A0A077YZ82_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YZ82, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 123 aa.

						>A0A077YZ82_TRITR|A0A077YZ82
MDESKKDKPPTDQKVIETAKKFVDKKLVDDEKAVTWALKSSNITVVKGNKLAGQLIILFNAVIVDCPSKTQIKMSEMLKFAVKDPKDNCKPNVINMKAEHPCSLLYSKYSGNSNLACSMIRGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.1	Very low	58.1	Low	240 Å²	240	147.2 Å²	147.2	100%	1.182	75%	0.752	S	S	*	*				0	100	0	-75.5	175.2	171.4	0	0	105.4	E3	M1-E3 PolarHBondContact O-N 3.06Å
2	D	36.4	Very low	60.8	Low	163 Å²	163	142.3 Å²	142.3	87%	0.872	73%	0.728	S	S	*	*			trans	-54.1	125.4	169.2	-91.5	-57.8	0	0	0	107.3	S4	D2-S4 PolarHBondContact O-N 2.68Å
3	E	39.6	Very low	63.2	Low	186 Å²	186	142.3 Å²	142.3	87%	0.869	72%	0.724	S	S	*	*			trans	-60.1	88.3	169.4	-71.8	-173.3	129	0	0	106.9	M1 K5	M1-E3 PolarHBondContact O-N 3.06Å; E3-K5 PolarHBondContact O-N 2.83Å
4	S	41.7	Very low	65.3	Low	107 Å²	107	143.5 Å²	143.5	75%	0.748	72%	0.721	S	S	*	*			trans	-52	110.5	172.9	41.3	0	0	0	0	106.3	D2 K6	D2-S4 PolarHBondContact O-N 2.68Å; S4-K6 PolarHBondContact O-N 3.43Å
5	K	46.8	Very low	67.1	Low	195 Å²	195	137.7 Å²	137.7	85%	0.848	70%	0.696	S	S	*	*			trans	-27	110.9	-179.3	-75.1	175.3	176.3	173.8	0	109.3	E3 D7	E3-K5 PolarHBondContact O-N 2.83Å; K5-D7 PolarHBondContact O-N 3.18Å
6	K	51.3	Low	68.7	Low	196 Å²	196	132.1 Å²	132.1	85%	0.852	67%	0.668	S	S	*	*			trans	-50.8	110.6	172.7	-77.4	179.9	178.1	172.3	0	106.5	S4 K8	S4-K6 PolarHBondContact O-N 3.43Å; K6-K8 PolarHBondContact O-N 2.89Å; K6-K8 VanDerWaalsContact O-N 3.13Å
7	D	63.8	Low	70.3	Confident	92 Å²	92	129.9 Å²	129.9	49%	0.492	66%	0.655	S	S	.	*	P	Polyproline II helix	trans	-52.2	122.9	178.3	-90.3	-37.7	0	0	0	106.6	K5 V45 K47	K5-D7 PolarHBondContact O-N 3.18Å; D7-V45 HydrophobicContact CB-CG1 4.27Å; D7-V45 HydrophobicContact CB-CG2 3.9Å; D7-K47 IonicContact OD2-NZ 3.96Å
8	K	69.8	Low	71.6	Confident	188 Å²	188	127.6 Å²	127.6	82%	0.817	65%	0.648	S	S	*	*	P	Polyproline II helix	trans	-65.5	143	-176.1	-73.4	-175.8	179.9	-179.7	0	108.9	K6	K6-K8 PolarHBondContact O-N 2.89Å; K6-K8 VanDerWaalsContact O-N 3.13Å
9	P	81.3	Confident	72.8	Confident	86 Å²	86	121.3 Å²	121.3	56%	0.558	62%	0.618	S	S	*	*	P	Polyproline II helix	trans	-53.3	140.9	174.3	-24	32.8	0	0	0	111.4	T11 T44	P9-T11 PolarHBondContact O-N 3.14Å; P9-T44 WeakPolarHBondContact CA-O 3.31Å
10	P	84.4	Confident	74	Confident	30 Å²	30	118 Å²	118	20%	0.195	60%	0.599	C	S	.	*	P	Polyproline II helix	trans	-58.6	136.6	172	26.3	-33.5	0	0	0	109.1	I16 I43 T44 V46	P10-I16 HydrophobicContact CB-CG1 4.17Å; P10-I16 HydrophobicContact CG-CG1 3.92Å; P10-I16 VanDerWaalsContact O-CD1 3.32Å; P10-I16 WeakPolarHBondContact O-CD1 3.23Å; P10-I43 HydrophobicContact CG-CG2 4.22Å; P10-T44 WeakPolarHBondContact CD-O 3.46Å; P10-V46 HydrophobicContact CG-CG2 4.23Å
11	T	88.6	Confident	75.1	Confident	136 Å²	136	119.6 Å²	119.6	83%	0.834	60%	0.602	S	S	*	*			trans	-103.4	-15.4	178.2	55.8	0	0	0	0	112.8	P9 Q13	P9-T11 PolarHBondContact O-N 3.14Å; T11-Q13 PolarHBondContact O-N 3.1Å
12	D	90.9	Very high	77.9	Confident	88 Å²	88	110.9 Å²	110.9	47%	0.471	56%	0.557	S	S	.	*			trans	-74.8	111	177.3	-177.1	-38.1	0	0	0	110.1	K14 V15 I16	D12-K14 VanDerWaalsContact C-N 3.28Å; D12-K14 PolarHBondContact O-N 3.05Å; D12-K14 WeakPolarHBondContact OD1-CA 3.37Å; D12-K14 WeakPolarHBondContact OD1-CB 3.24Å; D12-K14 PolarHBondContact OD1-N 3.26Å; D12-V15 HydrophobicContact CB-CB 3.97Å; D12-V15 HydrophobicContact CB-CG2 3.81Å; D12-V15 WeakPolarHBondContact O-CB 3.4Å; D12-V15 PolarHBondContact O-N 3.43Å; D12-V15 VanDerWaalsContact O-N 3.15Å; D12-V15 PolarHBondContact OD1-N 3.02Å; D12-I16 VanDerWaalsContact O-CG1 3.31Å; D12-I16 WeakPolarHBondContact O-CG1 3.47Å; D12-I16 PolarHBondContact O-N 3Å
13	Q	91.6	Very high	80.8	Confident	143 Å²	143	103.1 Å²	103.1	67%	0.668	52%	0.516	S	S	*	.	H	α-helix	trans	-60.3	-36.3	-177.1	-162	127.4	-6.3	0	0	113	T11 I16 E17	T11-Q13 PolarHBondContact O-N 3.1Å; Q13-I16 PolarHBondContact O-N 2.96Å; Q13-E17 WeakPolarHBondContact O-CB 3.03Å; Q13-E17 WeakPolarHBondContact O-CG 3.46Å; Q13-E17 PolarHBondContact O-N 3.33Å
14	K	93.3	Very high	83.5	Confident	159 Å²	159	96.1 Å²	96.1	69%	0.691	48%	0.484	S	S	*	.	H	α-helix	trans	-69.8	-37.7	178.7	-171.7	176.2	-179.1	178	0	110.9	D12 T18	D12-K14 VanDerWaalsContact C-N 3.28Å; D12-K14 PolarHBondContact O-N 3.05Å; D12-K14 WeakPolarHBondContact OD1-CA 3.37Å; D12-K14 WeakPolarHBondContact OD1-CB 3.24Å; D12-K14 PolarHBondContact OD1-N 3.26Å; K14-T18 VanDerWaalsContact O-CB 3.29Å; K14-T18 WeakPolarHBondContact O-CB 3.43Å; K14-T18 PolarHBondContact O-N 3.13Å; K14-T18 PolarHBondContact O-OG1 3.27Å
15	V	91.4	Very high	86	Confident	57 Å²	57	97.8 Å²	97.8	35%	0.345	48%	0.478	S	S	.	.	H	α-helix	trans	-64.1	-45.6	173	174.2	0	0	0	0	110.4	D12 T18 A19 V46	D12-V15 HydrophobicContact CB-CB 3.97Å; D12-V15 HydrophobicContact CB-CG2 3.81Å; D12-V15 WeakPolarHBondContact O-CB 3.4Å; D12-V15 PolarHBondContact O-N 3.43Å; D12-V15 VanDerWaalsContact O-N 3.15Å; D12-V15 PolarHBondContact OD1-N 3.02Å; V15-T18 PolarHBondContact O-N 3.11Å; V15-A19 VanDerWaalsContact O-CB 3.25Å; V15-A19 WeakPolarHBondContact O-CB 3.37Å; V15-A19 PolarHBondContact O-N 2.88Å; V15-V46 HydrophobicContact CG1-CB 4.44Å; V15-V46 HydrophobicContact CG1-CG1 4.32Å; V15-V46 HydrophobicContact CG1-CG2 4.41Å
16	I	93.4	Very high	88.2	Confident	47 Å²	47	90 Å²	90	24%	0.241	44%	0.444	C	S	.	.	H	α-helix	trans	-59.7	-50.4	178	-65	164.9	0	0	0	110.7	P10 D12 Q13 T18 A19 K20 I43	P10-I16 HydrophobicContact CB-CG1 4.17Å; P10-I16 HydrophobicContact CG-CG1 3.92Å; P10-I16 VanDerWaalsContact O-CD1 3.32Å; P10-I16 WeakPolarHBondContact O-CD1 3.23Å; D12-I16 VanDerWaalsContact O-CG1 3.31Å; D12-I16 WeakPolarHBondContact O-CG1 3.47Å; D12-I16 PolarHBondContact O-N 3Å; Q13-I16 PolarHBondContact O-N 2.96Å; I16-T18 VanDerWaalsContact C-N 3.34Å; I16-T18 PolarHBondContact O-N 3.01Å; I16-A19 PolarHBondContact O-N 3.5Å; I16-K20 WeakPolarHBondContact O-CB 3.3Å; I16-K20 PolarHBondContact O-N 3.09Å; I16-I43 HydrophobicContact CG2-CB 4.4Å; I16-I43 HydrophobicContact CG2-CG1 4.35Å
17	E	95.3	Very high	90.2	Very high	96 Å²	96	81 Å²	81	45%	0.449	41%	0.405	S	S	.	.	H	α-helix	trans	-62.7	-40.3	-179.9	-75.3	177.6	-167.7	0	0	112.6	Q13 K20 K21	Q13-E17 WeakPolarHBondContact O-CB 3.03Å; Q13-E17 WeakPolarHBondContact O-CG 3.46Å; Q13-E17 PolarHBondContact O-N 3.33Å; E17-K20 PolarHBondContact O-N 3.01Å; E17-K21 WeakPolarHBondContact O-CG 3.18Å; E17-K21 PolarHBondContact O-N 3.22Å
18	T	94.8	Very high	91.6	Very high	87 Å²	87	80.5 Å²	80.5	53%	0.534	41%	0.405	S	S	.	.	H	α-helix	trans	-66.7	-46.3	177.8	-57.3	0	0	0	0	110.7	K14 V15 I16 K20 K21 F22	K14-T18 VanDerWaalsContact O-CB 3.29Å; K14-T18 WeakPolarHBondContact O-CB 3.43Å; K14-T18 PolarHBondContact O-N 3.13Å; K14-T18 PolarHBondContact O-OG1 3.27Å; V15-T18 PolarHBondContact O-N 3.11Å; I16-T18 VanDerWaalsContact C-N 3.34Å; I16-T18 PolarHBondContact O-N 3.01Å; T18-K20 VanDerWaalsContact C-N 3.31Å; T18-K20 PolarHBondContact O-N 3.41Å; T18-K21 PolarHBondContact O-N 2.81Å; T18-F22 WeakPolarHBondContact O-CB 3.32Å; T18-F22 PolarHBondContact O-N 3.08Å
19	A	94.4	Very high	92.5	Very high	8 Å²	8	75.5 Å²	75.5	7%	0.066	39%	0.388	C	S	.	.	H	α-helix	trans	-60.6	-43.2	175.7	0	0	0	0	0	111	V15 I16 F22 V23 I43 V46 I57	V15-A19 VanDerWaalsContact O-CB 3.25Å; V15-A19 WeakPolarHBondContact O-CB 3.37Å; V15-A19 PolarHBondContact O-N 2.88Å; I16-A19 PolarHBondContact O-N 3.5Å; A19-F22 PolarHBondContact O-N 3.31Å; A19-V23 WeakPolarHBondContact O-CB 3.38Å; A19-V23 VanDerWaalsContact O-CG2 3.27Å; A19-V23 WeakPolarHBondContact O-CG2 3.42Å; A19-V23 PolarHBondContact O-N 3.45Å; A19-I43 HydrophobicContact CB-CG1 4.37Å; A19-I43 HydrophobicContact CB-CG2 4.34Å; A19-V46 HydrophobicContact CB-CG2 3.79Å; A19-I57 HydrophobicContact CB-CD1 4.23Å
20	K	96.2	Very high	92.8	Very high	56 Å²	56	73.2 Å²	73.2	24%	0.243	37%	0.371	C	S	.	.	H	α-helix	trans	-59	-51.8	176.9	-166.9	-175.2	177.4	60.9	0	112.1	I16 E17 T18 F22 V23 D24 S40 S41 I43	I16-K20 WeakPolarHBondContact O-CB 3.3Å; I16-K20 PolarHBondContact O-N 3.09Å; E17-K20 PolarHBondContact O-N 3.01Å; T18-K20 VanDerWaalsContact C-N 3.31Å; T18-K20 PolarHBondContact O-N 3.41Å; K20-F22 VanDerWaalsContact C-N 3.29Å; K20-F22 PolarHBondContact O-N 2.88Å; K20-V23 PolarHBondContact O-N 3.48Å; K20-D24 WeakPolarHBondContact O-CB 3.36Å; K20-D24 PolarHBondContact O-N 3.16Å; K20-S40 WeakPolarHBondContact CG-OG 3.09Å; K20-S40 VanDerWaalsContact NZ-C 3.25Å; K20-S40 PolarHBondContact NZ-O 3.35Å; K20-S40 PolarHBondContact NZ-OG 3.25Å; K20-S41 PolarHBondContact NZ-O 2.85Å; K20-I43 HydrophobicContact CB-CG1 4.32Å
21	K	96.4	Very high	92.9	Very high	151 Å²	151	72.8 Å²	72.8	66%	0.657	37%	0.366	S	S	*	.	H	α-helix	trans	-59.2	-41.2	177.4	-74.4	173.7	-177	171.8	0	111.8	E17 T18 K25	E17-K21 WeakPolarHBondContact O-CG 3.18Å; E17-K21 PolarHBondContact O-N 3.22Å; T18-K21 PolarHBondContact O-N 2.81Å; K21-K25 PolarHBondContact O-N 3.48Å; K21-K25 VanDerWaalsContact O-N 3.15Å
22	F	95.3	Very high	92.5	Very high	57 Å²	57	73.6 Å²	73.6	25%	0.25	36%	0.358	C	S	.	.	H	α-helix	trans	-64.8	-47.3	177.1	176.4	-105.3	0	0	0	112.1	T18 A19 K20 K25 K26 L55 I57 L104 Y106	T18-F22 WeakPolarHBondContact O-CB 3.32Å; T18-F22 PolarHBondContact O-N 3.08Å; A19-F22 PolarHBondContact O-N 3.31Å; K20-F22 VanDerWaalsContact C-N 3.29Å; K20-F22 PolarHBondContact O-N 2.88Å; F22-K25 PolarHBondContact O-N 3.41Å; F22-K26 HydrophobicContact CE1-CG 4.32Å; F22-K26 HydrophobicContact CE2-CG 4.3Å; F22-K26 HydrophobicContact CZ-CG 4.09Å; F22-K26 PolarHBondContact O-N 2.02Å; F22-K26 VanDerWaalsContact O-N 3.1Å; F22-L55 HydrophobicContact CD1-CD2 4.46Å; F22-L55 HydrophobicContact CE1-CD2 4.19Å; F22-I57 HydrophobicContact CD1-CD1 3.85Å; F22-I57 HydrophobicContact CE1-CD1 4.3Å; F22-L104 HydrophobicContact CD1-CD2 4.05Å; F22-L104 HydrophobicContact CE1-CD2 3.65Å; F22-Y106 HydrophobicContact CE1-CG 4.31Å; F22-Y106 HydrophobicContact CZ-CD1 4.12Å; F22-Y106 AromaticContact CZ-CD2 3.78Å; F22-Y106 HydrophobicContact CZ-CD2 3.78Å; F22-Y106 HydrophobicContact CZ-CE2 4.19Å; F22-Y106 AromaticContact CZ-CG 3.72Å; F22-Y106 HydrophobicContact CZ-CG 3.72Å
23	V	95.9	Very high	92	Very high	1 Å²	1	73.8 Å²	73.8	1%	0.006	37%	0.372	C	S	.	.	H	α-helix	trans	-61.5	-49.6	177	168.7	0	0	0	0	110.9	A19 K20 K25 K26 L27 I43 I57 F59 L104	A19-V23 WeakPolarHBondContact O-CB 3.38Å; A19-V23 VanDerWaalsContact O-CG2 3.27Å; A19-V23 WeakPolarHBondContact O-CG2 3.42Å; A19-V23 PolarHBondContact O-N 3.45Å; K20-V23 PolarHBondContact O-N 3.48Å; V23-K25 PolarHBondContact O-N 2.8Å; V23-K26 CarbonylContact O-C 3.6Å; V23-K26 WeakPolarHBondContact O-CA 2.99Å; V23-K26 PolarHBondContact O-N 2.81Å; V23-L27 HydrophobicContact CG1-CD1 3.94Å; V23-L27 HydrophobicContact CG1-CG 4.09Å; V23-L27 WeakPolarHBondContact O-CG 3.34Å; V23-L27 PolarHBondContact O-N 2.99Å; V23-I43 HydrophobicContact CG2-CD1 4.36Å; V23-I57 HydrophobicContact CG2-CB 4.27Å; V23-I57 HydrophobicContact CG2-CD1 3.76Å; V23-I57 HydrophobicContact CG2-CG2 3.83Å; V23-F59 HydrophobicContact CG1-CD1 4.1Å; V23-F59 HydrophobicContact CG1-CD2 3.8Å; V23-F59 HydrophobicContact CG1-CE1 3.79Å; V23-F59 HydrophobicContact CG1-CE2 3.45Å; V23-F59 VanDerWaalsContact CG1-CE2 3.45Å; V23-F59 HydrophobicContact CG1-CG 4.11Å; V23-F59 HydrophobicContact CG1-CZ 3.44Å; V23-F59 VanDerWaalsContact CG1-CZ 3.44Å; V23-F59 HydrophobicContact CG2-CD1 4.35Å; V23-F59 HydrophobicContact CG2-CE1 4.39Å; V23-L104 HydrophobicContact CG2-CD2 3.95Å
24	D	95.9	Very high	91.5	Very high	38 Å²	38	68.7 Å²	68.7	20%	0.203	35%	0.35	C	S	.	.	H	α-helix	trans	-59.1	-38	-178.8	-75	-14	0	0	0	111.5	K20 V28 S40	K20-D24 WeakPolarHBondContact O-CB 3.36Å; K20-D24 PolarHBondContact O-N 3.16Å; D24-V28 WeakPolarHBondContact O-CG2 3.12Å; D24-V28 PolarHBondContact O-N 2.91Å; D24-S40 VanDerWaalsContact OD1-CB 3.22Å; D24-S40 WeakPolarHBondContact OD1-CB 3.4Å; D24-S40 PolarHBondContact OD1-N 2.75Å; D24-S40 PolarHBondContact OD1-OG 3.45Å
25	K	94.5	Very high	91.2	Very high	143 Å²	143	62 Å²	62	62%	0.622	32%	0.323	S	S	*	.	H	α-helix	trans	-62.7	-45.4	172.5	-176	174.7	179.4	174.4	0	111.9	K21 F22 V23 V28 D29	K21-K25 PolarHBondContact O-N 3.48Å; K21-K25 VanDerWaalsContact O-N 3.15Å; F22-K25 PolarHBondContact O-N 3.41Å; V23-K25 PolarHBondContact O-N 2.8Å; K25-V28 PolarHBondContact O-N 3.33Å; K25-D29 PolarHBondContact O-N 3.04Å
26	K	93.1	Very high	91.3	Very high	31 Å²	31	61.4 Å²	61.4	14%	0.135	32%	0.315	C	S	.	.	H	α-helix	trans	-66.5	-35.2	179.2	-72.5	-57.9	-162.6	164.3	0	113.3	F22 V23 V28 D29 D30 L104 S113	F22-K26 HydrophobicContact CE1-CG 4.32Å; F22-K26 HydrophobicContact CE2-CG 4.3Å; F22-K26 HydrophobicContact CZ-CG 4.09Å; F22-K26 PolarHBondContact O-N 2.02Å; F22-K26 VanDerWaalsContact O-N 3.1Å; V23-K26 CarbonylContact O-C 3.6Å; V23-K26 WeakPolarHBondContact O-CA 2.99Å; V23-K26 PolarHBondContact O-N 2.81Å; K26-V28 VanDerWaalsContact C-N 3.3Å; K26-V28 PolarHBondContact O-N 3.45Å; K26-D29 PolarHBondContact O-N 3.34Å; K26-D30 WeakPolarHBondContact O-CB 3.38Å; K26-D30 PolarHBondContact O-N 2.72Å; K26-L104 HydrophobicContact CB-CD1 4.29Å; K26-L104 HydrophobicContact CB-CD2 4.17Å; K26-L104 HydrophobicContact CG-CD2 4.17Å; K26-S113 WeakPolarHBondContact CD-OG 3.39Å; K26-S113 WeakPolarHBondContact CE-OG 3.25Å; K26-S113 PolarHBondContact NZ-OG 2.96Å
27	L	93.8	Very high	91.3	Very high	6 Å²	6	59.3 Å²	59.3	3%	0.031	31%	0.305	C	S	.	.	H	α-helix	trans	-60.8	-40.7	173.7	-68.9	175	0	0	0	111.5	V23 D30 E31 L38 F59 L115	V23-L27 HydrophobicContact CG1-CD1 3.94Å; V23-L27 HydrophobicContact CG1-CG 4.09Å; V23-L27 WeakPolarHBondContact O-CG 3.34Å; V23-L27 PolarHBondContact O-N 2.99Å; L27-D30 PolarHBondContact O-N 2.87Å; L27-E31 PolarHBondContact O-N 3.39Å; L27-L38 HydrophobicContact CB-CB 4.49Å; L27-L38 HydrophobicContact CD1-CB 3.99Å; L27-L38 WeakPolarHBondContact CD1-O 3.11Å; L27-L38 HydrophobicContact CD2-CB 3.98Å; L27-L38 HydrophobicContact CD2-CD1 4.23Å; L27-L38 HydrophobicContact CG-CB 4.38Å; L27-F59 HydrophobicContact CD1-CE2 4.03Å; L27-F59 HydrophobicContact CD2-CE2 4.18Å; L27-F59 HydrophobicContact CD2-CZ 4.03Å; L27-L115 HydrophobicContact CD2-CD1 3.73Å; L27-L115 HydrophobicContact CD2-CD2 3.52Å; L27-L115 HydrophobicContact CD2-CG 4.28Å
28	V	92.5	Very high	91.3	Very high	82 Å²	82	55.3 Å²	55.3	50%	0.497	29%	0.286	S	S	.	.	H	α-helix	trans	-67.2	-43.7	175.6	174.6	0	0	0	0	111.3	D24 K25 K26 D30 E31	D24-V28 WeakPolarHBondContact O-CG2 3.12Å; D24-V28 PolarHBondContact O-N 2.91Å; K25-V28 PolarHBondContact O-N 3.33Å; K26-V28 VanDerWaalsContact C-N 3.3Å; K26-V28 PolarHBondContact O-N 3.45Å; V28-D30 PolarHBondContact O-N 2.94Å; V28-E31 WeakPolarHBondContact O-CB 3.45Å; V28-E31 PolarHBondContact O-N 3.35Å
29	D	89.8	Confident	91.4	Very high	83 Å²	83	56.2 Å²	56.2	44%	0.444	28%	0.283	S	S	.	.	H	α-helix	trans	-59.7	-35.2	178.2	-67.2	-21.6	0	0	0	111.8	K25 K26	K25-D29 PolarHBondContact O-N 3.04Å; K26-D29 PolarHBondContact O-N 3.34Å
30	D	86.4	Confident	91.5	Very high	38 Å²	38	56 Å²	56	20%	0.203	28%	0.281	C	S	.	.	G	3₁₀ helix	trans	-84	-3.7	-178.6	-77	6.1	0	0	0	113.9	K26 L27 V28 K32 A33 V34 L115	K26-D30 WeakPolarHBondContact O-CB 3.38Å; K26-D30 PolarHBondContact O-N 2.72Å; L27-D30 PolarHBondContact O-N 2.87Å; V28-D30 PolarHBondContact O-N 2.94Å; D30-K32 PolarHBondContact O-N 3.38Å; D30-A33 PolarHBondContact O-N 3.14Å; D30-V34 PolarHBondContact O-N 3.38Å; D30-V34 VanDerWaalsContact O-N 3.16Å; D30-L115 HydrophobicContact CB-CD2 4.07Å; D30-L115 WeakPolarHBondContact OD2-CB 3.29Å
31	E	86.8	Confident	91.4	Very high	22 Å²	22	55.3 Å²	55.3	10%	0.103	28%	0.283	C	S	.	.	G	3₁₀ helix	trans	-60.3	-16.2	179.7	-75.1	-173.2	172.4	0	0	113.6	L27 V28 A33 T70 Q71	L27-E31 PolarHBondContact O-N 3.39Å; V28-E31 WeakPolarHBondContact O-CB 3.45Å; V28-E31 PolarHBondContact O-N 3.35Å; E31-A33 VanDerWaalsContact C-N 3.26Å; E31-A33 PolarHBondContact O-N 3.08Å; E31-T70 HydrophobicContact CB-CG2 4.14Å; E31-T70 WeakPolarHBondContact OE2-CB 3.4Å; E31-T70 PolarHBondContact OE2-OG1 3.25Å; E31-Q71 WeakPolarHBondContact O-CG 3.37Å; E31-Q71 PolarHBondContact O-NE2 3.47Å
32	K	81.2	Confident	91.3	Very high	152 Å²	152	52 Å²	52	66%	0.661	27%	0.273	S	S	*	.	G	3₁₀ helix	trans	-67.6	-29	171.5	-67.7	-177.4	-178.7	177.4	0	112.7	D30 T70 Q71 M74	D30-K32 PolarHBondContact O-N 3.38Å; K32-T70 HydrophobicContact CB-CG2 4.46Å; K32-T70 HydrophobicContact CG-CG2 3.71Å; K32-Q71 PolarHBondContact O-NE2 3.01Å; K32-M74 HydrophobicContact CB-SD 4.1Å; K32-M74 HydrophobicContact CG-SD 4.14Å
33	A	79.7	Confident	91.3	Very high	92 Å²	92	49.6 Å²	49.6	76%	0.76	26%	0.262	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101.6	-16.1	-179	0	0	0	0	0	113.1	D30 E31	D30-A33 PolarHBondContact O-N 3.14Å; E31-A33 VanDerWaalsContact C-N 3.26Å; E31-A33 PolarHBondContact O-N 3.08Å
34	V	81.7	Confident	91.2	Very high	36 Å²	36	51.4 Å²	51.4	22%	0.218	27%	0.273	C	S	.	.			trans	-119.3	132.6	-174.9	-174.5	0	0	0	0	110.9	D30 W36 Q71	D30-V34 PolarHBondContact O-N 3.38Å; D30-V34 VanDerWaalsContact O-N 3.16Å; V34-W36 HydrophobicContact CG1-CE3 3.93Å; V34-W36 PolarHBondContact O-N 2.77Å; V34-Q71 VanDerWaalsContact O-CG 3.27Å; V34-Q71 WeakPolarHBondContact O-CG 3.46Å; V34-Q71 PolarHBondContact O-NE2 3.21Å
35	T	86.6	Confident	91.1	Very high	20 Å²	20	50.5 Å²	50.5	12%	0.123	27%	0.269	C	S	.	.	S	Bend	trans	-69.2	-31.9	-177.9	-52.9	0	0	0	0	113.9	P67 S68 P85 N88	T35-P67 HydrophobicContact CG2-CB 3.82Å; T35-P67 CarbonylContact O-C 3.32Å; T35-P67 WeakPolarHBondContact O-CA 3.35Å; T35-S68 PolarHBondContact O-N 2.71Å; T35-P85 HydrophobicContact CG2-CB 3.76Å; T35-P85 WeakPolarHBondContact CG2-O 3.5Å; T35-N88 HydrophobicContact CG2-CB 3.77Å; T35-N88 PolarHBondContact OG1-ND2 2.8Å; T35-N88 VanDerWaalsContact OG1-ND2 3.1Å
36	W	93.2	Very high	91.1	Very high	43 Å²	43	46 Å²	46	16%	0.163	25%	0.253	C	S	.	.	S	Bend	trans	-94.5	137.4	-173.4	-52.6	-77.5	0	0	0	111.9	V34 L38 I63 C66 N88 I94 M119	V34-W36 HydrophobicContact CG1-CE3 3.93Å; V34-W36 PolarHBondContact O-N 2.77Å; W36-L38 HydrophobicContact CB-CD2 4.46Å; W36-L38 HydrophobicContact CB-CG 4.48Å; W36-L38 PolarHBondContact O-N 2.05Å; W36-I63 HydrophobicContact CB-CD1 4.25Å; W36-I63 HydrophobicContact CB-CG1 4.09Å; W36-I63 HydrophobicContact CB-CG2 4.07Å; W36-I63 HydrophobicContact CG-CD1 3.94Å; W36-I63 HydrophobicContact CG-CG1 4.33Å; W36-C66 PolarHBondContact NE1-SG 3.08Å; W36-C66 VanDerWaalsContact NE1-SG 3.41Å; W36-N88 HydrophobicContact CZ2-CB 4.25Å; W36-N88 PolarHBondContact NE1-O 2.84Å; W36-I94 HydrophobicContact CH2-CD1 4.47Å; W36-I94 HydrophobicContact CZ2-CB 4.2Å; W36-I94 HydrophobicContact CZ2-CD1 4.06Å; W36-I94 HydrophobicContact CZ2-CG1 4.16Å; W36-M119 HydrophobicContact CD2-CE 3.8Å; W36-M119 HydrophobicContact CE3-CE 3.51Å; W36-M119 HydrophobicContact CE3-CG 4.23Å; W36-M119 HydrophobicContact CE3-SD 4.2Å; W36-M119 HydrophobicContact CG-CE 4.29Å; W36-M119 HydrophobicContact CH2-CG 4.22Å; W36-M119 HydrophobicContact CZ3-CE 3.91Å; W36-M119 HydrophobicContact CZ3-CG 3.69Å; W36-M119 HydrophobicContact CZ3-SD 4.27Å
37	A	94.9	Very high	91	Very high	4 Å²	4	49.8 Å²	49.8	3%	0.033	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.7	107.1	167.6	0	0	0	0	0	108.3	I63 V64 D65	A37-I63 WeakPolarHBondContact O-CA 3.48Å; A37-V64 HydrophobicContact CB-CG2 3.75Å; A37-V64 WeakPolarHBondContact O-CG2 3.37Å; A37-V64 PolarHBondContact O-N 3.04Å; A37-D65 HydrophobicContact CB-CB 3.95Å; A37-D65 WeakPolarHBondContact CB-O 3.4Å; A37-D65 PolarHBondContact N-O 3.48Å
38	L	95.4	Very high	90.8	Very high	11 Å²	11	52.2 Å²	52.2	6%	0.058	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	142.6	-179.1	-68.1	174	0	0	0	110.6	L27 W36 A61 V62 I63 M119	L27-L38 HydrophobicContact CB-CB 4.49Å; L27-L38 HydrophobicContact CD1-CB 3.99Å; L27-L38 WeakPolarHBondContact CD1-O 3.11Å; L27-L38 HydrophobicContact CD2-CB 3.98Å; L27-L38 HydrophobicContact CD2-CD1 4.23Å; L27-L38 HydrophobicContact CG-CB 4.38Å; W36-L38 HydrophobicContact CB-CD2 4.46Å; W36-L38 HydrophobicContact CB-CG 4.48Å; W36-L38 PolarHBondContact O-N 2.05Å; L38-A61 HydrophobicContact CB-CB 4.34Å; L38-A61 HydrophobicContact CD2-CB 4.18Å; L38-V62 WeakPolarHBondContact CA-O 3.11Å; L38-I63 HydrophobicContact CD2-CG1 3.76Å; L38-M119 HydrophobicContact CD2-CE 4.26Å
39	K	95.7	Very high	90.7	Very high	107 Å²	107	51.7 Å²	51.7	47%	0.465	29%	0.291	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	133.1	168.1	-169.8	173.2	-177.2	176.2	0	108.6	S41 A61 V62 V64	K39-S41 PolarHBondContact O-N 3.49Å; K39-A61 CarbonylContact O-C 3.58Å; K39-A61 VanDerWaalsContact O-CA 3.24Å; K39-A61 WeakPolarHBondContact O-CA 3.49Å; K39-V62 HydrophobicContact CB-CG2 4.33Å; K39-V62 PolarHBondContact N-O 2.86Å; K39-V62 PolarHBondContact O-N 2.91Å; K39-V64 HydrophobicContact CB-CG1 3.67Å; K39-V64 HydrophobicContact CD-CG1 4.11Å
40	S	96.1	Very high	90.5	Very high	4 Å²	4	57.5 Å²	57.5	3%	0.028	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.3	142.9	174.2	66.5	0	0	0	0	109.5	K20 D24 N60	K20-S40 WeakPolarHBondContact CG-OG 3.09Å; K20-S40 VanDerWaalsContact NZ-C 3.25Å; K20-S40 PolarHBondContact NZ-O 3.35Å; K20-S40 PolarHBondContact NZ-OG 3.25Å; D24-S40 VanDerWaalsContact OD1-CB 3.22Å; D24-S40 WeakPolarHBondContact OD1-CB 3.4Å; D24-S40 PolarHBondContact OD1-N 2.75Å; D24-S40 PolarHBondContact OD1-OG 3.45Å; S40-N60 CarbonylContact C-O 3.59Å; S40-N60 WeakPolarHBondContact CA-O 3.34Å
41	S	95.1	Very high	90.4	Very high	41 Å²	41	63.5 Å²	63.5	29%	0.287	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	-60.7	169.7	63.8	0	0	0	0	109.6	K20 K39 N60 E99	K20-S41 PolarHBondContact NZ-O 2.85Å; K39-S41 PolarHBondContact O-N 3.49Å; S41-N60 PolarHBondContact N-O 2.78Å; S41-N60 WeakPolarHBondContact OG-CB 3.45Å; S41-N60 PolarHBondContact OG-O 2.92Å; S41-E99 VanDerWaalsContact CB-OE1 3.25Å; S41-E99 WeakPolarHBondContact CB-OE1 3.44Å; S41-E99 VanDerWaalsContact OG-CD 3.27Å; S41-E99 PolarHBondContact OG-OE1 2.9Å
42	N	93.6	Very high	90.5	Very high	82 Å²	82	64 Å²	64	44%	0.439	35%	0.352	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	130.8	-174.6	-175.5	29.5	0	0	0	112.3	F59 N60	N42-F59 CarbonylContact O-C 3.6Å; N42-F59 WeakPolarHBondContact O-CA 3.48Å; N42-F59 VanDerWaalsContact O-CB 3.24Å; N42-F59 WeakPolarHBondContact O-CB 3.22Å; N42-N60 HydrophobicContact CB-CB 4.45Å; N42-N60 PolarHBondContact O-N 2.95Å
43	I	95.1	Very high	91	Very high	5 Å²	5	57.4 Å²	57.4	3%	0.026	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.5	117.5	173	-56.4	-57.2	0	0	0	108.6	P10 I16 A19 K20 V23 V46 I57 F59	P10-I43 HydrophobicContact CG-CG2 4.22Å; I16-I43 HydrophobicContact CG2-CB 4.4Å; I16-I43 HydrophobicContact CG2-CG1 4.35Å; A19-I43 HydrophobicContact CB-CG1 4.37Å; A19-I43 HydrophobicContact CB-CG2 4.34Å; K20-I43 HydrophobicContact CB-CG1 4.32Å; V23-I43 HydrophobicContact CG2-CD1 4.36Å; I43-V46 HydrophobicContact CG2-CG2 3.49Å; I43-V46 VanDerWaalsContact CG2-CG2 3.49Å; I43-I57 HydrophobicContact CD1-CG2 4.16Å; I43-I57 HydrophobicContact CG2-CG2 4.01Å; I43-F59 HydrophobicContact CD1-CB 3.66Å; I43-F59 HydrophobicContact CD1-CG 4.4Å
44	T	93.8	Very high	91.7	Very high	40 Å²	40	56.3 Å²	56.3	25%	0.245	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	-29.5	-176	57.9	0	0	0	0	112.8	P9 P10 L58	P9-T44 WeakPolarHBondContact CA-O 3.31Å; P10-T44 WeakPolarHBondContact CD-O 3.46Å; T44-L58 PolarHBondContact N-O 3.35Å; T44-L58 VanDerWaalsContact OG1-CB 3.27Å; T44-L58 WeakPolarHBondContact OG1-CB 3.48Å; T44-L58 PolarHBondContact OG1-O 3.49Å; T44-L58 VanDerWaalsContact OG1-O 3.08Å
45	V	94.3	Very high	92.3	Very high	18 Å²	18	57 Å²	57	11%	0.109	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.2	140.2	176.1	178.1	0	0	0	0	109.9	D7 K47 I57 L58	D7-V45 HydrophobicContact CB-CG1 4.27Å; D7-V45 HydrophobicContact CB-CG2 3.9Å; V45-K47 HydrophobicContact CG1-CB 4.17Å; V45-I57 CarbonylContact O-C 3.57Å; V45-I57 VanDerWaalsContact O-CA 3.28Å; V45-I57 WeakPolarHBondContact O-CA 3.35Å; V45-L58 HydrophobicContact CB-CB 3.86Å; V45-L58 HydrophobicContact CB-CD1 4.09Å; V45-L58 HydrophobicContact CB-CG 3.93Å; V45-L58 HydrophobicContact CG2-CB 4.17Å; V45-L58 HydrophobicContact CG2-CD1 3.85Å; V45-L58 HydrophobicContact CG2-CG 4.23Å; V45-L58 PolarHBondContact N-O 2.86Å; V45-L58 VanDerWaalsContact N-O 3.13Å; V45-L58 PolarHBondContact O-N 2.99Å
46	V	93.5	Very high	92.6	Very high	48 Å²	48	58.8 Å²	58.8	29%	0.291	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.9	112.3	166	-177.7	0	0	0	0	108	P10 V15 A19 I43 L55 I57	P10-V46 HydrophobicContact CG-CG2 4.23Å; V15-V46 HydrophobicContact CG1-CB 4.44Å; V15-V46 HydrophobicContact CG1-CG1 4.32Å; V15-V46 HydrophobicContact CG1-CG2 4.41Å; A19-V46 HydrophobicContact CB-CG2 3.79Å; I43-V46 HydrophobicContact CG2-CG2 3.49Å; I43-V46 VanDerWaalsContact CG2-CG2 3.49Å; V46-L55 HydrophobicContact CG1-CD1 4.02Å; V46-I57 HydrophobicContact CG2-CG2 4.48Å
47	K	91.7	Very high	92.8	Very high	111 Å²	111	56.9 Å²	56.9	48%	0.483	31%	0.309	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.3	122.8	-175.1	-176.2	175	-174.1	168	0	111	D7 V45 I56	D7-K47 IonicContact OD2-NZ 3.96Å; V45-K47 HydrophobicContact CG1-CB 4.17Å; K47-I56 HydrophobicContact CB-CB 4.4Å; K47-I56 PolarHBondContact N-O 2.98Å; K47-I56 PolarHBondContact O-N 2.82Å
48	G	90.3	Very high	92.8	Very high	58 Å²	58	59.8 Å²	59.8	60%	0.598	32%	0.324	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.7	137.4	173.7	0	0	0	0	0	112.1	Q54	G48-Q54 CarbonylContact C-O 3.56Å; G48-Q54 WeakPolarHBondContact CA-O 3.49Å
49	N	89.1	Confident	92.9	Very high	71 Å²	71	59.4 Å²	59.4	38%	0.38	32%	0.321	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	104.1	163.8	-177.6	-20.4	0	0	0	108.6	L51 A52 G53 Q54	N49-L51 PolarHBondContact O-N 3.22Å; N49-L51 PolarHBondContact OD1-N 3.01Å; N49-L51 VanDerWaalsContact OD1-N 3.1Å; N49-A52 HydrophobicContact CB-CB 4.21Å; N49-A52 PolarHBondContact OD1-N 2.72Å; N49-G53 WeakPolarHBondContact O-CA 3.44Å; N49-G53 PolarHBondContact O-N 3.19Å; N49-Q54 HydrophobicContact CB-CB 4.32Å; N49-Q54 PolarHBondContact N-O 2.82Å; N49-Q54 PolarHBondContact O-N 3.19Å
50	K	85.5	Confident	92.9	Very high	204 Å²	204	56 Å²	56	89%	0.887	31%	0.308	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.3	-40.3	-178.3	-72.1	-176.9	179.7	178	0	112.7	G53	K50-G53 PolarHBondContact O-N 3.17Å
51	L	85.4	Confident	93	Very high	164 Å²	164	55.8 Å²	55.8	86%	0.859	31%	0.307	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.9	-41.7	-177.5	-70.5	170.2	0	0	0	111.5	N49 G53	N49-L51 PolarHBondContact O-N 3.22Å; N49-L51 PolarHBondContact OD1-N 3.01Å; N49-L51 VanDerWaalsContact OD1-N 3.1Å; L51-G53 VanDerWaalsContact C-N 3.31Å
52	A	89.2	Confident	93	Very high	34 Å²	34	56.1 Å²	56.1	28%	0.281	31%	0.307	S	S	.	.	T	Hydrogen-bonded Turn	trans	-84.8	-4.6	177.6	0	0	0	0	0	113.3	N49 Q54 Y109	N49-A52 HydrophobicContact CB-CB 4.21Å; N49-A52 PolarHBondContact OD1-N 2.72Å; A52-Q54 HydrophobicContact CB-CB 4.32Å; A52-Q54 HydrophobicContact CB-CG 3.97Å; A52-Q54 PolarHBondContact O-N 3Å; A52-Y109 VanDerWaalsContact C-CE2 3.4Å; A52-Y109 WeakPolarHBondContact O-CD2 3.04Å; A52-Y109 VanDerWaalsContact O-CE2 3.23Å; A52-Y109 WeakPolarHBondContact O-CE2 3.48Å
53	G	91.7	Very high	93.1	Very high	12 Å²	12	52.8 Å²	52.8	12%	0.124	29%	0.289	C	S	.	.	T	Hydrogen-bonded Turn	trans	58.8	31.2	-173.7	0	0	0	0	0	113.2	N49 K50 L51 K108	N49-G53 WeakPolarHBondContact O-CA 3.44Å; N49-G53 PolarHBondContact O-N 3.19Å; K50-G53 PolarHBondContact O-N 3.17Å; L51-G53 VanDerWaalsContact C-N 3.31Å; G53-K108 WeakPolarHBondContact O-CB 3.21Å; G53-K108 PolarHBondContact O-N 2.88Å
54	Q	93.5	Very high	93.1	Very high	70 Å²	70	56.1 Å²	56.1	33%	0.327	31%	0.31	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	145.9	-173.4	-73.8	172.8	-12.5	0	0	112.2	G48 N49 A52 L105 Y106	G48-Q54 CarbonylContact C-O 3.56Å; G48-Q54 WeakPolarHBondContact CA-O 3.49Å; N49-Q54 HydrophobicContact CB-CB 4.32Å; N49-Q54 PolarHBondContact N-O 2.82Å; N49-Q54 PolarHBondContact O-N 3.19Å; A52-Q54 HydrophobicContact CB-CB 4.32Å; A52-Q54 HydrophobicContact CB-CG 3.97Å; A52-Q54 PolarHBondContact O-N 3Å; Q54-L105 HydrophobicContact CB-CD1 4.12Å; Q54-L105 HydrophobicContact CG-CD1 4.19Å; Q54-Y106 CarbonylContact C-O 3.54Å; Q54-Y106 VanDerWaalsContact CA-O 3.29Å; Q54-Y106 WeakPolarHBondContact CA-O 3.22Å
55	L	93.9	Very high	93.1	Very high	50 Å²	50	58.2 Å²	58.2	26%	0.262	32%	0.319	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.9	123.8	169.5	176.9	65.1	0	0	0	108.4	F22 V46 I57 Y106	F22-L55 HydrophobicContact CD1-CD2 4.46Å; F22-L55 HydrophobicContact CE1-CD2 4.19Å; V46-L55 HydrophobicContact CG1-CD1 4.02Å; L55-I57 HydrophobicContact CD1-CG1 4.41Å; L55-I57 HydrophobicContact CD2-CD1 4.01Å; L55-I57 HydrophobicContact CD2-CG1 4.36Å; L55-I57 HydrophobicContact CG-CD1 4.27Å; L55-I57 HydrophobicContact CG-CG1 4.06Å; L55-Y106 HydrophobicContact CB-CD1 4.3Å; L55-Y106 PolarHBondContact N-O 3.31Å; L55-Y106 PolarHBondContact O-N 2.71Å
56	I	94.6	Very high	93.1	Very high	58 Å²	58	58.8 Å²	58.8	30%	0.297	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110	124.1	176.9	-58.5	165.5	0	0	0	107.4	K47 L104 L105	K47-I56 HydrophobicContact CB-CB 4.4Å; K47-I56 PolarHBondContact N-O 2.98Å; K47-I56 PolarHBondContact O-N 2.82Å; I56-L104 WeakPolarHBondContact CA-O 3.32Å; I56-L105 HydrophobicContact CD1-CD1 4.39Å; I56-L105 HydrophobicContact CG1-CD1 3.59Å
57	I	95.4	Very high	93.1	Very high	2 Å²	2	57.1 Å²	57.1	1%	0.01	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	125.2	174.4	-54.2	176.4	0	0	0	108.3	A19 F22 V23 I43 V45 V46 L55 F59 S103 L104	A19-I57 HydrophobicContact CB-CD1 4.23Å; F22-I57 HydrophobicContact CD1-CD1 3.85Å; F22-I57 HydrophobicContact CE1-CD1 4.3Å; V23-I57 HydrophobicContact CG2-CB 4.27Å; V23-I57 HydrophobicContact CG2-CD1 3.76Å; V23-I57 HydrophobicContact CG2-CG2 3.83Å; I43-I57 HydrophobicContact CD1-CG2 4.16Å; I43-I57 HydrophobicContact CG2-CG2 4.01Å; V45-I57 CarbonylContact O-C 3.57Å; V45-I57 VanDerWaalsContact O-CA 3.28Å; V45-I57 WeakPolarHBondContact O-CA 3.35Å; V46-I57 HydrophobicContact CG2-CG2 4.48Å; L55-I57 HydrophobicContact CD1-CG1 4.41Å; L55-I57 HydrophobicContact CD2-CD1 4.01Å; L55-I57 HydrophobicContact CD2-CG1 4.36Å; L55-I57 HydrophobicContact CG-CD1 4.27Å; L55-I57 HydrophobicContact CG-CG1 4.06Å; I57-F59 HydrophobicContact CG2-CD1 4.21Å; I57-S103 CarbonylContact O-C 3.51Å; I57-S103 WeakPolarHBondContact O-CA 3.34Å; I57-L104 HydrophobicContact CB-CB 4.41Å; I57-L104 HydrophobicContact CD1-CD2 4.49Å; I57-L104 PolarHBondContact N-O 2.97Å; I57-L104 PolarHBondContact O-N 2.78Å
58	L	96.2	Very high	93.2	Very high	66 Å²	66	51.8 Å²	51.8	35%	0.346	29%	0.291	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	137.9	167	-55	-176.3	0	0	0	108.5	T44 V45 C102 S103	T44-L58 PolarHBondContact N-O 3.35Å; T44-L58 VanDerWaalsContact OG1-CB 3.27Å; T44-L58 WeakPolarHBondContact OG1-CB 3.48Å; T44-L58 PolarHBondContact OG1-O 3.49Å; T44-L58 VanDerWaalsContact OG1-O 3.08Å; V45-L58 HydrophobicContact CB-CB 3.86Å; V45-L58 HydrophobicContact CB-CD1 4.09Å; V45-L58 HydrophobicContact CB-CG 3.93Å; V45-L58 HydrophobicContact CG2-CB 4.17Å; V45-L58 HydrophobicContact CG2-CD1 3.85Å; V45-L58 HydrophobicContact CG2-CG 4.23Å; V45-L58 PolarHBondContact N-O 2.86Å; V45-L58 VanDerWaalsContact N-O 3.13Å; V45-L58 PolarHBondContact O-N 2.99Å; L58-C102 WeakPolarHBondContact CA-O 3.29Å; L58-S103 VanDerWaalsContact CD2-CB 3.46Å
59	F	96.4	Very high	93.3	Very high	2 Å²	2	56.3 Å²	56.3	1%	0.009	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.3	159.3	-176	63.3	-77.4	0	0	0	111.3	V23 L27 N42 I43 I57 A61 C102 L104 L115	V23-F59 HydrophobicContact CG1-CD1 4.1Å; V23-F59 HydrophobicContact CG1-CD2 3.8Å; V23-F59 HydrophobicContact CG1-CE1 3.79Å; V23-F59 HydrophobicContact CG1-CE2 3.45Å; V23-F59 VanDerWaalsContact CG1-CE2 3.45Å; V23-F59 HydrophobicContact CG1-CG 4.11Å; V23-F59 HydrophobicContact CG1-CZ 3.44Å; V23-F59 VanDerWaalsContact CG1-CZ 3.44Å; V23-F59 HydrophobicContact CG2-CD1 4.35Å; V23-F59 HydrophobicContact CG2-CE1 4.39Å; L27-F59 HydrophobicContact CD1-CE2 4.03Å; L27-F59 HydrophobicContact CD2-CE2 4.18Å; L27-F59 HydrophobicContact CD2-CZ 4.03Å; N42-F59 CarbonylContact O-C 3.6Å; N42-F59 WeakPolarHBondContact O-CA 3.48Å; N42-F59 VanDerWaalsContact O-CB 3.24Å; N42-F59 WeakPolarHBondContact O-CB 3.22Å; I43-F59 HydrophobicContact CD1-CB 3.66Å; I43-F59 HydrophobicContact CD1-CG 4.4Å; I57-F59 HydrophobicContact CG2-CD1 4.21Å; F59-A61 HydrophobicContact CD2-CB 4.25Å; F59-A61 HydrophobicContact CE2-CB 3.97Å; F59-C102 HydrophobicContact CD1-CB 4.1Å; F59-C102 HydrophobicContact CD2-CB 4.01Å; F59-C102 HydrophobicContact CE1-CB 3.64Å; F59-C102 HydrophobicContact CE2-CB 3.56Å; F59-C102 HydrophobicContact CG-CB 4.27Å; F59-C102 HydrophobicContact CZ-CB 3.36Å; F59-C102 PolarHBondContact N-O 2.81Å; F59-C102 WeakPolarHBondContact O-CA 3.47Å; F59-C102 PolarHBondContact O-N 3.41Å; F59-C102 VanDerWaalsContact O-O 3.1Å; F59-L104 HydrophobicContact CE1-CB 3.97Å; F59-L115 HydrophobicContact CE1-CD1 4.24Å; F59-L115 HydrophobicContact CZ-CD1 3.72Å
60	N	96.8	Very high	93.4	Very high	36 Å²	36	54.7 Å²	54.7	19%	0.193	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	145.5	164.4	-72	-9.3	0	0	0	109.3	S40 S41 N42 E99 H100	S40-N60 CarbonylContact C-O 3.59Å; S40-N60 WeakPolarHBondContact CA-O 3.34Å; S41-N60 PolarHBondContact N-O 2.78Å; S41-N60 WeakPolarHBondContact OG-CB 3.45Å; S41-N60 PolarHBondContact OG-O 2.92Å; N42-N60 HydrophobicContact CB-CB 4.45Å; N42-N60 PolarHBondContact O-N 2.95Å; N60-E99 HydrophobicContact CB-CB 4.14Å; N60-E99 PolarHBondContact ND2-OE2 2.87Å; N60-H100 CarbonylContact C-O 3.59Å; N60-H100 WeakPolarHBondContact CA-O 3.29Å
61	A	96.8	Very high	93.7	Very high	0 Å²	0	46 Å²	46	0%	0	25%	0.249	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	147.9	175.2	0	0	0	0	0	111.3	L38 K39 F59 E99 H100	L38-A61 HydrophobicContact CB-CB 4.34Å; L38-A61 HydrophobicContact CD2-CB 4.18Å; K39-A61 CarbonylContact O-C 3.58Å; K39-A61 VanDerWaalsContact O-CA 3.24Å; K39-A61 WeakPolarHBondContact O-CA 3.49Å; F59-A61 HydrophobicContact CD2-CB 4.25Å; F59-A61 HydrophobicContact CE2-CB 3.97Å; A61-E99 CarbonylContact O-C 3.57Å; A61-H100 PolarHBondContact N-O 3.46Å; A61-H100 PolarHBondContact O-N 3.48Å
62	V	96.5	Very high	94	Very high	47 Å²	47	41.3 Å²	41.3	29%	0.285	22%	0.224	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	150.7	170.6	-65.5	0	0	0	0	109.5	L38 K39 V64 E99	L38-V62 WeakPolarHBondContact CA-O 3.11Å; K39-V62 HydrophobicContact CB-CG2 4.33Å; K39-V62 PolarHBondContact N-O 2.86Å; K39-V62 PolarHBondContact O-N 2.91Å; V62-V64 HydrophobicContact CG2-CG1 4.38Å; V62-E99 HydrophobicContact CG1-CG 4.11Å
63	I	95.4	Very high	94.1	Very high	13 Å²	13	45.8 Å²	45.8	7%	0.067	24%	0.238	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-84.4	115.9	171.3	-59	168.9	0	0	0	107.6	W36 A37 L38 D65 C66 I94 M96 H100 M119	W36-I63 HydrophobicContact CB-CD1 4.25Å; W36-I63 HydrophobicContact CB-CG1 4.09Å; W36-I63 HydrophobicContact CB-CG2 4.07Å; W36-I63 HydrophobicContact CG-CD1 3.94Å; W36-I63 HydrophobicContact CG-CG1 4.33Å; A37-I63 WeakPolarHBondContact O-CA 3.48Å; L38-I63 HydrophobicContact CD2-CG1 3.76Å; I63-D65 VanDerWaalsContact CG2-O 3.29Å; I63-D65 WeakPolarHBondContact CG2-O 3.27Å; I63-C66 HydrophobicContact CG2-CB 4.19Å; I63-I94 HydrophobicContact CD1-CD1 4.14Å; I63-I94 HydrophobicContact CD1-CG1 3.37Å; I63-M96 HydrophobicContact CB-CE 4.18Å; I63-M96 HydrophobicContact CB-SD 4.16Å; I63-M96 HydrophobicContact CD1-SD 3.94Å; I63-M96 HydrophobicContact CG2-CE 3.47Å; I63-M96 VanDerWaalsContact CG2-CE 3.47Å; I63-M96 HydrophobicContact CG2-SD 3.69Å; I63-H100 WeakPolarHBondContact CD1-NE2 3.38Å; I63-M119 HydrophobicContact CD1-CE 3.9Å; I63-M119 HydrophobicContact CG1-CE 4.29Å
64	V	95	Very high	94	Very high	75 Å²	75	48.1 Å²	48.1	46%	0.455	25%	0.246	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-86.3	-36.9	176.6	-67.1	0	0	0	0	111.8	A37 K39 V62	A37-V64 HydrophobicContact CB-CG2 3.75Å; A37-V64 WeakPolarHBondContact O-CG2 3.37Å; A37-V64 PolarHBondContact O-N 3.04Å; K39-V64 HydrophobicContact CB-CG1 3.67Å; K39-V64 HydrophobicContact CD-CG1 4.11Å; V62-V64 HydrophobicContact CG2-CG1 4.38Å
65	D	94.7	Very high	93.9	Very high	84 Å²	84	45.8 Å²	45.8	45%	0.449	24%	0.237	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-142.2	144.4	177.3	-72.3	-55.1	0	0	0	109.8	A37 I63	A37-D65 HydrophobicContact CB-CB 3.95Å; A37-D65 WeakPolarHBondContact CB-O 3.4Å; A37-D65 PolarHBondContact N-O 3.48Å; I63-D65 VanDerWaalsContact CG2-O 3.29Å; I63-D65 WeakPolarHBondContact CG2-O 3.27Å
66	C	93.3	Very high	93.7	Very high	30 Å²	30	50.1 Å²	50.1	20%	0.203	26%	0.256	C	S	.	.	S	Bend	trans	-138.9	125.6	167.9	-169.2	0	0	0	0	110.8	W36 I63 C89 M96	W36-C66 PolarHBondContact NE1-SG 3.08Å; W36-C66 VanDerWaalsContact NE1-SG 3.41Å; I63-C66 HydrophobicContact CG2-CB 4.19Å; C66-C89 HydrophobicContact CB-CB 3.74Å; C66-C89 WeakPolarHBondContact CB-SG 3.42Å; C66-C89 PolarHBondContact O-SG 2.58Å; C66-C89 WeakPolarHBondContact SG-CA 3.1Å; C66-C89 WeakPolarHBondContact SG-CB 3.28Å; C66-C89 CovalentContact SG-SG 2.02Å; C66-C89 PolarHBondContact SG-SG 2.86Å; C66-M96 HydrophobicContact CB-CE 3.6Å; C66-M96 HydrophobicContact CB-SD 3.66Å
67	P	93.9	Very high	93.5	Very high	12 Å²	12	54.1 Å²	54.1	8%	0.078	28%	0.275	C	S	.	.	S	Bend	cis	-75.6	165.4	-6.3	27.2	-27	0	0	0	111.5	T35 Q71 I72 P85 K86 C89	T35-P67 HydrophobicContact CG2-CB 3.82Å; T35-P67 CarbonylContact O-C 3.32Å; T35-P67 WeakPolarHBondContact O-CA 3.35Å; P67-Q71 HydrophobicContact CB-CB 4.17Å; P67-I72 HydrophobicContact CB-CG1 4.44Å; P67-I72 HydrophobicContact CG-CD1 4.28Å; P67-I72 HydrophobicContact CG-CG1 3.7Å; P67-P85 HydrophobicContact CB-CB 3.64Å; P67-P85 HydrophobicContact CB-CG 4.05Å; P67-P85 HydrophobicContact CG-CB 3.94Å; P67-P85 HydrophobicContact CG-CG 3.85Å; P67-K86 HydrophobicContact CG-CG 4.22Å; P67-C89 VanDerWaalsContact CD-SG 3.51Å
68	S	94	Very high	93.2	Very high	0 Å²	0	58.1 Å²	58.1	0%	0	30%	0.296	C	S	.	.			trans	-62	154.2	175.1	75.4	0	0	0	0	111	T35 T70 Q71 I72	T35-S68 PolarHBondContact O-N 2.71Å; S68-T70 PolarHBondContact O-N 2.87Å; S68-Q71 PolarHBondContact O-N 2.81Å; S68-Q71 WeakPolarHBondContact OG-CB 3.35Å; S68-Q71 WeakPolarHBondContact OG-CG 3.5Å; S68-Q71 PolarHBondContact OG-N 3.45Å; S68-I72 WeakPolarHBondContact O-CG1 3.24Å; S68-I72 PolarHBondContact O-N 3.38Å
69	K	92.2	Very high	92.4	Very high	152 Å²	152	62.7 Å²	62.7	66%	0.661	31%	0.313	S	S	*	.	H	α-helix	trans	-58.4	-35.2	177.6	-69.6	-178.5	-178.4	175.3	0	111.7	K73	K69-K73 WeakPolarHBondContact O-CG 3.41Å; K69-K73 PolarHBondContact O-N 2.93Å; K69-K73 VanDerWaalsContact O-N 3.17Å
70	T	91.6	Very high	91.8	Very high	38 Å²	38	72.9 Å²	72.9	23%	0.233	36%	0.358	C	S	.	.	H	α-helix	trans	-62.2	-43.8	175.2	-57.9	0	0	0	0	111.2	E31 K32 S68 K73 M74	E31-T70 HydrophobicContact CB-CG2 4.14Å; E31-T70 WeakPolarHBondContact OE2-CB 3.4Å; E31-T70 PolarHBondContact OE2-OG1 3.25Å; K32-T70 HydrophobicContact CB-CG2 4.46Å; K32-T70 HydrophobicContact CG-CG2 3.71Å; S68-T70 PolarHBondContact O-N 2.87Å; T70-K73 PolarHBondContact O-N 2.84Å; T70-M74 HydrophobicContact CG2-SD 4.23Å; T70-M74 WeakPolarHBondContact O-CG 3.49Å; T70-M74 PolarHBondContact O-N 3.3Å
71	Q	91.7	Very high	91.2	Very high	22 Å²	22	75.4 Å²	75.4	10%	0.103	38%	0.384	C	S	.	.	H	α-helix	trans	-70.6	-37.4	-178.8	-69.8	-82.1	-31.7	0	0	112.5	E31 K32 V34 P67 S68 M74 S75 P85	E31-Q71 WeakPolarHBondContact O-CG 3.37Å; E31-Q71 PolarHBondContact O-NE2 3.47Å; K32-Q71 PolarHBondContact O-NE2 3.01Å; V34-Q71 VanDerWaalsContact O-CG 3.27Å; V34-Q71 WeakPolarHBondContact O-CG 3.46Å; V34-Q71 PolarHBondContact O-NE2 3.21Å; P67-Q71 HydrophobicContact CB-CB 4.17Å; S68-Q71 PolarHBondContact O-N 2.81Å; S68-Q71 WeakPolarHBondContact OG-CB 3.35Å; S68-Q71 WeakPolarHBondContact OG-CG 3.5Å; S68-Q71 PolarHBondContact OG-N 3.45Å; Q71-M74 PolarHBondContact O-N 3.28Å; Q71-S75 WeakPolarHBondContact O-CB 3.25Å; Q71-S75 PolarHBondContact O-N 3.27Å; Q71-S75 PolarHBondContact O-OG 2.87Å; Q71-P85 HydrophobicContact CB-CB 4.25Å
72	I	91.8	Very high	90.4	Very high	64 Å²	64	78.6 Å²	78.6	33%	0.328	40%	0.403	S	S	.	.	H	α-helix	trans	-56.1	-55.1	171.5	-64.9	170.5	0	0	0	109.4	P67 S68 M74 S75 E76	P67-I72 HydrophobicContact CB-CG1 4.44Å; P67-I72 HydrophobicContact CG-CD1 4.28Å; P67-I72 HydrophobicContact CG-CG1 3.7Å; S68-I72 WeakPolarHBondContact O-CG1 3.24Å; S68-I72 PolarHBondContact O-N 3.38Å; I72-M74 VanDerWaalsContact C-N 3.34Å; I72-M74 PolarHBondContact O-N 3.27Å; I72-S75 PolarHBondContact O-N 3.3Å; I72-S75 VanDerWaalsContact O-N 3.14Å; I72-S75 PolarHBondContact O-OG 3.13Å; I72-E76 WeakPolarHBondContact O-CG 3.08Å; I72-E76 PolarHBondContact O-N 3.08Å
73	K	91.6	Very high	89.7	Confident	129 Å²	129	84.9 Å²	84.9	56%	0.561	43%	0.427	S	S	*	.	H	α-helix	trans	-58.4	-43.7	180	-72.9	179.2	179.2	-175.9	0	112.5	K69 T70 E76 M77	K69-K73 WeakPolarHBondContact O-CG 3.41Å; K69-K73 PolarHBondContact O-N 2.93Å; K69-K73 VanDerWaalsContact O-N 3.17Å; T70-K73 PolarHBondContact O-N 2.84Å; K73-E76 PolarHBondContact O-N 2.83Å; K73-M77 HydrophobicContact CB-CE 3.92Å; K73-M77 WeakPolarHBondContact O-CE 3.43Å; K73-M77 WeakPolarHBondContact O-CG 3.47Å; K73-M77 PolarHBondContact O-N 3.03Å; K73-M77 VanDerWaalsContact O-N 3.08Å
74	M	89.1	Confident	89.4	Confident	60 Å²	60	88.4 Å²	88.4	30%	0.296	45%	0.446	S	S	.	.	H	α-helix	trans	-64.3	-41.1	177.6	-74.8	-175.3	65.3	0	0	112.1	K32 T70 Q71 I72 E76 M77 L78	K32-M74 HydrophobicContact CB-SD 4.1Å; K32-M74 HydrophobicContact CG-SD 4.14Å; T70-M74 HydrophobicContact CG2-SD 4.23Å; T70-M74 WeakPolarHBondContact O-CG 3.49Å; T70-M74 PolarHBondContact O-N 3.3Å; Q71-M74 PolarHBondContact O-N 3.28Å; I72-M74 VanDerWaalsContact C-N 3.34Å; I72-M74 PolarHBondContact O-N 3.27Å; M74-E76 VanDerWaalsContact C-N 3.31Å; M74-E76 PolarHBondContact O-N 3.48Å; M74-M77 PolarHBondContact O-N 3.19Å; M74-L78 WeakPolarHBondContact O-CB 3.43Å; M74-L78 PolarHBondContact O-N 3.25Å
75	S	90.2	Very high	89.1	Confident	22 Å²	22	85 Å²	85	15%	0.154	43%	0.425	C	S	.	.	H	α-helix	trans	-66	-32.8	177.7	74.2	0	0	0	0	112.8	Q71 I72 K79	Q71-S75 WeakPolarHBondContact O-CB 3.25Å; Q71-S75 PolarHBondContact O-N 3.27Å; Q71-S75 PolarHBondContact O-OG 2.87Å; I72-S75 PolarHBondContact O-N 3.3Å; I72-S75 VanDerWaalsContact O-N 3.14Å; I72-S75 PolarHBondContact O-OG 3.13Å; S75-K79 WeakPolarHBondContact O-CA 3.48Å; S75-K79 WeakPolarHBondContact O-CB 3.39Å; S75-K79 PolarHBondContact O-N 3.13Å
76	E	90.3	Very high	89	Confident	140 Å²	140	87.5 Å²	87.5	65%	0.654	43%	0.432	S	S	*	.	H	α-helix	trans	-69.2	-44.7	174.3	-71.1	171.8	168.4	0	0	111.2	I72 K73 M74 L78	I72-E76 WeakPolarHBondContact O-CG 3.08Å; I72-E76 PolarHBondContact O-N 3.08Å; K73-E76 PolarHBondContact O-N 2.83Å; M74-E76 VanDerWaalsContact C-N 3.31Å; M74-E76 PolarHBondContact O-N 3.48Å; E76-L78 PolarHBondContact O-N 2.84Å
77	M	90.5	Very high	88.8	Confident	142 Å²	142	89.4 Å²	89.4	70%	0.7	44%	0.44	S	S	*	.	H	α-helix	trans	-68	-32.9	178.8	-74.7	-177.4	-91.9	0	0	113.3	K73 M74	K73-M77 HydrophobicContact CB-CE 3.92Å; K73-M77 WeakPolarHBondContact O-CE 3.43Å; K73-M77 WeakPolarHBondContact O-CG 3.47Å; K73-M77 PolarHBondContact O-N 3.03Å; K73-M77 VanDerWaalsContact O-N 3.08Å; M74-M77 PolarHBondContact O-N 3.19Å
78	L	88.6	Confident	88.7	Confident	86 Å²	86	91.9 Å²	91.9	45%	0.45	45%	0.453	S	S	.	.	T	Hydrogen-bonded Turn	trans	-120.8	30.9	-172	-59	172.9	0	0	0	112.3	M74 E76 F80 A81 V82	M74-L78 WeakPolarHBondContact O-CB 3.43Å; M74-L78 PolarHBondContact O-N 3.25Å; E76-L78 PolarHBondContact O-N 2.84Å; L78-F80 PolarHBondContact O-N 2.83Å; L78-A81 PolarHBondContact O-N 2.96Å; L78-V82 HydrophobicContact CB-CG2 3.45Å; L78-V82 VanDerWaalsContact CB-CG2 3.45Å; L78-V82 HydrophobicContact CD1-CG2 4.14Å; L78-V82 HydrophobicContact CG-CG2 4.46Å; L78-V82 WeakPolarHBondContact O-CG2 3.36Å; L78-V82 PolarHBondContact O-N 3.23Å
79	K	81.1	Confident	88.6	Confident	162 Å²	162	93.3 Å²	93.3	70%	0.704	46%	0.462	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.1	-29.9	-170.6	-167.3	175.8	179.4	-179.5	0	115.1	S75	S75-K79 WeakPolarHBondContact O-CA 3.48Å; S75-K79 WeakPolarHBondContact O-CB 3.39Å; S75-K79 PolarHBondContact O-N 3.13Å
80	F	83.8	Confident	88.6	Confident	217 Å²	217	90.7 Å²	90.7	95%	0.952	45%	0.451	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81	-19.2	178.7	-59.7	-76.3	0	0	0	114.1	L78	L78-F80 PolarHBondContact O-N 2.83Å
81	A	83.4	Confident	88.5	Confident	88 Å²	88	93.6 Å²	93.6	73%	0.727	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	trans	-111.1	-15.4	-173.5	0	0	0	0	0	113.4	L78	L78-A81 PolarHBondContact O-N 2.96Å
82	V	80.2	Confident	88.5	Confident	67 Å²	67	97 Å²	97	41%	0.406	49%	0.49	S	S	.	.	S	Bend	trans	-125.2	136.9	-173.3	-156.4	0	0	0	0	109.8	L78	L78-V82 HydrophobicContact CB-CG2 3.45Å; L78-V82 VanDerWaalsContact CB-CG2 3.45Å; L78-V82 HydrophobicContact CD1-CG2 4.14Å; L78-V82 HydrophobicContact CG-CG2 4.46Å; L78-V82 WeakPolarHBondContact O-CG2 3.36Å; L78-V82 PolarHBondContact O-N 3.23Å
83	K	82.1	Confident	88.6	Confident	179 Å²	179	95.8 Å²	95.8	78%	0.778	49%	0.485	S	S	*	.			trans	-61.5	154.6	173.8	-69.6	-176.6	177.6	-180	0	110.7	P85	K83-P85 VanDerWaalsContact O-CD 3.3Å; K83-P85 WeakPolarHBondContact O-CD 3.33Å; K83-P85 VanDerWaalsContact O-N 3.16Å
84	D	87.4	Confident	88.7	Confident	87 Å²	87	89.8 Å²	89.8	47%	0.465	46%	0.459	S	S	.	.			trans	-61.1	117	173.2	-173.5	-19.4	0	0	0	109.2	K86 D87	D84-K86 PolarHBondContact O-N 2.96Å; D84-K86 VanDerWaalsContact O-N 3.11Å; D84-K86 VanDerWaalsContact OD1-CB 3.24Å; D84-K86 WeakPolarHBondContact OD1-CB 3.43Å; D84-K86 WeakPolarHBondContact OD1-CG 3.27Å; D84-K86 PolarHBondContact OD1-N 2.62Å; D84-D87 WeakPolarHBondContact O-CB 3.24Å; D84-D87 PolarHBondContact O-N 3.1Å
85	P	90.7	Very high	89	Confident	5 Å²	5	89.6 Å²	89.6	3%	0.032	46%	0.459	C	S	.	.	G	3₁₀ helix	trans	-64.7	-17.6	-177.6	28.6	-36.9	0	0	0	112.5	T35 P67 Q71 K83 D87 N88 C89	T35-P85 HydrophobicContact CG2-CB 3.76Å; T35-P85 WeakPolarHBondContact CG2-O 3.5Å; P67-P85 HydrophobicContact CB-CB 3.64Å; P67-P85 HydrophobicContact CB-CG 4.05Å; P67-P85 HydrophobicContact CG-CB 3.94Å; P67-P85 HydrophobicContact CG-CG 3.85Å; Q71-P85 HydrophobicContact CB-CB 4.25Å; K83-P85 VanDerWaalsContact O-CD 3.3Å; K83-P85 WeakPolarHBondContact O-CD 3.33Å; K83-P85 VanDerWaalsContact O-N 3.16Å; P85-D87 PolarHBondContact O-N 3.05Å; P85-N88 PolarHBondContact O-N 2.78Å; P85-N88 VanDerWaalsContact O-N 3.13Å; P85-C89 PolarHBondContact O-SG 2.84Å
86	K	90.8	Very high	89.1	Confident	135 Å²	135	92 Å²	92	59%	0.587	47%	0.469	S	S	*	.	G	3₁₀ helix	trans	-62.7	-23.8	172.3	-67.1	-176.8	176.2	-178	0	113.1	P67 D84 N88 C89	P67-K86 HydrophobicContact CG-CG 4.22Å; D84-K86 PolarHBondContact O-N 2.96Å; D84-K86 VanDerWaalsContact O-N 3.11Å; D84-K86 VanDerWaalsContact OD1-CB 3.24Å; D84-K86 WeakPolarHBondContact OD1-CB 3.43Å; D84-K86 WeakPolarHBondContact OD1-CG 3.27Å; D84-K86 PolarHBondContact OD1-N 2.62Å; K86-N88 PolarHBondContact O-N 2.8Å; K86-C89 WeakPolarHBondContact O-CB 3.22Å; K86-C89 PolarHBondContact O-N 2.84Å
87	D	90.5	Very high	89.2	Confident	70 Å²	70	94.9 Å²	94.9	37%	0.374	48%	0.479	S	S	.	.	G	3₁₀ helix	trans	-62.6	-27.9	175.4	-78	-32.2	0	0	0	112.4	D84 P85 C89 K90	D84-D87 WeakPolarHBondContact O-CB 3.24Å; D84-D87 PolarHBondContact O-N 3.1Å; P85-D87 PolarHBondContact O-N 3.05Å; D87-C89 VanDerWaalsContact C-N 3.25Å; D87-C89 PolarHBondContact O-N 3.27Å; D87-K90 VanDerWaalsContact OD1-CE 3.23Å; D87-K90 WeakPolarHBondContact OD1-CE 3.27Å; D87-K90 IonicContact OD1-NZ 2.68Å; D87-K90 PolarHBondContact OD1-NZ 3.28Å
88	N	90.7	Very high	89.4	Confident	65 Å²	65	88.8 Å²	88.8	35%	0.348	45%	0.451	S	S	.	.	G	3₁₀ helix	trans	-81.9	-1.3	176	-63.6	-37.3	0	0	0	113.6	T35 W36 P85 K86 I94	T35-N88 HydrophobicContact CG2-CB 3.77Å; T35-N88 PolarHBondContact OG1-ND2 2.8Å; T35-N88 VanDerWaalsContact OG1-ND2 3.1Å; W36-N88 HydrophobicContact CZ2-CB 4.25Å; W36-N88 PolarHBondContact NE1-O 2.84Å; P85-N88 PolarHBondContact O-N 2.78Å; P85-N88 VanDerWaalsContact O-N 3.13Å; K86-N88 PolarHBondContact O-N 2.8Å; N88-I94 WeakPolarHBondContact O-CG2 3.33Å
89	C	92.6	Very high	89.8	Confident	29 Å²	29	88.9 Å²	88.9	20%	0.196	45%	0.45	C	S	.	.	G	3₁₀ helix	trans	-105.4	4.9	-177.1	-53	0	0	0	0	113.3	C66 P67 P85 K86 D87	C66-C89 HydrophobicContact CB-CB 3.74Å; C66-C89 WeakPolarHBondContact CB-SG 3.42Å; C66-C89 PolarHBondContact O-SG 2.58Å; C66-C89 WeakPolarHBondContact SG-CA 3.1Å; C66-C89 WeakPolarHBondContact SG-CB 3.28Å; C66-C89 CovalentContact SG-SG 2.02Å; C66-C89 PolarHBondContact SG-SG 2.86Å; P67-C89 VanDerWaalsContact CD-SG 3.51Å; P85-C89 PolarHBondContact O-SG 2.84Å; K86-C89 WeakPolarHBondContact O-CB 3.22Å; K86-C89 PolarHBondContact O-N 2.84Å; D87-C89 VanDerWaalsContact C-N 3.25Å; D87-C89 PolarHBondContact O-N 3.27Å
90	K	91.7	Very high	90.4	Very high	97 Å²	97	81.2 Å²	81.2	42%	0.422	42%	0.416	S	S	.	.	S	Bend	trans	-69.9	145.4	-179.5	-65.3	174.5	-178.1	162.8	0	110.7	D87 N92 V93 I94	D87-K90 VanDerWaalsContact OD1-CE 3.23Å; D87-K90 WeakPolarHBondContact OD1-CE 3.27Å; D87-K90 IonicContact OD1-NZ 2.68Å; D87-K90 PolarHBondContact OD1-NZ 3.28Å; K90-N92 VanDerWaalsContact CB-OD1 3.31Å; K90-N92 WeakPolarHBondContact CB-OD1 3.42Å; K90-N92 PolarHBondContact O-N 2.81Å; K90-N92 VanDerWaalsContact O-N 3.14Å; K90-V93 HydrophobicContact CB-CB 4.41Å; K90-V93 HydrophobicContact CB-CG2 3.99Å; K90-V93 WeakPolarHBondContact O-CB 3.43Å; K90-V93 PolarHBondContact O-N 3.32Å; K90-I94 PolarHBondContact O-N 2.95Å
91	P	90.4	Very high	91	Very high	100 Å²	100	73.8 Å²	73.8	65%	0.649	39%	0.39	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.6	-32.8	-178.4	-27.8	35.1	0	0	0	114.6	V93 G122	P91-V93 VanDerWaalsContact C-N 3.33Å; P91-G122 CarbonylContact O-C 3.48Å; P91-G122 VanDerWaalsContact O-C 3.32Å; P91-G122 WeakPolarHBondContact O-CA 3.44Å
92	N	91.9	Very high	91.6	Very high	94 Å²	94	70 Å²	70	50%	0.503	36%	0.358	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82	-9.5	177.8	66.5	-46.8	0	0	0	113.9	K90	K90-N92 VanDerWaalsContact CB-OD1 3.31Å; K90-N92 WeakPolarHBondContact CB-OD1 3.42Å; K90-N92 PolarHBondContact O-N 2.81Å; K90-N92 VanDerWaalsContact O-N 3.14Å
93	V	92.3	Very high	92.4	Very high	38 Å²	38	69 Å²	69	23%	0.23	35%	0.354	C	S	.	.	T	Hydrogen-bonded Turn	trans	-92.9	-45	178.8	176.6	0	0	0	0	110	K90 P91	K90-V93 HydrophobicContact CB-CB 4.41Å; K90-V93 HydrophobicContact CB-CG2 3.99Å; K90-V93 WeakPolarHBondContact O-CB 3.43Å; K90-V93 PolarHBondContact O-N 3.32Å; P91-V93 VanDerWaalsContact C-N 3.33Å
94	I	94.2	Very high	93	Very high	2 Å²	2	60.5 Å²	60.5	1%	0.01	32%	0.317	C	S	.	.			trans	-141.7	137.1	-174.1	-166.2	67.7	0	0	0	112.1	W36 I63 N88 K90 M96 M119 I120	W36-I94 HydrophobicContact CH2-CD1 4.47Å; W36-I94 HydrophobicContact CZ2-CB 4.2Å; W36-I94 HydrophobicContact CZ2-CD1 4.06Å; W36-I94 HydrophobicContact CZ2-CG1 4.16Å; I63-I94 HydrophobicContact CD1-CD1 4.14Å; I63-I94 HydrophobicContact CD1-CG1 3.37Å; N88-I94 WeakPolarHBondContact O-CG2 3.33Å; K90-I94 PolarHBondContact O-N 2.95Å; I94-M96 HydrophobicContact CG2-CG 4.19Å; I94-M96 HydrophobicContact CG2-SD 3.9Å; I94-M96 PolarHBondContact O-N 3.05Å; I94-M119 HydrophobicContact CD1-CB 3.73Å; I94-M119 HydrophobicContact CD1-CE 3.54Å; I94-M119 HydrophobicContact CD1-CG 4.47Å; I94-M119 HydrophobicContact CG1-CE 4.25Å; I94-I120 WeakPolarHBondContact CD1-O 3.48Å
95	N	95.1	Very high	93.4	Very high	57 Å²	57	59.1 Å²	59.1	31%	0.305	31%	0.309	S	S	.	.			trans	-85.3	91.6	173.2	-170.9	-15.8	0	0	0	110.1	K97 A98 H100 I120	N95-K97 PolarHBondContact O-N 3.27Å; N95-K97 PolarHBondContact OD1-N 3.41Å; N95-K97 VanDerWaalsContact OD1-N 3.09Å; N95-A98 HydrophobicContact CB-CB 3.85Å; N95-A98 PolarHBondContact O-N 3.15Å; N95-A98 VanDerWaalsContact O-N 3.08Å; N95-A98 PolarHBondContact OD1-N 2.97Å; N95-H100 PolarHBondContact O-CE1 3.44Å; N95-H100 PolarHBondContact O-NE2 3.1Å; N95-I120 HydrophobicContact CB-CG2 4.12Å; N95-I120 WeakPolarHBondContact CB-O 3.23Å; N95-I120 PolarHBondContact N-O 3.01Å
96	M	92.2	Very high	93.5	Very high	71 Å²	71	61.4 Å²	61.4	35%	0.35	32%	0.318	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.7	-18.9	178.9	-65.3	-69.1	-65.9	0	0	114.5	I63 C66 I94	I63-M96 HydrophobicContact CB-CE 4.18Å; I63-M96 HydrophobicContact CB-SD 4.16Å; I63-M96 HydrophobicContact CD1-SD 3.94Å; I63-M96 HydrophobicContact CG2-CE 3.47Å; I63-M96 VanDerWaalsContact CG2-CE 3.47Å; I63-M96 HydrophobicContact CG2-SD 3.69Å; C66-M96 HydrophobicContact CB-CE 3.6Å; C66-M96 HydrophobicContact CB-SD 3.66Å; I94-M96 HydrophobicContact CG2-CG 4.19Å; I94-M96 HydrophobicContact CG2-SD 3.9Å; I94-M96 PolarHBondContact O-N 3.05Å
97	K	93	Very high	93.7	Very high	201 Å²	201	56.3 Å²	56.3	87%	0.874	30%	0.299	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98.9	-6.7	-178.4	-62.4	-175.8	179.9	-179.5	0	113.3	N95	N95-K97 PolarHBondContact O-N 3.27Å; N95-K97 PolarHBondContact OD1-N 3.41Å; N95-K97 VanDerWaalsContact OD1-N 3.09Å
98	A	94.7	Very high	93.6	Very high	14 Å²	14	60.6 Å²	60.6	12%	0.116	31%	0.314	C	S	.	.	S	Bend	trans	-83.6	154.7	-177.9	0	0	0	0	0	111.7	N95 I120	N95-A98 HydrophobicContact CB-CB 3.85Å; N95-A98 PolarHBondContact O-N 3.15Å; N95-A98 VanDerWaalsContact O-N 3.08Å; N95-A98 PolarHBondContact OD1-N 2.97Å; A98-I120 HydrophobicContact CB-CB 4.11Å; A98-I120 HydrophobicContact CB-CD1 3.82Å; A98-I120 HydrophobicContact CB-CG2 4.22Å
99	E	96.3	Very high	93.6	Very high	89 Å²	89	65.6 Å²	65.6	42%	0.416	33%	0.329	S	S	.	.	P	Polyproline II helix	trans	-85.2	117.8	161.4	-69.1	-155.7	147.1	0	0	109.3	S41 N60 A61 V62 P101 I120	S41-E99 VanDerWaalsContact CB-OE1 3.25Å; S41-E99 WeakPolarHBondContact CB-OE1 3.44Å; S41-E99 VanDerWaalsContact OG-CD 3.27Å; S41-E99 PolarHBondContact OG-OE1 2.9Å; N60-E99 HydrophobicContact CB-CB 4.14Å; N60-E99 PolarHBondContact ND2-OE2 2.87Å; A61-E99 CarbonylContact O-C 3.57Å; V62-E99 HydrophobicContact CG1-CG 4.11Å; E99-P101 WeakPolarHBondContact O-CD 3.46Å; E99-I120 WeakPolarHBondContact O-CD1 3.33Å
100	H	95.3	Very high	93.5	Very high	0 Å²	0	67.4 Å²	67.4	0%	0	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.4	119.3	179.9	-57.7	-59.3	0	0	0	110.3	N60 A61 I63 N95 C102 M119 I120	N60-H100 CarbonylContact C-O 3.59Å; N60-H100 WeakPolarHBondContact CA-O 3.29Å; A61-H100 PolarHBondContact N-O 3.46Å; A61-H100 PolarHBondContact O-N 3.48Å; I63-H100 WeakPolarHBondContact CD1-NE2 3.38Å; N95-H100 PolarHBondContact O-CE1 3.44Å; N95-H100 PolarHBondContact O-NE2 3.1Å; H100-C102 PolarHBondContact O-N 3.43Å; H100-C102 PolarHBondContact O-SG 3.36Å; H100-M119 HydrophobicContact CB-SD 4.2Å; H100-I120 PolarHBondContact CE1-N 3.05Å; H100-I120 PolarHBondContact ND1-N 2.87Å
101	P	96.5	Very high	93.3	Very high	61 Å²	61	64.2 Å²	64.2	40%	0.396	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.6	132.3	174.4	-19.7	32.5	0	0	0	110.7	E99 C117 S118	E99-P101 WeakPolarHBondContact O-CD 3.46Å; P101-C117 CarbonylContact O-C 3.53Å; P101-C117 WeakPolarHBondContact O-CA 3.36Å; P101-S118 PolarHBondContact O-N 3.39Å
102	C	96.2	Very high	93.3	Very high	9 Å²	9	64.6 Å²	64.6	6%	0.061	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.1	156.8	-178.2	-62.4	0	0	0	0	111.7	L58 F59 H100 A116 C117	L58-C102 WeakPolarHBondContact CA-O 3.29Å; F59-C102 HydrophobicContact CD1-CB 4.1Å; F59-C102 HydrophobicContact CD2-CB 4.01Å; F59-C102 HydrophobicContact CE1-CB 3.64Å; F59-C102 HydrophobicContact CE2-CB 3.56Å; F59-C102 HydrophobicContact CG-CB 4.27Å; F59-C102 HydrophobicContact CZ-CB 3.36Å; F59-C102 PolarHBondContact N-O 2.81Å; F59-C102 WeakPolarHBondContact O-CA 3.47Å; F59-C102 PolarHBondContact O-N 3.41Å; F59-C102 VanDerWaalsContact O-O 3.1Å; H100-C102 PolarHBondContact O-N 3.43Å; H100-C102 PolarHBondContact O-SG 3.36Å; C102-A116 CarbonylContact C-O 3.55Å; C102-A116 WeakPolarHBondContact CA-O 3.45Å; C102-C117 HydrophobicContact CB-CB 4.12Å; C102-C117 WeakPolarHBondContact CB-SG 3.33Å; C102-C117 WeakPolarHBondContact SG-CB 3.39Å; C102-C117 CovalentContact SG-SG 2.05Å; C102-C117 PolarHBondContact SG-SG 3.49Å
103	S	95.8	Very high	93.2	Very high	45 Å²	45	61.1 Å²	61.1	32%	0.315	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.9	136.6	171.6	63.8	0	0	0	0	110	I57 L58 A116	I57-S103 CarbonylContact O-C 3.51Å; I57-S103 WeakPolarHBondContact O-CA 3.34Å; L58-S103 VanDerWaalsContact CD2-CB 3.46Å; S103-A116 PolarHBondContact N-O 2.97Å; S103-A116 PolarHBondContact O-N 2.9Å
104	L	95.1	Very high	93.2	Very high	2 Å²	2	64.8 Å²	64.8	1%	0.01	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.4	117.1	171.4	-176.7	72.5	0	0	0	108.7	F22 V23 K26 I56 I57 F59 N114 L115	F22-L104 HydrophobicContact CD1-CD2 4.05Å; F22-L104 HydrophobicContact CE1-CD2 3.65Å; V23-L104 HydrophobicContact CG2-CD2 3.95Å; K26-L104 HydrophobicContact CB-CD1 4.29Å; K26-L104 HydrophobicContact CB-CD2 4.17Å; K26-L104 HydrophobicContact CG-CD2 4.17Å; I56-L104 WeakPolarHBondContact CA-O 3.32Å; I57-L104 HydrophobicContact CB-CB 4.41Å; I57-L104 HydrophobicContact CD1-CD2 4.49Å; I57-L104 PolarHBondContact N-O 2.97Å; I57-L104 PolarHBondContact O-N 2.78Å; F59-L104 HydrophobicContact CE1-CB 3.97Å; L104-N114 WeakPolarHBondContact CA-O 3.31Å; L104-L115 HydrophobicContact CD1-CB 4.24Å; L104-L115 HydrophobicContact CD1-CD1 4.34Å
105	L	94.9	Very high	93.2	Very high	57 Å²	57	66.6 Å²	66.6	30%	0.298	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.6	114.7	167.9	175.2	68.9	0	0	0	108.6	Q54 I56 S113 N114	Q54-L105 HydrophobicContact CB-CD1 4.12Å; Q54-L105 HydrophobicContact CG-CD1 4.19Å; I56-L105 HydrophobicContact CD1-CD1 4.39Å; I56-L105 HydrophobicContact CG1-CD1 3.59Å; L105-S113 CarbonylContact O-C 3.45Å; L105-S113 WeakPolarHBondContact O-CA 3.47Å; L105-N114 HydrophobicContact CB-CB 4.42Å; L105-N114 PolarHBondContact N-O 3.46Å; L105-N114 PolarHBondContact O-N 3.15Å
106	Y	94	Very high	93.1	Very high	54 Å²	54	66.5 Å²	66.5	21%	0.212	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	133.8	176.8	173.3	-102.4	0	0	0	110.8	F22 Q54 L55 K108 G111 N112	F22-Y106 HydrophobicContact CE1-CG 4.31Å; F22-Y106 HydrophobicContact CZ-CD1 4.12Å; F22-Y106 AromaticContact CZ-CD2 3.78Å; F22-Y106 HydrophobicContact CZ-CD2 3.78Å; F22-Y106 HydrophobicContact CZ-CE2 4.19Å; F22-Y106 AromaticContact CZ-CG 3.72Å; F22-Y106 HydrophobicContact CZ-CG 3.72Å; Q54-Y106 CarbonylContact C-O 3.54Å; Q54-Y106 VanDerWaalsContact CA-O 3.29Å; Q54-Y106 WeakPolarHBondContact CA-O 3.22Å; L55-Y106 HydrophobicContact CB-CD1 4.3Å; L55-Y106 PolarHBondContact N-O 3.31Å; L55-Y106 PolarHBondContact O-N 2.71Å; Y106-K108 HydrophobicContact CE1-CB 4.21Å; Y106-G111 WeakPolarHBondContact CE2-O 3.35Å; Y106-N112 WeakPolarHBondContact CD2-O 3.19Å
107	S	93.5	Very high	93.1	Very high	27 Å²	27	64.7 Å²	64.7	19%	0.189	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.4	119.3	171.8	174.6	0	0	0	0	110	Y109 S110 G111 N112	S107-Y109 VanDerWaalsContact C-N 3.27Å; S107-Y109 PolarHBondContact O-N 3.3Å; S107-Y109 PolarHBondContact OG-N 2.99Å; S107-S110 WeakPolarHBondContact CB-OG 3.39Å; S107-S110 PolarHBondContact OG-N 3.42Å; S107-S110 PolarHBondContact OG-OG 2.95Å; S107-G111 WeakPolarHBondContact O-CA 3.46Å; S107-G111 PolarHBondContact O-N 3.27Å; S107-N112 PolarHBondContact N-O 3.44Å
108	K	90.2	Very high	93.2	Very high	161 Å²	161	59.3 Å²	59.3	70%	0.7	33%	0.333	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.4	-31.3	175	-173.5	179.4	175.9	-175.9	0	112	G53 Y106	G53-K108 WeakPolarHBondContact O-CB 3.21Å; G53-K108 PolarHBondContact O-N 2.88Å; Y106-K108 HydrophobicContact CE1-CB 4.21Å
109	Y	89.5	Confident	93.1	Very high	169 Å²	169	61 Å²	61	66%	0.663	34%	0.339	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.8	-36	-177.2	-62.9	-54.5	0	0	0	113	A52 S107	A52-Y109 VanDerWaalsContact C-CE2 3.4Å; A52-Y109 WeakPolarHBondContact O-CD2 3.04Å; A52-Y109 VanDerWaalsContact O-CE2 3.23Å; A52-Y109 WeakPolarHBondContact O-CE2 3.48Å; S107-Y109 VanDerWaalsContact C-N 3.27Å; S107-Y109 PolarHBondContact O-N 3.3Å; S107-Y109 PolarHBondContact OG-N 2.99Å
110	S	91.6	Very high	93.1	Very high	68 Å²	68	60 Å²	60	48%	0.476	34%	0.336	S	S	.	.	T	Hydrogen-bonded Turn	trans	-102.7	-15	178.6	57.7	0	0	0	0	114.1	S107 N112	S107-S110 WeakPolarHBondContact CB-OG 3.39Å; S107-S110 PolarHBondContact OG-N 3.42Å; S107-S110 PolarHBondContact OG-OG 2.95Å; S110-N112 PolarHBondContact O-N 3.32Å; S110-N112 PolarHBondContact OG-N 3.37Å
111	G	87.5	Confident	92.9	Very high	30 Å²	30	68.4 Å²	68.4	31%	0.309	37%	0.368	S	S	.	.			trans	72.4	1.2	-171.5	0	0	0	0	0	114.1	Y106 S107	Y106-G111 WeakPolarHBondContact CE2-O 3.35Å; S107-G111 WeakPolarHBondContact O-CA 3.46Å; S107-G111 PolarHBondContact O-N 3.27Å
112	N	89.4	Confident	92.6	Very high	108 Å²	108	66.1 Å²	66.1	58%	0.578	36%	0.356	S	S	*	.			trans	-84.4	149.8	-176.6	-66.2	-18.4	0	0	0	111.7	Y106 S107 S110	Y106-N112 WeakPolarHBondContact CD2-O 3.19Å; S107-N112 PolarHBondContact N-O 3.44Å; S110-N112 PolarHBondContact O-N 3.32Å; S110-N112 PolarHBondContact OG-N 3.37Å
113	S	90.7	Very high	92	Very high	21 Å²	21	77.9 Å²	77.9	15%	0.147	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.2	137.9	173.7	34.7	0	0	0	0	110.1	K26 L105	K26-S113 WeakPolarHBondContact CD-OG 3.39Å; K26-S113 WeakPolarHBondContact CE-OG 3.25Å; K26-S113 PolarHBondContact NZ-OG 2.96Å; L105-S113 CarbonylContact O-C 3.45Å; L105-S113 WeakPolarHBondContact O-CA 3.47Å
114	N	92	Very high	91.8	Very high	115 Å²	115	79.6 Å²	79.6	62%	0.615	41%	0.41	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.1	110.5	165.8	-72.1	-24.2	0	0	0	107.9	L104 L105	L104-N114 WeakPolarHBondContact CA-O 3.31Å; L105-N114 HydrophobicContact CB-CB 4.42Å; L105-N114 PolarHBondContact N-O 3.46Å; L105-N114 PolarHBondContact O-N 3.15Å
115	L	92.8	Very high	91.6	Very high	39 Å²	39	83.6 Å²	83.6	20%	0.204	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	132.6	173.4	178.4	69.1	0	0	0	109.6	L27 D30 F59 L104	L27-L115 HydrophobicContact CD2-CD1 3.73Å; L27-L115 HydrophobicContact CD2-CD2 3.52Å; L27-L115 HydrophobicContact CD2-CG 4.28Å; D30-L115 HydrophobicContact CB-CD2 4.07Å; D30-L115 WeakPolarHBondContact OD2-CB 3.29Å; F59-L115 HydrophobicContact CE1-CD1 4.24Å; F59-L115 HydrophobicContact CZ-CD1 3.72Å; L104-L115 HydrophobicContact CD1-CB 4.24Å; L104-L115 HydrophobicContact CD1-CD1 4.34Å
116	A	93.6	Very high	91.4	Very high	55 Å²	55	85.1 Å²	85.1	46%	0.455	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.8	132	170.5	0	0	0	0	0	109.4	C102 S103	C102-A116 CarbonylContact C-O 3.55Å; C102-A116 WeakPolarHBondContact CA-O 3.45Å; S103-A116 PolarHBondContact N-O 2.97Å; S103-A116 PolarHBondContact O-N 2.9Å
117	C	93.6	Very high	91.3	Very high	34 Å²	34	86.9 Å²	86.9	23%	0.23	45%	0.452	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.1	130.7	177.9	-68.6	0	0	0	0	110.1	P101 C102 M119	P101-C117 CarbonylContact O-C 3.53Å; P101-C117 WeakPolarHBondContact O-CA 3.36Å; C102-C117 HydrophobicContact CB-CB 4.12Å; C102-C117 WeakPolarHBondContact CB-SG 3.33Å; C102-C117 WeakPolarHBondContact SG-CB 3.39Å; C102-C117 CovalentContact SG-SG 2.05Å; C102-C117 PolarHBondContact SG-SG 3.49Å; C117-M119 VanDerWaalsContact C-N 3.32Å; C117-M119 HydrophobicContact CB-CG 4.39Å; C117-M119 HydrophobicContact CB-SD 3.55Å; C117-M119 VanDerWaalsContact CB-SD 3.55Å; C117-M119 PolarHBondContact O-N 3.34Å; C117-M119 VanDerWaalsContact O-N 3.08Å
118	S	94.1	Very high	91.2	Very high	88 Å²	88	90.7 Å²	90.7	62%	0.615	47%	0.468	S	S	*	.			trans	-81.5	82.2	171.7	-65.4	0	0	0	0	108.9	P101 I120	P101-S118 PolarHBondContact O-N 3.39Å; S118-I120 PolarHBondContact O-N 2.73Å
119	M	93.3	Very high	91.2	Very high	48 Å²	48	86 Å²	86	24%	0.236	45%	0.453	C	S	.	.			trans	-65.2	124.2	-175.8	-58.2	-54.5	-65.4	0	0	110.7	W36 L38 I63 I94 H100 C117 R121	W36-M119 HydrophobicContact CD2-CE 3.8Å; W36-M119 HydrophobicContact CE3-CE 3.51Å; W36-M119 HydrophobicContact CE3-CG 4.23Å; W36-M119 HydrophobicContact CE3-SD 4.2Å; W36-M119 HydrophobicContact CG-CE 4.29Å; W36-M119 HydrophobicContact CH2-CG 4.22Å; W36-M119 HydrophobicContact CZ3-CE 3.91Å; W36-M119 HydrophobicContact CZ3-CG 3.69Å; W36-M119 HydrophobicContact CZ3-SD 4.27Å; L38-M119 HydrophobicContact CD2-CE 4.26Å; I63-M119 HydrophobicContact CD1-CE 3.9Å; I63-M119 HydrophobicContact CG1-CE 4.29Å; I94-M119 HydrophobicContact CD1-CB 3.73Å; I94-M119 HydrophobicContact CD1-CE 3.54Å; I94-M119 HydrophobicContact CD1-CG 4.47Å; I94-M119 HydrophobicContact CG1-CE 4.25Å; H100-M119 HydrophobicContact CB-SD 4.2Å; C117-M119 VanDerWaalsContact C-N 3.32Å; C117-M119 HydrophobicContact CB-CG 4.39Å; C117-M119 HydrophobicContact CB-SD 3.55Å; C117-M119 VanDerWaalsContact CB-SD 3.55Å; C117-M119 PolarHBondContact O-N 3.34Å; C117-M119 VanDerWaalsContact O-N 3.08Å; M119-R121 PolarHBondContact O-N 2.85Å
120	I	94.8	Very high	91.3	Very high	68 Å²	68	80.1 Å²	80.1	35%	0.349	44%	0.438	S	S	.	.			trans	-84	115.9	-179.2	-62.6	166.6	0	0	0	107.1	I94 N95 A98 E99 H100 S118	I94-I120 WeakPolarHBondContact CD1-O 3.48Å; N95-I120 HydrophobicContact CB-CG2 4.12Å; N95-I120 WeakPolarHBondContact CB-O 3.23Å; N95-I120 PolarHBondContact N-O 3.01Å; A98-I120 HydrophobicContact CB-CB 4.11Å; A98-I120 HydrophobicContact CB-CD1 3.82Å; A98-I120 HydrophobicContact CB-CG2 4.22Å; E99-I120 WeakPolarHBondContact O-CD1 3.33Å; H100-I120 PolarHBondContact CE1-N 3.05Å; H100-I120 PolarHBondContact ND1-N 2.87Å; S118-I120 PolarHBondContact O-N 2.73Å
121	R	92.7	Very high	91.3	Very high	178 Å²	178	81 Å²	81	67%	0.672	44%	0.435	S	S	*	.			trans	-63.9	143.5	176.1	-59.9	-174	70.4	116	3.5	110	M119	M119-R121 PolarHBondContact O-N 2.85Å
122	G	89.1	Confident	91.6	Very high	13 Å²	13	85.3 Å²	85.3	13%	0.134	45%	0.446	C	S	.	.			trans	-81.2	167.9	171.5	0	0	0	0	0	111.6	P91	P91-G122 CarbonylContact O-C 3.48Å; P91-G122 VanDerWaalsContact O-C 3.32Å; P91-G122 WeakPolarHBondContact O-CA 3.44Å
123	K	83.7	Confident	91.8	Very high	256 Å²	256	83.2 Å²	83.2	100%	1.113	43%	0.434	S	S	*	.			trans	-99.8	0	-174.4	-68.6	-175.4	176.9	-178.5	0	110.3

Retrieved 123 of 123 residues in 247.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).