolarHBondContact O-N 3.18Å; E123-K125 VanDerWaalsContact C-N 3.3Å; E123-K125 PolarHBondContact O-N 3.46Å; E123-Y126 WeakPolarHBondContact O-CA 3.36Å; E123-Y126 WeakPolarHBondContact O-CB 2.79Å; E123-Y126 PolarHBondContact O-N 3.41Å; E123-V127 WeakPolarHBondContact O-CG2 3.07Å; E123-V127 PolarHBondContact O-N 2.98Å
124	L	97.6	Very high	96.9	Very high	113 Å²	113	115.2 Å²	115.2	59%	0.592	56%	0.556	S	S	*	*	H	α-helix	trans	-58.2	-42	176.4	-74.1	170.8	0	0	0	112.1	E120 Y126 V127 V128	E120-L124 WeakPolarHBondContact O-CB 3.32Å; E120-L124 WeakPolarHBondContact O-CG 3.35Å; E120-L124 PolarHBondContact O-N 2.9Å; L124-Y126 VanDerWaalsContact C-N 3.28Å; L124-Y126 PolarHBondContact O-N 2.77Å; L124-V127 PolarHBondContact O-N 2.73Å; L124-V128 VanDerWaalsContact O-CG2 3.29Å; L124-V128 WeakPolarHBondContact O-CG2 3.32Å; L124-V128 PolarHBondContact O-N 3.23Å
125	K	97.8	Very high	96.8	Very high	129 Å²	129	115.2 Å²	115.2	56%	0.561	55%	0.554	S	S	*	*	H	α-helix	trans	-61.8	-37.6	175.5	-75	170.9	-174.4	176.4	0	112.2	S121 A122 E123 R129	S121-K125 VanDerWaalsContact O-CG 3.26Å; S121-K125 WeakPolarHBondContact O-CG 3.4Å; S121-K125 PolarHBondContact O-N 3.14Å; A122-K125 PolarHBondContact O-N 2.91Å; E123-K125 VanDerWaalsContact C-N 3.3Å; E123-K125 PolarHBondContact O-N 3.46Å; K125-R129 WeakPolarHBondContact O-CG 3.24Å; K125-R129 PolarHBondContact O-N 2.88Å
126	Y	97.3	Very high	96.7	Very high	145 Å²	145	113.9 Å²	113.9	57%	0.569	55%	0.551	S	S	*	*	H	α-helix	trans	-67.9	-45.4	176.1	178.8	-105.3	0	0	0	111.5	A122 E123 L124 V128 R129 L130	A122-Y126 PolarHBondContact O-N 3.49Å; A122-Y126 VanDerWaalsContact O-N 3.12Å; E123-Y126 WeakPolarHBondContact O-CA 3.36Å; E123-Y126 WeakPolarHBondContact O-CB 2.79Å; E123-Y126 PolarHBondContact O-N 3.41Å; L124-Y126 VanDerWaalsContact C-N 3.28Å; L124-Y126 PolarHBondContact O-N 2.77Å; Y126-V128 PolarHBondContact O-N 2.95Å; Y126-R129 PolarHBondContact O-N 3.4Å; Y126-L130 HydrophobicContact CD1-CD1 3.97Å; Y126-L130 HydrophobicContact CE1-CD1 3.41Å; Y126-L130 VanDerWaalsContact CE1-CD1 3.41Å; Y126-L130 HydrophobicContact CE1-CG 4.12Å; Y126-L130 PolarHBondContact O-N 3.22Å
127	V	97.3	Very high	96.6	Very high	64 Å²	64	113.1 Å²	113.1	39%	0.388	55%	0.551	S	S	.	*	H	α-helix	trans	-59.6	-45.3	176.2	173.3	0	0	0	0	111.4	E123 L124 R129 L130 L131	E123-V127 WeakPolarHBondContact O-CG2 3.07Å; E123-V127 PolarHBondContact O-N 2.98Å; L124-V127 PolarHBondContact O-N 2.73Å; V127-R129 VanDerWaalsContact C-N 3.33Å; V127-R129 PolarHBondContact O-N 3.1Å; V127-L130 PolarHBondContact O-N 3.19Å; V127-L130 VanDerWaalsContact O-N 3.17Å; V127-L131 HydrophobicContact CG1-CD1 4.12Å; V127-L131 HydrophobicContact CG1-CG 4.47Å; V127-L131 WeakPolarHBondContact O-CG 3.03Å; V127-L131 PolarHBondContact O-N 2.8Å
128	V	97.5	Very high	96.5	Very high	72 Å²	72	114.4 Å²	114.4	44%	0.436	56%	0.555	S	S	.	*	H	α-helix	trans	-58.3	-45.5	176.6	169.4	0	0	0	0	111.1	L124 Y126 L130 L131 E132	L124-V128 VanDerWaalsContact O-CG2 3.29Å; L124-V128 WeakPolarHBondContact O-CG2 3.32Å; L124-V128 PolarHBondContact O-N 3.23Å; Y126-V128 PolarHBondContact O-N 2.95Å; V128-L130 VanDerWaalsContact C-N 3.3Å; V128-L130 PolarHBondContact O-N 2.9Å; V128-L131 PolarHBondContact O-N 2.81Å; V128-L131 VanDerWaalsContact O-N 3.13Å; V128-E132 HydrophobicContact CG1-CG 4.39Å; V128-E132 WeakPolarHBondContact O-CG 3.49Å; V128-E132 PolarHBondContact O-N 3.04Å
129	R	97	Very high	96.4	Very high	163 Å²	163	110.4 Å²	110.4	62%	0.615	55%	0.547	S	S	*	.	H	α-helix	trans	-61.4	-36.6	177.2	-74.1	176.2	-174.8	-176.7	1.5	113.2	K125 Y126 V127 Q133	K125-R129 WeakPolarHBondContact O-CG 3.24Å; K125-R129 PolarHBondContact O-N 2.88Å; Y126-R129 PolarHBondContact O-N 3.4Å; V127-R129 VanDerWaalsContact C-N 3.33Å; V127-R129 PolarHBondContact O-N 3.1Å; R129-Q133 WeakPolarHBondContact O-CG 3.49Å; R129-Q133 PolarHBondContact O-N 3.32Å
130	L	96.8	Very high	96.2	Very high	73 Å²	73	111.6 Å²	111.6	38%	0.382	55%	0.552	S	S	.	*	H	α-helix	trans	-67.4	-39.9	175.4	-71	176.8	0	0	0	111.3	Y126 V127 V128 E132 Q133	Y126-L130 HydrophobicContact CD1-CD1 3.97Å; Y126-L130 HydrophobicContact CE1-CD1 3.41Å; Y126-L130 VanDerWaalsContact CE1-CD1 3.41Å; Y126-L130 HydrophobicContact CE1-CG 4.12Å; Y126-L130 PolarHBondContact O-N 3.22Å; V127-L130 PolarHBondContact O-N 3.19Å; V127-L130 VanDerWaalsContact O-N 3.17Å; V128-L130 VanDerWaalsContact C-N 3.3Å; V128-L130 PolarHBondContact O-N 2.9Å; L130-E132 VanDerWaalsContact C-N 3.33Å; L130-Q133 PolarHBondContact O-N 3.47Å
131	L	96.3	Very high	96.1	Very high	110 Å²	110	114.1 Å²	114.1	58%	0.576	57%	0.565	S	S	*	*	H	α-helix	trans	-67.3	-33.6	176.9	-67.5	173.4	0	0	0	112.5	V127 V128 Q133 L134	V127-L131 HydrophobicContact CG1-CD1 4.12Å; V127-L131 HydrophobicContact CG1-CG 4.47Å; V127-L131 WeakPolarHBondContact O-CG 3.03Å; V127-L131 PolarHBondContact O-N 2.8Å; V128-L131 PolarHBondContact O-N 2.81Å; V128-L131 VanDerWaalsContact O-N 3.13Å; L131-Q133 PolarHBondContact O-N 3.42Å; L131-L134 HydrophobicContact CD2-CD1 4.34Å; L131-L134 PolarHBondContact O-N 3.24Å
132	E	95.8	Very high	95.9	Very high	144 Å²	144	118.9 Å²	118.9	67%	0.673	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.6	-13.5	174.4	-72.3	172.4	169.3	0	0	113.6	V128 L130	V128-E132 HydrophobicContact CG1-CG 4.39Å; V128-E132 WeakPolarHBondContact O-CG 3.49Å; V128-E132 PolarHBondContact O-N 3.04Å; L130-E132 VanDerWaalsContact C-N 3.33Å
133	Q	93.3	Very high	95.7	Very high	156 Å²	156	125 Å²	125	73%	0.729	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.3	-5.3	178.5	-71	176.2	-7.4	0	0	113.9	R129 L130 L131	R129-Q133 WeakPolarHBondContact O-CG 3.49Å; R129-Q133 PolarHBondContact O-N 3.32Å; L130-Q133 PolarHBondContact O-N 3.47Å; L131-Q133 PolarHBondContact O-N 3.42Å
134	L	84.1	Confident	95.5	Very high	200 Å²	200	124.5 Å²	124.5	100%	1.047	60%	0.597	S	S	*	*			trans	-95.3	0	178.4	-64	175.7	0	0	0	111.1	L131	L131-L134 HydrophobicContact CD2-CD1 4.34Å; L131-L134 PolarHBondContact O-N 3.24Å

Retrieved 134 of 134 residues in 61.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).