A0A077YZD2_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YZD2, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 144 aa.

						>A0A077YZD2_TRITR|A0A077YZD2
MAPLSPSAPAAPTGLYQDYANAAAAAAAAASYVPTTAATPVMGPYAAGSTMCDPYSYAVATAAYGMLPNASAPYQAGAGNAMAAAIQQAFSNPAVAAAALQAAAAANANGIPFTTSPMATATYQSNGNGQLQNATATPASDRQQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.1	Very low	29	Very low	248 Å²	248	123.7 Å²	123.7	100%	1.222	81%	0.814	S	S	*	*				0	105.5	0	-80.6	150.3	92.2	0	0	107.3
2	A	36.5	Very low	28.8	Very low	93 Å²	93	120.4 Å²	120.4	77%	0.769	79%	0.791	S	S	*	*			trans	-84.1	139.1	173.2	0	0	0	0	0	108.9
3	P	31.8	Very low	28.9	Very low	121 Å²	121	121.6 Å²	121.6	79%	0.786	80%	0.795	S	S	*	*			trans	-66.6	135	-179.7	27.1	-32.5	0	0	0	110.4	S5	P3-S5 PolarHBondContact O-N 3.07Å; P3-S5 VanDerWaalsContact O-N 3.07Å
4	L	26.4	Very low	28.9	Very low	175 Å²	175	116.3 Å²	116.3	92%	0.916	77%	0.773	S	S	*	*			trans	-60.2	107.1	170	-68.5	162.4	0	0	0	108.2
5	S	26.3	Very low	28.8	Very low	105 Å²	105	115.1 Å²	115.1	73%	0.734	76%	0.755	S	S	*	*			trans	-60.2	134.5	168.7	-69.8	0	0	0	0	109	P3 S7	P3-S5 PolarHBondContact O-N 3.07Å; P3-S5 VanDerWaalsContact O-N 3.07Å; S5-S7 PolarHBondContact O-N 3.11Å; S5-S7 VanDerWaalsContact O-N 3.11Å
6	P	27	Very low	28.6	Very low	124 Å²	124	117.4 Å²	117.4	81%	0.805	75%	0.746	S	S	*	*			trans	-59.2	119.5	176.8	23.4	-31.3	0	0	0	108.9	A8	P6-A8 PolarHBondContact O-N 2.96Å
7	S	24.4	Very low	28.7	Very low	122 Å²	122	116.1 Å²	116.1	85%	0.853	73%	0.728	S	S	*	*			trans	-57.4	107.4	168.1	-66.1	0	0	0	0	107.8	S5	S5-S7 PolarHBondContact O-N 3.11Å; S5-S7 VanDerWaalsContact O-N 3.11Å
8	A	26.6	Very low	28.9	Very low	86 Å²	86	115.4 Å²	115.4	71%	0.711	72%	0.718	S	S	*	*			trans	-56.1	131.8	168.5	0	0	0	0	0	107.9	P6 A10	P6-A8 PolarHBondContact O-N 2.96Å; A8-A10 PolarHBondContact O-N 3.28Å
9	P	26.4	Very low	29.1	Very low	122 Å²	122	117.4 Å²	117.4	79%	0.792	71%	0.712	S	S	*	*			trans	-57.6	131.6	174.5	22.1	-28.9	0	0	0	108.3	A11	P9-A11 PolarHBondContact O-N 3.02Å
10	A	26.3	Very low	29.3	Very low	100 Å²	100	113.7 Å²	113.7	83%	0.826	69%	0.694	S	S	*	*			trans	-53	115.9	174.2	0	0	0	0	0	108.4	A8	A8-A10 PolarHBondContact O-N 3.28Å
11	A	30.1	Very low	29.5	Very low	65 Å²	65	110.3 Å²	110.3	54%	0.537	67%	0.672	S	S	.	*			trans	-56.8	135.3	177.1	0	0	0	0	0	108.7	P9 T13	P9-A11 PolarHBondContact O-N 3.02Å; A11-T13 PolarHBondContact O-N 2.84Å
12	P	26.8	Very low	29.5	Very low	84 Å²	84	99.1 Å²	99.1	55%	0.545	62%	0.619	S	S	.	*			trans	-64.2	99.3	176.1	25.4	-31.5	0	0	0	108.4	G14 L15	P12-G14 PolarHBondContact O-N 3.12Å; P12-L15 HydrophobicContact CB-CD1 4.26Å; P12-L15 HydrophobicContact CG-CD1 4.05Å; P12-L15 PolarHBondContact O-N 2.68Å
13	T	30.5	Very low	29.4	Very low	136 Å²	136	96.1 Å²	96.1	83%	0.834	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.3	-6.6	-176	42.8	0	0	0	0	113.8	A11	A11-T13 PolarHBondContact O-N 2.84Å
14	G	28.7	Very low	29.4	Very low	47 Å²	47	92 Å²	92	49%	0.485	57%	0.57	S	S	.	*	T	Hydrogen-bonded Turn	trans	-88.6	-30.7	177.6	0	0	0	0	0	115.2	P12	P12-G14 PolarHBondContact O-N 3.12Å
15	L	26.6	Very low	29.7	Very low	98 Å²	98	86.1 Å²	86.1	51%	0.513	55%	0.547	S	S	.	.	H	α-helix	trans	-81.2	-34.8	-171.6	-67.8	170.7	0	0	0	112.5	P12 Q17 D18 Y19	P12-L15 HydrophobicContact CB-CD1 4.26Å; P12-L15 HydrophobicContact CG-CD1 4.05Å; P12-L15 PolarHBondContact O-N 2.68Å; L15-Q17 VanDerWaalsContact C-N 3.26Å; L15-Q17 PolarHBondContact O-N 3Å; L15-D18 PolarHBondContact O-N 3.02Å; L15-Y19 WeakPolarHBondContact O-CD2 3.24Å; L15-Y19 PolarHBondContact O-N 3.32Å; L15-Y19 VanDerWaalsContact O-N 3.07Å
16	Y	26.8	Very low	30	Very low	153 Å²	153	81.6 Å²	81.6	60%	0.6	52%	0.516	S	S	*	.	H	α-helix	trans	-62.8	-30.9	-179.9	-99.8	-91.1	0	0	0	113.5	A20	Y16-A20 PolarHBondContact O-N 3.41Å
17	Q	30.1	Very low	30.2	Very low	94 Å²	94	76.2 Å²	76.2	44%	0.439	48%	0.482	S	S	.	.	H	α-helix	trans	-75.7	-38	-179.4	-162.2	63.5	53.2	0	0	111.5	L15 Y19 A20 N21	L15-Q17 VanDerWaalsContact C-N 3.26Å; L15-Q17 PolarHBondContact O-N 3Å; Q17-Y19 VanDerWaalsContact C-N 3.34Å; Q17-A20 PolarHBondContact O-N 3.11Å; Q17-N21 WeakPolarHBondContact O-CB 3.37Å; Q17-N21 PolarHBondContact O-N 2.99Å; Q17-N21 PolarHBondContact O-ND2 2.89Å
18	D	32	Very low	30.5	Very low	105 Å²	105	71 Å²	71	56%	0.561	45%	0.446	S	S	*	.	H	α-helix	trans	-65.7	-37.4	172.2	-72.1	-33.7	0	0	0	111.4	L15 N21 A22	L15-D18 PolarHBondContact O-N 3.02Å; D18-N21 PolarHBondContact O-N 3.39Å; D18-A22 WeakPolarHBondContact O-CB 3.39Å; D18-A22 PolarHBondContact O-N 3.4Å
19	Y	32.7	Very low	30.6	Very low	153 Å²	153	69.6 Å²	69.6	60%	0.6	43%	0.434	S	S	*	.	H	α-helix	trans	-66.2	-35.5	173.7	-86	-74.4	0	0	0	113.5	L15 Q17 A22 A23	L15-Y19 WeakPolarHBondContact O-CD2 3.24Å; L15-Y19 PolarHBondContact O-N 3.32Å; L15-Y19 VanDerWaalsContact O-N 3.07Å; Q17-Y19 VanDerWaalsContact C-N 3.34Å; Y19-A22 WeakPolarHBondContact O-CB 3.41Å; Y19-A23 WeakPolarHBondContact O-CB 3.38Å; Y19-A23 PolarHBondContact O-N 3.3Å
20	A	33.2	Very low	30.6	Very low	42 Å²	42	64.7 Å²	64.7	35%	0.347	40%	0.404	S	S	.	.	H	α-helix	trans	-71.7	-41.2	176.7	0	0	0	0	0	112	Y16 Q17 A22 A23 A24	Y16-A20 PolarHBondContact O-N 3.41Å; Q17-A20 PolarHBondContact O-N 3.11Å; A20-A22 VanDerWaalsContact C-N 3.29Å; A20-A23 PolarHBondContact O-N 3.1Å; A20-A24 WeakPolarHBondContact O-CB 3.31Å; A20-A24 PolarHBondContact O-N 3.24Å
21	N	34	Very low	30.6	Very low	44 Å²	44	60.8 Å²	60.8	24%	0.235	37%	0.371	C	S	.	.	H	α-helix	trans	-65.8	-36.8	174.2	-68.9	-15	0	0	0	111.2	Q17 D18 A24 A25 M118	Q17-N21 WeakPolarHBondContact O-CB 3.37Å; Q17-N21 PolarHBondContact O-N 2.99Å; Q17-N21 PolarHBondContact O-ND2 2.89Å; D18-N21 PolarHBondContact O-N 3.39Å; N21-A24 PolarHBondContact O-N 3.41Å; N21-A25 PolarHBondContact O-N 2.96Å; N21-M118 HydrophobicContact CB-CE 4.05Å; N21-M118 HydrophobicContact CB-SD 3.9Å; N21-M118 WeakPolarHBondContact OD1-CE 3.39Å
22	A	35.4	Very low	30.3	Very low	12 Å²	12	66.3 Å²	66.3	10%	0.099	38%	0.379	C	S	.	.	H	α-helix	trans	-63.7	-46.2	173.8	0	0	0	0	0	112.8	D18 Y19 A20 A24 A25 A26 Y55	D18-A22 WeakPolarHBondContact O-CB 3.39Å; D18-A22 PolarHBondContact O-N 3.4Å; Y19-A22 WeakPolarHBondContact O-CB 3.41Å; A20-A22 VanDerWaalsContact C-N 3.29Å; A22-A24 VanDerWaalsContact C-N 3.29Å; A22-A24 PolarHBondContact O-N 2.98Å; A22-A25 PolarHBondContact O-N 3.37Å; A22-A26 WeakPolarHBondContact O-CB 3.47Å; A22-A26 PolarHBondContact O-N 3.37Å; A22-Y55 HydrophobicContact CB-CD1 4.25Å; A22-Y55 HydrophobicContact CB-CE1 3.2Å; A22-Y55 VanDerWaalsContact CB-CZ 3.41Å; A22-Y55 WeakPolarHBondContact CB-OH 3.46Å; A22-Y55 VanDerWaalsContact O-CD1 3.25Å; A22-Y55 WeakPolarHBondContact O-CD1 3.07Å; A22-Y55 VanDerWaalsContact O-CE1 3.29Å; A22-Y55 WeakPolarHBondContact O-CE1 3.05Å
23	A	34.8	Very low	30.2	Very low	31 Å²	31	66.5 Å²	66.5	26%	0.256	38%	0.378	S	S	.	.	H	α-helix	trans	-63.7	-35.2	175.9	0	0	0	0	0	112.1	Y19 A20 A26 A27 A99	Y19-A23 WeakPolarHBondContact O-CB 3.38Å; Y19-A23 PolarHBondContact O-N 3.3Å; A20-A23 PolarHBondContact O-N 3.1Å; A23-A26 PolarHBondContact O-N 3.49Å; A23-A27 WeakPolarHBondContact O-CB 3.22Å; A23-A27 PolarHBondContact O-N 3.46Å; A23-A99 HydrophobicContact CB-CB 4.35Å
24	A	32.4	Very low	29.9	Very low	33 Å²	33	63.3 Å²	63.3	27%	0.273	36%	0.36	S	S	.	.	H	α-helix	trans	-68.2	-39.8	174.5	0	0	0	0	0	112.5	A20 N21 A22 A28 A102	A20-A24 WeakPolarHBondContact O-CB 3.31Å; A20-A24 PolarHBondContact O-N 3.24Å; N21-A24 PolarHBondContact O-N 3.41Å; A22-A24 VanDerWaalsContact C-N 3.29Å; A22-A24 PolarHBondContact O-N 2.98Å; A24-A28 WeakPolarHBondContact O-CB 3.15Å; A24-A28 PolarHBondContact O-N 3.41Å; A24-A102 HydrophobicContact CB-CB 4.04Å
25	A	33.3	Very low	29.6	Very low	53 Å²	53	67.4 Å²	67.4	44%	0.438	38%	0.376	S	S	.	.	H	α-helix	trans	-66.7	-37.4	173.4	0	0	0	0	0	112.2	N21 A22 A28 A29	N21-A25 PolarHBondContact O-N 2.96Å; A22-A25 PolarHBondContact O-N 3.37Å; A25-A28 PolarHBondContact O-N 2.98Å; A25-A29 PolarHBondContact O-N 3.1Å; A25-A29 VanDerWaalsContact O-N 3.1Å
26	A	32.3	Very low	29.4	Very low	9 Å²	9	68 Å²	68	7%	0.074	38%	0.383	C	S	.	.	H	α-helix	trans	-66	-52.9	176.4	0	0	0	0	0	111	A22 A23 A28 A29 A30 Y55 V59	A22-A26 WeakPolarHBondContact O-CB 3.47Å; A22-A26 PolarHBondContact O-N 3.37Å; A23-A26 PolarHBondContact O-N 3.49Å; A26-A28 PolarHBondContact O-N 2.97Å; A26-A29 PolarHBondContact O-N 3.15Å; A26-A30 PolarHBondContact O-N 3.11Å; A26-Y55 HydrophobicContact CB-CD1 3.9Å; A26-Y55 HydrophobicContact CB-CG 4.35Å; A26-V59 HydrophobicContact CB-CG2 3.59Å; A26-V59 WeakPolarHBondContact O-CG2 3.38Å
27	A	30.9	Very low	29.2	Very low	12 Å²	12	66.3 Å²	66.3	10%	0.099	40%	0.402	C	S	.	.	H	α-helix	trans	-50.3	-40.4	173.3	0	0	0	0	0	113.1	A23 A30 A99 A102 A103	A23-A27 WeakPolarHBondContact O-CB 3.22Å; A23-A27 PolarHBondContact O-N 3.46Å; A27-A30 VanDerWaalsContact O-CB 3.3Å; A27-A30 WeakPolarHBondContact O-CB 3.48Å; A27-A30 PolarHBondContact O-N 3.29Å; A27-A99 HydrophobicContact CB-CB 4.47Å; A27-A99 WeakPolarHBondContact CB-O 3.37Å; A27-A102 HydrophobicContact CB-CB 4.48Å; A27-A103 HydrophobicContact CB-CB 3.7Å; A27-A103 VanDerWaalsContact O-CA 3.27Å; A27-A103 WeakPolarHBondContact O-CA 3.3Å; A27-A103 WeakPolarHBondContact O-CB 3.4Å
28	A	29.9	Very low	29	Very low	13 Å²	13	65.1 Å²	65.1	11%	0.107	41%	0.408	C	S	.	.	H	α-helix	trans	-67.9	-46.3	177.9	0	0	0	0	0	110.6	A24 A25 A26 A30 S31 A106 F113	A24-A28 WeakPolarHBondContact O-CB 3.15Å; A24-A28 PolarHBondContact O-N 3.41Å; A25-A28 PolarHBondContact O-N 2.98Å; A26-A28 PolarHBondContact O-N 2.97Å; A28-A30 PolarHBondContact O-N 3.43Å; A28-S31 PolarHBondContact O-N 3.31Å; A28-S31 VanDerWaalsContact O-N 3.09Å; A28-A106 HydrophobicContact CB-CB 3.66Å; A28-F113 VanDerWaalsContact CA-CZ 3.47Å; A28-F113 HydrophobicContact CB-CE1 3.22Å; A28-F113 HydrophobicContact CB-CZ 3.31Å; A28-F113 WeakPolarHBondContact O-CE2 3.21Å; A28-F113 WeakPolarHBondContact O-CZ 3.48Å
29	A	28.5	Very low	28.7	Very low	55 Å²	55	65.7 Å²	65.7	46%	0.455	42%	0.415	S	S	.	.	H	α-helix	trans	-62.5	-27	175.4	0	0	0	0	0	113.6	A25 A26 S31	A25-A29 PolarHBondContact O-N 3.1Å; A25-A29 VanDerWaalsContact O-N 3.1Å; A26-A29 PolarHBondContact O-N 3.15Å; A29-S31 PolarHBondContact O-N 3.07Å
30	A	27.8	Very low	28.4	Very low	20 Å²	20	61.9 Å²	61.9	17%	0.165	41%	0.409	C	S	.	.	T	Hydrogen-bonded Turn	trans	-65.8	-20.7	175.1	0	0	0	0	0	114.2	A26 A27 A28 V59 A63	A26-A30 PolarHBondContact O-N 3.11Å; A27-A30 VanDerWaalsContact O-CB 3.3Å; A27-A30 WeakPolarHBondContact O-CB 3.48Å; A27-A30 PolarHBondContact O-N 3.29Å; A28-A30 PolarHBondContact O-N 3.43Å; A30-V59 HydrophobicContact CB-CB 4.16Å; A30-V59 HydrophobicContact CB-CG1 3.3Å; A30-V59 HydrophobicContact CB-CG2 4.05Å; A30-A63 HydrophobicContact CB-CB 4.42Å
31	S	25.7	Very low	28	Very low	18 Å²	18	65.8 Å²	65.8	13%	0.126	43%	0.428	C	S	.	.	T	Hydrogen-bonded Turn	trans	-96.9	9.2	-167	-146	0	0	0	0	114.7	A28 A29 V33 A103 N107	A28-S31 PolarHBondContact O-N 3.31Å; A28-S31 VanDerWaalsContact O-N 3.09Å; A29-S31 PolarHBondContact O-N 3.07Å; S31-V33 VanDerWaalsContact C-N 3.26Å; S31-V33 PolarHBondContact O-N 3.08Å; S31-A103 WeakPolarHBondContact CB-O 3.27Å; S31-A103 PolarHBondContact OG-O 3.43Å; S31-N107 PolarHBondContact O-ND2 2.66Å; S31-N107 PolarHBondContact O-OD1 3.07Å; S31-N107 WeakPolarHBondContact OG-CB 3.23Å; S31-N107 PolarHBondContact OG-ND2 3.18Å
32	Y	23.7	Very low	27.8	Very low	181 Å²	181	69.4 Å²	69.4	71%	0.71	45%	0.445	S	S	*	.			trans	-74.5	82.6	164.4	-165.5	-97	0	0	0	109.5	P34	Y32-P34 WeakPolarHBondContact O-CD 3.46Å
33	V	25.4	Very low	27.4	Very low	87 Å²	87	71.1 Å²	71.1	53%	0.527	46%	0.464	S	S	.	.			trans	-90.4	104.2	169.7	180	0	0	0	0	107.4	S31 T35	S31-V33 VanDerWaalsContact C-N 3.26Å; S31-V33 PolarHBondContact O-N 3.08Å; V33-T35 PolarHBondContact O-N 3.09Å
34	P	23.6	Very low	27	Very low	70 Å²	70	75.8 Å²	75.8	46%	0.455	49%	0.492	S	S	.	.			trans	-61.9	112.3	165.5	22.7	-28.1	0	0	0	107.9	Y32 T36	Y32-P34 WeakPolarHBondContact O-CD 3.46Å; P34-T36 PolarHBondContact O-N 3.19Å
35	T	23	Very low	26.9	Very low	132 Å²	132	80.2 Å²	80.2	81%	0.81	50%	0.502	S	S	*	.	S	Bend	trans	-69	65	177	53.2	0	0	0	0	110.6	V33	V33-T35 PolarHBondContact O-N 3.09Å
36	T	21.9	Very low	26.6	Very low	110 Å²	110	81 Å²	81	68%	0.675	51%	0.509	S	S	*	.	S	Bend	trans	-170.4	89.8	171.1	34.4	0	0	0	0	109.5	P34 A38	P34-T36 PolarHBondContact O-N 3.19Å; T36-A38 VanDerWaalsContact C-N 3.32Å; T36-A38 PolarHBondContact O-N 2.98Å
37	A	23	Very low	26.2	Very low	119 Å²	119	86 Å²	86	98%	0.983	55%	0.55	S	S	*	*	S	Bend	trans	40.1	42	151.7	0	0	0	0	0	118.7
38	A	25.2	Very low	26	Very low	69 Å²	69	88.8 Å²	88.8	57%	0.57	58%	0.581	S	S	*	*			trans	-138.9	120.9	179.9	0	0	0	0	0	110.6	T36	T36-A38 VanDerWaalsContact C-N 3.32Å; T36-A38 PolarHBondContact O-N 2.98Å
39	T	26.2	Very low	25.8	Very low	116 Å²	116	92 Å²	92	71%	0.712	60%	0.602	S	S	*	*			trans	-48	140	162.7	41.7	0	0	0	0	109.3	V41	T39-V41 PolarHBondContact O-N 3.05Å
40	P	26.2	Very low	25.9	Very low	74 Å²	74	95.4 Å²	95.4	48%	0.481	62%	0.617	S	S	.	*			trans	-63.6	104.8	173.1	-0.4	13.2	0	0	0	107.5	M42 Y64	P40-M42 PolarHBondContact O-N 3.1Å; P40-Y64 HydrophobicContact CB-CE1 4.23Å; P40-Y64 HydrophobicContact CB-CE2 4.17Å; P40-Y64 HydrophobicContact CG-CD1 3.56Å; P40-Y64 HydrophobicContact CG-CD2 4.19Å; P40-Y64 HydrophobicContact CG-CE1 3.02Å; P40-Y64 HydrophobicContact CG-CE2 3.71Å; P40-Y64 HydrophobicContact CG-CG 4.12Å; P40-Y64 WeakPolarHBondContact CG-OH 3.1Å
41	V	25.3	Very low	25.8	Very low	123 Å²	123	102.3 Å²	102.3	75%	0.745	65%	0.648	S	S	*	*			trans	-84.1	104.5	170.5	-180	0	0	0	0	106	T39 G43	T39-V41 PolarHBondContact O-N 3.05Å; V41-G43 PolarHBondContact O-N 3.15Å; V41-G43 VanDerWaalsContact O-N 3.1Å
42	M	29.5	Very low	26	Very low	120 Å²	120	104.5 Å²	104.5	59%	0.591	66%	0.663	S	S	*	*			trans	-64.7	108.4	161.5	-89.2	-168.1	44.7	0	0	108.3	P40 Y45	P40-M42 PolarHBondContact O-N 3.1Å; M42-Y45 HydrophobicContact CE-CD2 4.18Å; M42-Y45 HydrophobicContact CE-CE2 3.19Å; M42-Y45 VanDerWaalsContact CE-CZ 3.47Å; M42-Y45 VanDerWaalsContact CE-OH 3.24Å; M42-Y45 WeakPolarHBondContact CE-OH 3.28Å
43	G	26.9	Very low	26.5	Very low	48 Å²	48	99.2 Å²	99.2	50%	0.495	65%	0.647	S	S	.	*	P	Polyproline II helix	trans	-59.8	148.2	169	0	0	0	0	0	110.3	V41 Y45	V41-G43 PolarHBondContact O-N 3.15Å; V41-G43 VanDerWaalsContact O-N 3.1Å; G43-Y45 PolarHBondContact O-N 3Å
44	P	26.9	Very low	26.9	Very low	129 Å²	129	97.9 Å²	97.9	84%	0.838	64%	0.64	S	S	*	*	P	Polyproline II helix	trans	-55.9	126.7	177.5	24.1	-32.9	0	0	0	109.3	A46	P44-A46 PolarHBondContact O-N 3Å
45	Y	30.4	Very low	27.4	Very low	126 Å²	126	99 Å²	99	49%	0.494	64%	0.636	S	S	.	*	P	Polyproline II helix	trans	-54.6	127.8	170.4	-70.6	-76.6	0	0	0	108.6	M42 G43 A47	M42-Y45 HydrophobicContact CE-CD2 4.18Å; M42-Y45 HydrophobicContact CE-CE2 3.19Å; M42-Y45 VanDerWaalsContact CE-CZ 3.47Å; M42-Y45 VanDerWaalsContact CE-OH 3.24Å; M42-Y45 WeakPolarHBondContact CE-OH 3.28Å; G43-Y45 PolarHBondContact O-N 3Å; Y45-A47 PolarHBondContact O-N 3.46Å
46	A	26.4	Very low	28.1	Very low	71 Å²	71	95.7 Å²	95.7	59%	0.587	62%	0.618	S	S	*	*	P	Polyproline II helix	trans	-50.9	128.6	174.5	0	0	0	0	0	109.2	P44 G48 S49	P44-A46 PolarHBondContact O-N 3Å; A46-G48 PolarHBondContact O-N 2.97Å; A46-S49 PolarHBondContact O-N 2.89Å; A46-S49 VanDerWaalsContact O-N 3.14Å
47	A	24.1	Very low	28.7	Very low	112 Å²	112	94.2 Å²	94.2	93%	0.926	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.7	116.8	177.2	0	0	0	0	0	109.2	Y45	Y45-A47 PolarHBondContact O-N 3.46Å
48	G	26.1	Very low	29.5	Very low	72 Å²	72	90.2 Å²	90.2	74%	0.742	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	115.9	-7.3	-177.2	0	0	0	0	0	115.8	A46 T50	A46-G48 PolarHBondContact O-N 2.97Å; G48-T50 PolarHBondContact O-N 3.34Å
49	S	26.2	Very low	30	Very low	79 Å²	79	87.9 Å²	87.9	55%	0.552	55%	0.546	S	S	*	.			trans	-88.2	91.2	175	-65.1	0	0	0	0	111.6	A46 M51	A46-S49 PolarHBondContact O-N 2.89Å; A46-S49 VanDerWaalsContact O-N 3.14Å; S49-M51 PolarHBondContact O-N 2.63Å
50	T	29.4	Very low	30.5	Very low	127 Å²	127	83.4 Å²	83.4	78%	0.779	52%	0.521	S	S	*	.			trans	-79.7	17.8	-174.9	-18.3	0	0	0	0	115.1	G48	G48-T50 PolarHBondContact O-N 3.34Å
51	M	26.1	Very low	31.1	Very low	165 Å²	165	81.3 Å²	81.3	81%	0.813	51%	0.507	S	S	*	.			trans	-124	92.3	179	-65.1	-143	123.7	0	0	110.1	S49 D53	S49-M51 PolarHBondContact O-N 2.63Å; M51-D53 PolarHBondContact O-N 3.01Å
52	C	29.8	Very low	31.6	Very low	65 Å²	65	79 Å²	79	44%	0.439	50%	0.501	S	S	.	.			trans	-69.6	96.6	151.2	-166.3	0	0	0	0	105.6	Y57	C52-Y57 WeakPolarHBondContact SG-CD2 3.36Å
53	D	34.8	Very low	31.7	Very low	70 Å²	70	75.7 Å²	75.7	37%	0.374	49%	0.492	S	S	.	.			trans	-62.1	127.1	178.2	-175.9	-79.8	0	0	0	108.4	M51 Y55 S56 Y57	M51-D53 PolarHBondContact O-N 3.01Å; D53-Y55 PolarHBondContact O-N 3.35Å; D53-Y55 WeakPolarHBondContact OD1-CB 3.41Å; D53-Y55 WeakPolarHBondContact OD1-CD2 3.45Å; D53-Y55 PolarHBondContact OD1-N 2.86Å; D53-S56 PolarHBondContact O-N 3.34Å; D53-Y57 PolarHBondContact O-N 3.37Å
54	P	33.4	Very low	31.8	Very low	58 Å²	58	78.2 Å²	78.2	38%	0.377	49%	0.488	S	S	.	.	H	α-helix	trans	-47.9	-30	-176.9	-15.1	11.6	0	0	0	114.1	A58 M82	P54-A58 WeakPolarHBondContact O-CB 3.41Å; P54-A58 PolarHBondContact O-N 2.85Å; P54-A58 VanDerWaalsContact O-N 3.11Å; P54-M82 HydrophobicContact CB-CE 3.21Å; P54-M82 HydrophobicContact CG-CE 3.48Å; P54-M82 VanDerWaalsContact CG-CE 3.48Å
55	Y	35.3	Very low	31.9	Very low	95 Å²	95	75.1 Å²	75.1	37%	0.373	48%	0.479	S	S	.	.	H	α-helix	trans	-77.9	-39.5	-173.7	-55.8	-125.1	0	0	0	110	A22 A26 D53 Y57 V59	A22-Y55 HydrophobicContact CB-CD1 4.25Å; A22-Y55 HydrophobicContact CB-CE1 3.2Å; A22-Y55 VanDerWaalsContact CB-CZ 3.41Å; A22-Y55 WeakPolarHBondContact CB-OH 3.46Å; A22-Y55 VanDerWaalsContact O-CD1 3.25Å; A22-Y55 WeakPolarHBondContact O-CD1 3.07Å; A22-Y55 VanDerWaalsContact O-CE1 3.29Å; A22-Y55 WeakPolarHBondContact O-CE1 3.05Å; A26-Y55 HydrophobicContact CB-CD1 3.9Å; A26-Y55 HydrophobicContact CB-CG 4.35Å; D53-Y55 PolarHBondContact O-N 3.35Å; D53-Y55 WeakPolarHBondContact OD1-CB 3.41Å; D53-Y55 WeakPolarHBondContact OD1-CD2 3.45Å; D53-Y55 PolarHBondContact OD1-N 2.86Å; Y55-Y57 VanDerWaalsContact C-N 3.26Å; Y55-Y57 PolarHBondContact O-N 3.49Å; Y55-V59 WeakPolarHBondContact O-CB 3.31Å; Y55-V59 WeakPolarHBondContact O-CG2 3.37Å; Y55-V59 PolarHBondContact O-N 3.03Å
56	S	36.9	Very low	31.8	Very low	62 Å²	62	75.1 Å²	75.1	43%	0.434	49%	0.485	S	S	.	.	H	α-helix	trans	-64.3	-32.4	175.9	-61.4	0	0	0	0	112.2	D53 A60	D53-S56 PolarHBondContact O-N 3.34Å; S56-A60 WeakPolarHBondContact O-CB 3.48Å; S56-A60 PolarHBondContact O-N 2.82Å; S56-A60 VanDerWaalsContact O-N 3.15Å
57	Y	35.5	Very low	32	Very low	78 Å²	78	78.9 Å²	78.9	31%	0.306	49%	0.494	S	S	.	.	H	α-helix	trans	-80.8	-43.3	-178.7	-147.1	-101.9	0	0	0	112.4	C52 D53 Y55 V59 A60 T61 P68	C52-Y57 WeakPolarHBondContact SG-CD2 3.36Å; D53-Y57 PolarHBondContact O-N 3.37Å; Y55-Y57 VanDerWaalsContact C-N 3.26Å; Y55-Y57 PolarHBondContact O-N 3.49Å; Y57-V59 VanDerWaalsContact C-N 3.29Å; Y57-V59 PolarHBondContact O-N 3Å; Y57-A60 PolarHBondContact O-N 2.92Å; Y57-T61 PolarHBondContact O-N 3.2Å; Y57-T61 PolarHBondContact O-OG1 3.43Å; Y57-P68 HydrophobicContact CE1-CB 3.78Å; Y57-P68 HydrophobicContact CE1-CG 4.19Å; Y57-P68 VanDerWaalsContact OH-CB 3.28Å; Y57-P68 WeakPolarHBondContact OH-CB 3.28Å
58	A	38.1	Very low	32.2	Very low	35 Å²	35	76 Å²	76	29%	0.289	47%	0.466	S	S	.	.	H	α-helix	trans	-64.9	-34.5	175.6	0	0	0	0	0	112.2	P54 A62	P54-A58 WeakPolarHBondContact O-CB 3.41Å; P54-A58 PolarHBondContact O-N 2.85Å; P54-A58 VanDerWaalsContact O-N 3.11Å; A58-A62 WeakPolarHBondContact O-CB 3.35Å; A58-A62 PolarHBondContact O-N 2.83Å
59	V	36.5	Very low	32.3	Very low	20 Å²	20	77.8 Å²	77.8	12%	0.121	46%	0.459	C	S	.	.	H	α-helix	trans	-67.4	-45.1	173.9	161.2	0	0	0	0	112.1	A26 A30 Y55 Y57 T61 A62 A63	A26-V59 HydrophobicContact CB-CG2 3.59Å; A26-V59 WeakPolarHBondContact O-CG2 3.38Å; A30-V59 HydrophobicContact CB-CB 4.16Å; A30-V59 HydrophobicContact CB-CG1 3.3Å; A30-V59 HydrophobicContact CB-CG2 4.05Å; Y55-V59 WeakPolarHBondContact O-CB 3.31Å; Y55-V59 WeakPolarHBondContact O-CG2 3.37Å; Y55-V59 PolarHBondContact O-N 3.03Å; Y57-V59 VanDerWaalsContact C-N 3.29Å; Y57-V59 PolarHBondContact O-N 3Å; V59-T61 VanDerWaalsContact C-N 3.32Å; V59-T61 PolarHBondContact O-N 3.11Å; V59-A62 PolarHBondContact O-N 3.44Å; V59-A63 WeakPolarHBondContact O-CB 3.38Å; V59-A63 PolarHBondContact O-N 3.36Å
60	A	36.6	Very low	32.4	Very low	23 Å²	23	78.2 Å²	78.2	19%	0.19	47%	0.467	C	S	.	.	H	α-helix	trans	-63.3	-38.8	176.8	0	0	0	0	0	111.9	S56 Y57 Y64	S56-A60 WeakPolarHBondContact O-CB 3.48Å; S56-A60 PolarHBondContact O-N 2.82Å; S56-A60 VanDerWaalsContact O-N 3.15Å; Y57-A60 PolarHBondContact O-N 2.92Å; A60-Y64 WeakPolarHBondContact O-CB 3.34Å; A60-Y64 PolarHBondContact O-N 3.42Å; A60-Y64 VanDerWaalsContact O-N 3.17Å
61	T	38.1	Very low	32.3	Very low	30 Å²	30	76.8 Å²	76.8	18%	0.184	46%	0.463	C	S	.	.	H	α-helix	trans	-72.5	-37.4	177.2	-57.9	0	0	0	0	112.8	Y57 V59 G65 M66	Y57-T61 PolarHBondContact O-N 3.2Å; Y57-T61 PolarHBondContact O-OG1 3.43Å; V59-T61 VanDerWaalsContact C-N 3.32Å; V59-T61 PolarHBondContact O-N 3.11Å; T61-G65 PolarHBondContact O-N 2.98Å; T61-M66 WeakPolarHBondContact CA-O 3.11Å; T61-M66 WeakPolarHBondContact CB-O 3.49Å; T61-M66 WeakPolarHBondContact CG2-O 3.45Å; T61-M66 PolarHBondContact OG1-O 2.88Å
62	A	36	Very low	32.3	Very low	75 Å²	75	71.5 Å²	71.5	62%	0.62	45%	0.445	S	S	*	.	H	α-helix	trans	-77.2	-36.9	179.5	0	0	0	0	0	113.8	A58 V59	A58-A62 WeakPolarHBondContact O-CB 3.35Å; A58-A62 PolarHBondContact O-N 2.83Å; V59-A62 PolarHBondContact O-N 3.44Å
63	A	32.1	Very low	32.1	Very low	49 Å²	49	74.1 Å²	74.1	41%	0.405	46%	0.461	S	S	.	.	H	α-helix	trans	-86.6	-28.2	-177	0	0	0	0	0	113.5	A30 V59	A30-A63 HydrophobicContact CB-CB 4.42Å; V59-A63 WeakPolarHBondContact O-CB 3.38Å; V59-A63 PolarHBondContact O-N 3.36Å
64	Y	29.6	Very low	31.8	Very low	102 Å²	102	77 Å²	77	40%	0.4	47%	0.468	S	S	.	.	H	α-helix	trans	-120.5	6.5	-171.2	-59.7	-66.8	0	0	0	114.7	P40 A60 M66	P40-Y64 HydrophobicContact CB-CE1 4.23Å; P40-Y64 HydrophobicContact CB-CE2 4.17Å; P40-Y64 HydrophobicContact CG-CD1 3.56Å; P40-Y64 HydrophobicContact CG-CD2 4.19Å; P40-Y64 HydrophobicContact CG-CE1 3.02Å; P40-Y64 HydrophobicContact CG-CE2 3.71Å; P40-Y64 HydrophobicContact CG-CG 4.12Å; P40-Y64 WeakPolarHBondContact CG-OH 3.1Å; A60-Y64 WeakPolarHBondContact O-CB 3.34Å; A60-Y64 PolarHBondContact O-N 3.42Å; A60-Y64 VanDerWaalsContact O-N 3.17Å; Y64-M66 PolarHBondContact O-N 3.16Å
65	G	27.8	Very low	31.4	Very low	64 Å²	64	82.1 Å²	82.1	66%	0.66	49%	0.487	S	S	*	.			trans	58.9	18.7	-177	0	0	0	0	0	112.9	T61 L67	T61-G65 PolarHBondContact O-N 2.98Å; G65-L67 VanDerWaalsContact C-N 3.35Å; G65-L67 PolarHBondContact O-N 2.89Å
66	M	30.1	Very low	30.9	Very low	126 Å²	126	82.7 Å²	82.7	62%	0.621	51%	0.511	S	S	*	.			trans	-80.5	85.5	-178.2	-71.8	-89.6	131	0	0	107.9	T61 Y64	T61-M66 WeakPolarHBondContact CA-O 3.11Å; T61-M66 WeakPolarHBondContact CB-O 3.49Å; T61-M66 WeakPolarHBondContact CG2-O 3.45Å; T61-M66 PolarHBondContact OG1-O 2.88Å; Y64-M66 PolarHBondContact O-N 3.16Å
67	L	29.1	Very low	30.3	Very low	149 Å²	149	83.7 Å²	83.7	78%	0.78	53%	0.531	S	S	*	.			trans	-57.2	131.2	160.1	-82.2	152.3	0	0	0	107.6	G65 N69	G65-L67 VanDerWaalsContact C-N 3.35Å; G65-L67 PolarHBondContact O-N 2.89Å; L67-N69 PolarHBondContact O-N 3.43Å
68	P	29.6	Very low	29.9	Very low	51 Å²	51	83.4 Å²	83.4	33%	0.331	54%	0.544	S	S	.	.			trans	-57.1	116.6	174.6	22.6	-31.4	0	0	0	108.8	Y57 A70	Y57-P68 HydrophobicContact CE1-CB 3.78Å; Y57-P68 HydrophobicContact CE1-CG 4.19Å; Y57-P68 VanDerWaalsContact OH-CB 3.28Å; Y57-P68 WeakPolarHBondContact OH-CB 3.28Å; P68-A70 PolarHBondContact O-N 2.95Å
69	N	28.1	Very low	29.3	Very low	111 Å²	111	82.7 Å²	82.7	59%	0.594	54%	0.54	S	S	*	.			trans	-53.9	113	159	166.2	0.2	0	0	0	106	L67 S71 A72	L67-N69 PolarHBondContact O-N 3.43Å; N69-S71 PolarHBondContact O-N 3.32Å; N69-S71 WeakPolarHBondContact OD1-CA 3.22Å; N69-S71 WeakPolarHBondContact OD1-CB 2.97Å; N69-S71 PolarHBondContact OD1-N 3.04Å; N69-S71 PolarHBondContact OD1-OG 3.01Å; N69-A72 PolarHBondContact O-N 3.35Å
70	A	27.9	Very low	28.8	Very low	88 Å²	88	88.9 Å²	88.9	73%	0.727	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.1	4.1	179	0	0	0	0	0	114.9	P68	P68-A70 PolarHBondContact O-N 2.95Å
71	S	26.5	Very low	28.4	Very low	97 Å²	97	91.4 Å²	91.4	68%	0.678	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.2	0.8	-175.2	-39.9	0	0	0	0	114.9	N69	N69-S71 PolarHBondContact O-N 3.32Å; N69-S71 WeakPolarHBondContact OD1-CA 3.22Å; N69-S71 WeakPolarHBondContact OD1-CB 2.97Å; N69-S71 PolarHBondContact OD1-N 3.04Å; N69-S71 PolarHBondContact OD1-OG 3.01Å
72	A	27.5	Very low	28	Very low	53 Å²	53	93 Å²	93	44%	0.438	60%	0.6	S	S	.	*	S	Bend	trans	-85.4	127.9	169.6	0	0	0	0	0	109.1	N69 Y74	N69-A72 PolarHBondContact O-N 3.35Å; A72-Y74 WeakPolarHBondContact O-CD2 3.34Å; A72-Y74 PolarHBondContact O-N 3.38Å
73	P	25.7	Very low	27.7	Very low	121 Å²	121	91.4 Å²	91.4	79%	0.786	59%	0.587	S	S	*	*			trans	-64.7	99.6	-167.5	24.9	-33.2	0	0	0	111.3	Q75	P73-Q75 PolarHBondContact O-N 2.93Å
74	Y	26.6	Very low	27.7	Very low	131 Å²	131	91.1 Å²	91.1	51%	0.514	59%	0.585	S	S	.	*			trans	-55.9	99.9	160.4	-76.5	-93.8	0	0	0	108	A72 A76	A72-Y74 WeakPolarHBondContact O-CD2 3.34Å; A72-Y74 PolarHBondContact O-N 3.38Å; Y74-A76 PolarHBondContact O-N 3.41Å
75	Q	26.5	Very low	27.9	Very low	165 Å²	165	87.9 Å²	87.9	77%	0.771	58%	0.579	S	S	*	*			trans	-66.4	128.2	170.4	-70.5	-158.2	-5.2	0	0	109.2	P73	P73-Q75 PolarHBondContact O-N 2.93Å
76	A	24.6	Very low	28.3	Very low	107 Å²	107	87.2 Å²	87.2	88%	0.884	56%	0.56	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.4	136.1	-163.2	0	0	0	0	0	114.1	Y74	Y74-A76 PolarHBondContact O-N 3.41Å
77	G	24.8	Very low	28.4	Very low	82 Å²	82	87.9 Å²	87.9	85%	0.845	56%	0.561	S	S	*	*	T	Hydrogen-bonded Turn	trans	115.3	-32.8	162.6	0	0	0	0	0	116.4
78	A	25.6	Very low	28.5	Very low	72 Å²	72	86.5 Å²	86.5	60%	0.595	55%	0.551	S	S	*	*	S	Bend	trans	-101.1	-18.3	-175.9	0	0	0	0	0	114.3	M82	A78-M82 WeakPolarHBondContact O-CB 3.01Å
79	G	26.4	Very low	28.7	Very low	20 Å²	20	86.3 Å²	86.3	21%	0.206	55%	0.554	C	S	.	*	H	α-helix	trans	-75.9	-21.6	-172.7	0	0	0	0	0	116.2	A83	G79-A83 WeakPolarHBondContact O-CB 3.46Å; G79-A83 PolarHBondContact O-N 2.87Å; G79-A83 VanDerWaalsContact O-N 3.09Å
80	N	25.7	Very low	29	Very low	150 Å²	150	86.8 Å²	86.8	80%	0.802	55%	0.551	S	S	*	*	H	α-helix	trans	-78.7	-39.5	-175.8	-115	26	0	0	0	113	M82 A84	N80-M82 VanDerWaalsContact C-N 3.31Å; N80-A84 PolarHBondContact O-N 2.77Å
81	A	28.4	Very low	29.1	Very low	76 Å²	76	86.8 Å²	86.8	63%	0.628	55%	0.546	S	S	*	.	H	α-helix	trans	-71.4	-32	175.2	0	0	0	0	0	111.7	A84 A85	A81-A84 PolarHBondContact O-N 2.97Å; A81-A85 PolarHBondContact O-N 3.34Å
82	M	28.6	Very low	29.4	Very low	63 Å²	63	85.7 Å²	85.7	31%	0.31	53%	0.532	S	S	.	.	H	α-helix	trans	-73.9	-41.9	-178.1	-162.9	176.5	-157.5	0	0	112.3	P54 A78 N80 A84 A85 I86	P54-M82 HydrophobicContact CB-CE 3.21Å; P54-M82 HydrophobicContact CG-CE 3.48Å; P54-M82 VanDerWaalsContact CG-CE 3.48Å; A78-M82 WeakPolarHBondContact O-CB 3.01Å; N80-M82 VanDerWaalsContact C-N 3.31Å; M82-A84 VanDerWaalsContact C-N 3.27Å; M82-A84 PolarHBondContact O-N 3.39Å; M82-A85 PolarHBondContact O-N 3.45Å; M82-I86 HydrophobicContact CG-CD1 4.28Å; M82-I86 WeakPolarHBondContact O-CB 3.38Å; M82-I86 WeakPolarHBondContact O-CD1 3.38Å; M82-I86 VanDerWaalsContact O-CG1 3.23Å; M82-I86 WeakPolarHBondContact O-CG1 3.4Å; M82-I86 PolarHBondContact O-N 3.02Å
83	A	30.1	Very low	29.6	Very low	43 Å²	43	88.2 Å²	88.2	36%	0.355	54%	0.544	S	S	.	.	H	α-helix	trans	-61.3	-36.5	171.2	0	0	0	0	0	112.1	G79 Q87	G79-A83 WeakPolarHBondContact O-CB 3.46Å; G79-A83 PolarHBondContact O-N 2.87Å; G79-A83 VanDerWaalsContact O-N 3.09Å; A83-Q87 WeakPolarHBondContact O-CB 3.44Å; A83-Q87 VanDerWaalsContact O-CG 3.31Å; A83-Q87 WeakPolarHBondContact O-CG 3.35Å; A83-Q87 PolarHBondContact O-N 3.17Å
84	A	31.6	Very low	30	Very low	43 Å²	43	85.6 Å²	85.6	36%	0.355	53%	0.533	S	S	.	.	H	α-helix	trans	-69.1	-40	175.6	0	0	0	0	0	112.7	N80 A81 M82 Q87 Q88	N80-A84 PolarHBondContact O-N 2.77Å; A81-A84 PolarHBondContact O-N 2.97Å; M82-A84 VanDerWaalsContact C-N 3.27Å; M82-A84 PolarHBondContact O-N 3.39Å; A84-Q87 PolarHBondContact O-N 3.19Å; A84-Q88 WeakPolarHBondContact O-CB 3.04Å; A84-Q88 WeakPolarHBondContact O-CG 2.9Å; A84-Q88 PolarHBondContact O-N 2.95Å
85	A	33.9	Very low	30.6	Very low	34 Å²	34	81.9 Å²	81.9	28%	0.281	52%	0.523	S	S	.	.	H	α-helix	trans	-66.8	-39.9	176.3	0	0	0	0	0	112.2	A81 M82 Q88 A89	A81-A85 PolarHBondContact O-N 3.34Å; M82-A85 PolarHBondContact O-N 3.45Å; A85-Q88 PolarHBondContact O-N 3.06Å; A85-A89 PolarHBondContact O-N 3.39Å
86	I	36.2	Very low	31.2	Very low	50 Å²	50	76.1 Å²	76.1	26%	0.256	50%	0.504	S	S	.	.	H	α-helix	trans	-65.4	-46.5	174.8	-67.7	167.1	0	0	0	110.2	M82 Q88 A89 F90	M82-I86 HydrophobicContact CG-CD1 4.28Å; M82-I86 WeakPolarHBondContact O-CB 3.38Å; M82-I86 WeakPolarHBondContact O-CD1 3.38Å; M82-I86 VanDerWaalsContact O-CG1 3.23Å; M82-I86 WeakPolarHBondContact O-CG1 3.4Å; M82-I86 PolarHBondContact O-N 3.02Å; I86-Q88 VanDerWaalsContact C-N 3.31Å; I86-Q88 PolarHBondContact O-N 2.91Å; I86-A89 PolarHBondContact O-N 3.49Å; I86-F90 HydrophobicContact CG2-CD2 3.68Å; I86-F90 HydrophobicContact CG2-CE2 3.46Å; I86-F90 VanDerWaalsContact CG2-CE2 3.46Å; I86-F90 WeakPolarHBondContact O-CD2 3.49Å; I86-F90 PolarHBondContact O-N 2.88Å
87	Q	34	Very low	31.7	Very low	139 Å²	139	73.6 Å²	73.6	65%	0.65	48%	0.483	S	S	*	.	H	α-helix	trans	-62.6	-34.7	174.7	-77.6	175.6	13.8	0	0	113.1	A83 A84 F90 S91	A83-Q87 WeakPolarHBondContact O-CB 3.44Å; A83-Q87 VanDerWaalsContact O-CG 3.31Å; A83-Q87 WeakPolarHBondContact O-CG 3.35Å; A83-Q87 PolarHBondContact O-N 3.17Å; A84-Q87 PolarHBondContact O-N 3.19Å; Q87-F90 PolarHBondContact O-N 3.02Å; Q87-S91 PolarHBondContact O-N 3.31Å; Q87-S91 VanDerWaalsContact O-N 3.1Å; Q87-S91 PolarHBondContact O-OG 3.09Å
88	Q	30.6	Very low	32.4	Very low	121 Å²	121	72.3 Å²	72.3	57%	0.565	46%	0.464	S	S	*	.	H	α-helix	trans	-69.3	-36.4	174.4	-81.1	-176.2	22.5	0	0	113	A84 A85 I86 S91	A84-Q88 WeakPolarHBondContact O-CB 3.04Å; A84-Q88 WeakPolarHBondContact O-CG 2.9Å; A84-Q88 PolarHBondContact O-N 2.95Å; A85-Q88 PolarHBondContact O-N 3.06Å; I86-Q88 VanDerWaalsContact C-N 3.31Å; I86-Q88 PolarHBondContact O-N 2.91Å; Q88-S91 VanDerWaalsContact CA-OG 3.24Å; Q88-S91 WeakPolarHBondContact CA-OG 3.29Å; Q88-S91 PolarHBondContact O-N 2.99Å; Q88-S91 PolarHBondContact O-OG 3.28Å; Q88-S91 VanDerWaalsContact O-OG 3.12Å
89	A	33.3	Very low	33.2	Very low	47 Å²	47	70 Å²	70	39%	0.388	45%	0.445	S	S	.	.	H	α-helix	trans	-68.3	-36.1	174.1	0	0	0	0	0	112.4	A85 I86	A85-A89 PolarHBondContact O-N 3.39Å; I86-A89 PolarHBondContact O-N 3.49Å
90	F	34.8	Very low	33.8	Very low	121 Å²	121	75.3 Å²	75.3	53%	0.531	47%	0.468	S	S	.	.	H	α-helix	trans	-75.7	-18.2	175	-77.5	-65.7	0	0	0	114.4	I86 Q87 N92	I86-F90 HydrophobicContact CG2-CD2 3.68Å; I86-F90 HydrophobicContact CG2-CE2 3.46Å; I86-F90 VanDerWaalsContact CG2-CE2 3.46Å; I86-F90 WeakPolarHBondContact O-CD2 3.49Å; I86-F90 PolarHBondContact O-N 2.88Å; Q87-F90 PolarHBondContact O-N 3.02Å; F90-N92 VanDerWaalsContact C-N 3.33Å
91	S	30.7	Very low	34.4	Very low	88 Å²	88	74.8 Å²	74.8	62%	0.615	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.3	-2.4	178.4	31.7	0	0	0	0	113.7	Q87 Q88	Q87-S91 PolarHBondContact O-N 3.31Å; Q87-S91 VanDerWaalsContact O-N 3.1Å; Q87-S91 PolarHBondContact O-OG 3.09Å; Q88-S91 VanDerWaalsContact CA-OG 3.24Å; Q88-S91 WeakPolarHBondContact CA-OG 3.29Å; Q88-S91 PolarHBondContact O-N 2.99Å; Q88-S91 PolarHBondContact O-OG 3.28Å; Q88-S91 VanDerWaalsContact O-OG 3.12Å
92	N	32	Very low	34.8	Very low	74 Å²	74	72.8 Å²	72.8	40%	0.396	44%	0.444	S	S	.	.			trans	-116.4	100.5	170.8	-166.6	-25.4	0	0	0	111.4	F90 A94 V95 A96	F90-N92 VanDerWaalsContact C-N 3.33Å; N92-A94 PolarHBondContact O-N 3.07Å; N92-A94 VanDerWaalsContact O-N 3.11Å; N92-A94 WeakPolarHBondContact OD1-CB 3.47Å; N92-A94 PolarHBondContact OD1-N 3.36Å; N92-A94 VanDerWaalsContact OD1-N 3.1Å; N92-V95 HydrophobicContact CB-CB 4.12Å; N92-V95 HydrophobicContact CB-CG2 3.79Å; N92-V95 PolarHBondContact O-N 3Å; N92-A96 PolarHBondContact O-N 2.96Å; N92-A96 VanDerWaalsContact O-N 3.15Å
93	P	31.7	Very low	35.2	Very low	105 Å²	105	70.4 Å²	70.4	68%	0.682	44%	0.435	S	S	*	.	H	α-helix	trans	-60.3	-23.9	-178.5	20.5	-30.2	0	0	0	113.6	A97	P93-A97 WeakPolarHBondContact O-CB 2.97Å; P93-A97 PolarHBondContact O-N 3.06Å
94	A	34.9	Very low	35.4	Very low	67 Å²	67	71.3 Å²	71.3	55%	0.554	44%	0.442	S	S	*	.	H	α-helix	trans	-71.8	-33.8	174.8	0	0	0	0	0	112.5	N92 A98	N92-A94 PolarHBondContact O-N 3.07Å; N92-A94 VanDerWaalsContact O-N 3.11Å; N92-A94 WeakPolarHBondContact OD1-CB 3.47Å; N92-A94 PolarHBondContact OD1-N 3.36Å; N92-A94 VanDerWaalsContact OD1-N 3.1Å; A94-A98 VanDerWaalsContact O-CB 3.28Å; A94-A98 WeakPolarHBondContact O-CB 3.38Å; A94-A98 PolarHBondContact O-N 3.46Å
95	V	38.4	Very low	35.5	Very low	53 Å²	53	71.9 Å²	71.9	32%	0.321	45%	0.447	S	S	.	.	H	α-helix	trans	-74.4	-41.1	177.9	178.7	0	0	0	0	110.2	N92 A98 A99	N92-V95 HydrophobicContact CB-CB 4.12Å; N92-V95 HydrophobicContact CB-CG2 3.79Å; N92-V95 PolarHBondContact O-N 3Å; V95-A98 PolarHBondContact O-N 2.91Å; V95-A99 WeakPolarHBondContact O-CB 3.13Å; V95-A99 PolarHBondContact O-N 3.45Å
96	A	38.1	Very low	35.4	Very low	44 Å²	44	71 Å²	71	36%	0.364	44%	0.439	S	S	.	.	H	α-helix	trans	-62.8	-42.6	173.2	0	0	0	0	0	112.1	N92 L100	N92-A96 PolarHBondContact O-N 2.96Å; N92-A96 VanDerWaalsContact O-N 3.15Å; A96-L100 WeakPolarHBondContact O-CB 3.01Å; A96-L100 PolarHBondContact O-N 2.91Å
97	A	36.4	Very low	35	Very low	53 Å²	53	72.5 Å²	72.5	44%	0.438	45%	0.448	S	S	.	.	H	α-helix	trans	-67.3	-40.8	177.1	0	0	0	0	0	112.6	P93 L100 Q101	P93-A97 WeakPolarHBondContact O-CB 2.97Å; P93-A97 PolarHBondContact O-N 3.06Å; A97-L100 PolarHBondContact O-N 3.27Å; A97-Q101 VanDerWaalsContact O-CB 3.31Å; A97-Q101 WeakPolarHBondContact O-CB 3.25Å; A97-Q101 PolarHBondContact O-N 3.1Å
98	A	40	Very low	34.7	Very low	55 Å²	55	69.9 Å²	69.9	46%	0.455	45%	0.45	S	S	.	.	H	α-helix	trans	-65.3	-40	176.6	0	0	0	0	0	112.2	A94 V95 Q101 A102	A94-A98 VanDerWaalsContact O-CB 3.28Å; A94-A98 WeakPolarHBondContact O-CB 3.38Å; A94-A98 PolarHBondContact O-N 3.46Å; V95-A98 PolarHBondContact O-N 2.91Å; A98-Q101 PolarHBondContact O-N 3.03Å; A98-A102 WeakPolarHBondContact O-CB 3.22Å; A98-A102 PolarHBondContact O-N 3.48Å
99	A	40.4	Very low	34.5	Very low	24 Å²	24	69.7 Å²	69.7	20%	0.198	45%	0.453	C	S	.	.	H	α-helix	trans	-62.5	-46.8	173.2	0	0	0	0	0	111	A23 A27 V95 Q101 A102 A103	A23-A99 HydrophobicContact CB-CB 4.35Å; A27-A99 HydrophobicContact CB-CB 4.47Å; A27-A99 WeakPolarHBondContact CB-O 3.37Å; V95-A99 WeakPolarHBondContact O-CB 3.13Å; V95-A99 PolarHBondContact O-N 3.45Å; A99-Q101 VanDerWaalsContact C-N 3.31Å; A99-Q101 PolarHBondContact O-N 3.06Å; A99-A102 PolarHBondContact O-N 2.95Å; A99-A103 PolarHBondContact O-N 3.15Å
100	L	39	Very low	34.1	Very low	131 Å²	131	70.7 Å²	70.7	69%	0.686	47%	0.468	S	S	*	.	H	α-helix	trans	-62.9	-37	177.9	-167.4	69.2	0	0	0	112.6	A96 A97 A103 A104	A96-L100 WeakPolarHBondContact O-CB 3.01Å; A96-L100 PolarHBondContact O-N 2.91Å; A97-L100 PolarHBondContact O-N 3.27Å; L100-A103 WeakPolarHBondContact O-CB 2.92Å; L100-A103 PolarHBondContact O-N 3.12Å; L100-A104 PolarHBondContact O-N 2.98Å
101	Q	38.3	Very low	33.8	Very low	140 Å²	140	69.5 Å²	69.5	65%	0.654	47%	0.466	S	S	*	.	H	α-helix	trans	-73.3	-37.1	178.9	-167.5	164.5	20.5	0	0	112.5	A97 A98 A99 A103 A104 A105	A97-Q101 VanDerWaalsContact O-CB 3.31Å; A97-Q101 WeakPolarHBondContact O-CB 3.25Å; A97-Q101 PolarHBondContact O-N 3.1Å; A98-Q101 PolarHBondContact O-N 3.03Å; A99-Q101 VanDerWaalsContact C-N 3.31Å; A99-Q101 PolarHBondContact O-N 3.06Å; Q101-A103 VanDerWaalsContact C-N 3.35Å; Q101-A104 PolarHBondContact O-N 3.19Å; Q101-A105 PolarHBondContact O-N 3.4Å; Q101-A105 VanDerWaalsContact O-N 3.12Å
102	A	38.5	Very low	33.5	Very low	33 Å²	33	69.7 Å²	69.7	27%	0.273	47%	0.465	S	S	.	.	H	α-helix	trans	-65.4	-36.9	172.5	0	0	0	0	0	112.1	A24 A27 A98 A99 A105 A106	A24-A102 HydrophobicContact CB-CB 4.04Å; A27-A102 HydrophobicContact CB-CB 4.48Å; A98-A102 WeakPolarHBondContact O-CB 3.22Å; A98-A102 PolarHBondContact O-N 3.48Å; A99-A102 PolarHBondContact O-N 2.95Å; A102-A105 PolarHBondContact O-N 3.19Å; A102-A106 PolarHBondContact O-N 3.44Å
103	A	36.8	Very low	33.4	Very low	14 Å²	14	71.4 Å²	71.4	12%	0.116	47%	0.469	C	S	.	.	H	α-helix	trans	-59.5	-50.1	173.6	0	0	0	0	0	111.5	A27 S31 A99 L100 Q101 A105 A106 N107	A27-A103 HydrophobicContact CB-CB 3.7Å; A27-A103 VanDerWaalsContact O-CA 3.27Å; A27-A103 WeakPolarHBondContact O-CA 3.3Å; A27-A103 WeakPolarHBondContact O-CB 3.4Å; S31-A103 WeakPolarHBondContact CB-O 3.27Å; S31-A103 PolarHBondContact OG-O 3.43Å; A99-A103 PolarHBondContact O-N 3.15Å; L100-A103 WeakPolarHBondContact O-CB 2.92Å; L100-A103 PolarHBondContact O-N 3.12Å; Q101-A103 VanDerWaalsContact C-N 3.35Å; A103-A105 VanDerWaalsContact C-N 3.31Å; A103-A105 PolarHBondContact O-N 3.2Å; A103-A106 PolarHBondContact O-N 3.48Å; A103-N107 PolarHBondContact O-N 3.4Å
104	A	34.1	Very low	33	Very low	61 Å²	61	71.1 Å²	71.1	50%	0.504	47%	0.466	S	S	.	.	H	α-helix	trans	-63.6	-36.7	-178.2	0	0	0	0	0	112.3	L100 Q101 N107 A108	L100-A104 PolarHBondContact O-N 2.98Å; Q101-A104 PolarHBondContact O-N 3.19Å; A104-N107 PolarHBondContact O-N 3.3Å; A104-A108 PolarHBondContact O-N 3.49Å
105	A	32.8	Very low	32.5	Very low	55 Å²	55	74 Å²	74	46%	0.455	48%	0.476	S	S	.	.	H	α-helix	trans	-70.6	-32.8	178.8	0	0	0	0	0	113.5	Q101 A102 A103 N109	Q101-A105 PolarHBondContact O-N 3.4Å; Q101-A105 VanDerWaalsContact O-N 3.12Å; A102-A105 PolarHBondContact O-N 3.19Å; A103-A105 VanDerWaalsContact C-N 3.31Å; A103-A105 PolarHBondContact O-N 3.2Å; A105-N109 PolarHBondContact O-ND2 3.32Å
106	A	32.9	Very low	31.9	Very low	15 Å²	15	77.2 Å²	77.2	12%	0.124	50%	0.501	C	S	.	.	H	α-helix	trans	-71.4	-37.6	175.4	0	0	0	0	0	112	A28 A102 A103 N109 F113	A28-A106 HydrophobicContact CB-CB 3.66Å; A102-A106 PolarHBondContact O-N 3.44Å; A103-A106 PolarHBondContact O-N 3.48Å; A106-N109 PolarHBondContact O-N 3.23Å; A106-F113 HydrophobicContact CB-CZ 4.25Å
107	N	28.1	Very low	31.4	Very low	83 Å²	83	79.9 Å²	79.9	44%	0.444	52%	0.515	S	S	.	.	H	α-helix	trans	-61.5	-43.6	176.2	-153.6	-18.2	0	0	0	112.7	S31 A103 A104 N109 G110	S31-N107 PolarHBondContact O-ND2 2.66Å; S31-N107 PolarHBondContact O-OD1 3.07Å; S31-N107 WeakPolarHBondContact OG-CB 3.23Å; S31-N107 PolarHBondContact OG-ND2 3.18Å; A103-N107 PolarHBondContact O-N 3.4Å; A104-N107 PolarHBondContact O-N 3.3Å; N107-N109 PolarHBondContact O-N 3.44Å; N107-N109 VanDerWaalsContact O-N 3.14Å; N107-G110 PolarHBondContact O-N 3.05Å
108	A	26.2	Very low	31	Very low	83 Å²	83	81.6 Å²	81.6	69%	0.686	52%	0.515	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.8	-16.5	-174.3	0	0	0	0	0	113.8	A104	A104-A108 PolarHBondContact O-N 3.49Å
109	N	26.2	Very low	30.4	Very low	118 Å²	118	83.6 Å²	83.6	63%	0.631	53%	0.532	S	S	*	.	T	Hydrogen-bonded Turn	trans	-110.4	6.4	-174	-74.2	-65	0	0	0	114.5	A105 A106 N107 I111	A105-N109 PolarHBondContact O-ND2 3.32Å; A106-N109 PolarHBondContact O-N 3.23Å; N107-N109 PolarHBondContact O-N 3.44Å; N107-N109 VanDerWaalsContact O-N 3.14Å; N109-I111 HydrophobicContact CB-CD1 3.81Å; N109-I111 HydrophobicContact CB-CG1 3.6Å; N109-I111 PolarHBondContact O-N 3.14Å; N109-I111 VanDerWaalsContact O-N 3.09Å
110	G	25.6	Very low	29.7	Very low	68 Å²	68	88.6 Å²	88.6	70%	0.701	56%	0.56	S	S	*	*	T	Hydrogen-bonded Turn	trans	58.2	27.2	174.9	0	0	0	0	0	114.5	N107 P112	N107-G110 PolarHBondContact O-N 3.05Å; G110-P112 VanDerWaalsContact O-CD 3.27Å; G110-P112 WeakPolarHBondContact O-CD 3.03Å
111	I	27.9	Very low	29.3	Very low	95 Å²	95	84 Å²	84	49%	0.487	54%	0.54	S	S	.	.			trans	-75.2	116.7	-171.6	-47.2	178.2	0	0	0	109	N109 F113	N109-I111 HydrophobicContact CB-CD1 3.81Å; N109-I111 HydrophobicContact CB-CG1 3.6Å; N109-I111 PolarHBondContact O-N 3.14Å; N109-I111 VanDerWaalsContact O-N 3.09Å; I111-F113 PolarHBondContact O-N 3.01Å
112	P	25.7	Very low	29.1	Very low	92 Å²	92	81.7 Å²	81.7	60%	0.597	54%	0.537	S	S	*	.			trans	-67.6	132.2	170.6	26.4	-30.3	0	0	0	109.6	G110 T114	G110-P112 VanDerWaalsContact O-CD 3.27Å; G110-P112 WeakPolarHBondContact O-CD 3.03Å; P112-T114 PolarHBondContact O-N 3.25Å
113	F	29.4	Very low	28.8	Very low	110 Å²	110	85.6 Å²	85.6	48%	0.482	55%	0.545	S	S	.	.	S	Bend	trans	-70.1	43.9	177.9	-78.1	-78.3	0	0	0	113.9	A28 A106 I111	A28-F113 VanDerWaalsContact CA-CZ 3.47Å; A28-F113 HydrophobicContact CB-CE1 3.22Å; A28-F113 HydrophobicContact CB-CZ 3.31Å; A28-F113 WeakPolarHBondContact O-CE2 3.21Å; A28-F113 WeakPolarHBondContact O-CZ 3.48Å; A106-F113 HydrophobicContact CB-CZ 4.25Å; I111-F113 PolarHBondContact O-N 3.01Å
114	T	23.6	Very low	28.6	Very low	99 Å²	99	90.8 Å²	90.8	61%	0.607	57%	0.567	S	S	*	*			trans	-115.8	116.3	178.8	58.6	0	0	0	0	108.2	P112	P112-T114 PolarHBondContact O-N 3.25Å
115	T	24.8	Very low	28.6	Very low	127 Å²	127	91.9 Å²	91.9	78%	0.779	57%	0.571	S	S	*	*	S	Bend	trans	84.3	115.6	-174.4	75.6	0	0	0	0	115.2	P117	T115-P117 WeakPolarHBondContact O-CD 3.07Å; T115-P117 WeakPolarHBondContact O-CG 3.47Å
116	S	25.3	Very low	28.8	Very low	121 Å²	121	91.7 Å²	91.7	85%	0.846	56%	0.562	S	S	*	*			trans	-62.4	114.6	168.2	-89.1	0	0	0	0	110
117	P	27.3	Very low	28.7	Very low	101 Å²	101	94.2 Å²	94.2	66%	0.656	59%	0.59	S	S	*	*			trans	-95.9	-1.3	-178.9	-0.2	21.6	0	0	0	113.7	T115 A119 T120	T115-P117 WeakPolarHBondContact O-CD 3.07Å; T115-P117 WeakPolarHBondContact O-CG 3.47Å; P117-A119 PolarHBondContact O-N 3.32Å; P117-T120 PolarHBondContact O-N 3.09Å
118	M	28.5	Very low	28.9	Very low	88 Å²	88	96.6 Å²	96.6	43%	0.433	60%	0.603	S	S	.	*	T	Hydrogen-bonded Turn	trans	-70.9	0.1	-178.1	-73.1	-160.7	72	0	0	114.4	N21 T120 Y123	N21-M118 HydrophobicContact CB-CE 4.05Å; N21-M118 HydrophobicContact CB-SD 3.9Å; N21-M118 WeakPolarHBondContact OD1-CE 3.39Å; M118-T120 PolarHBondContact O-N 3.46Å; M118-Y123 HydrophobicContact CE-CD2 4.33Å; M118-Y123 HydrophobicContact CE-CE2 4.25Å
119	A	27.6	Very low	29.1	Very low	98 Å²	98	95.9 Å²	95.9	81%	0.81	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.4	-7	172.6	0	0	0	0	0	114.1	P117	P117-A119 PolarHBondContact O-N 3.32Å
120	T	26.1	Very low	29.3	Very low	129 Å²	129	95.8 Å²	95.8	79%	0.791	60%	0.599	S	S	*	*	S	Bend	trans	-136.7	4.1	-169	-27.8	0	0	0	0	116.1	P117 M118	P117-T120 PolarHBondContact O-N 3.09Å; M118-T120 PolarHBondContact O-N 3.46Å
121	A	30.2	Very low	29.9	Very low	33 Å²	33	97.4 Å²	97.4	27%	0.273	59%	0.591	S	S	.	*			trans	-116.5	112.2	-178.5	0	0	0	0	0	112.1	Y123	A121-Y123 HydrophobicContact CB-CD2 4.16Å; A121-Y123 HydrophobicContact CB-CE2 3.53Å; A121-Y123 WeakPolarHBondContact O-CD2 3.24Å; A121-Y123 PolarHBondContact O-N 2.99Å
122	T	32.6	Very low	30.1	Very low	93 Å²	93	97.8 Å²	97.8	57%	0.571	59%	0.591	S	S	*	*			trans	-77	108.4	172.9	-48.8	0	0	0	0	108.7	A134	T122-A134 HydrophobicContact CG2-CB 4.27Å; T122-A134 WeakPolarHBondContact O-CB 3.35Å; T122-A134 PolarHBondContact O-N 3.31Å
123	Y	33.9	Very low	30.7	Very low	114 Å²	114	96.5 Å²	96.5	45%	0.447	58%	0.579	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-94.7	132.3	170.7	-67.7	-90.7	0	0	0	109.5	M118 A121 Q132 N133	M118-Y123 HydrophobicContact CE-CD2 4.33Å; M118-Y123 HydrophobicContact CE-CE2 4.25Å; A121-Y123 HydrophobicContact CB-CD2 4.16Å; A121-Y123 HydrophobicContact CB-CE2 3.53Å; A121-Y123 WeakPolarHBondContact O-CD2 3.24Å; A121-Y123 PolarHBondContact O-N 2.99Å; Y123-Q132 CarbonylContact C-O 3.57Å; Y123-Q132 WeakPolarHBondContact CA-O 2.85Å; Y123-N133 HydrophobicContact CD1-CB 4.31Å; Y123-N133 HydrophobicContact CE1-CB 4.09Å
124	Q	32.2	Very low	31.2	Very low	124 Å²	124	93.6 Å²	93.6	58%	0.579	58%	0.575	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-110.7	138.4	175.4	-74.5	177.1	-8.7	0	0	110.1	Q132 A134	Q124-Q132 PolarHBondContact N-O 3.38Å; Q124-Q132 PolarHBondContact O-N 3.07Å; Q124-A134 HydrophobicContact CB-CB 4.42Å; Q124-A134 HydrophobicContact CG-CB 3.86Å
125	S	34.3	Very low	32	Very low	84 Å²	84	93.7 Å²	93.7	59%	0.587	58%	0.575	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-76.3	134.3	172.8	174.3	0	0	0	0	110.1	G127	S125-G127 VanDerWaalsContact C-N 3.3Å; S125-G127 PolarHBondContact O-N 3.39Å
126	N	37.2	Very low	32.6	Very low	50 Å²	50	90.5 Å²	90.5	27%	0.267	56%	0.562	S	S	.	*			trans	-89.3	17.5	-178	76.3	-17.2	0	0	0	115.2	N128 Q130 Q132	N126-N128 PolarHBondContact O-N 2.98Å; N126-N128 VanDerWaalsContact O-N 3.11Å; N126-N128 WeakPolarHBondContact OD1-CA 3.07Å; N126-N128 WeakPolarHBondContact OD1-CB 3.19Å; N126-N128 PolarHBondContact OD1-N 3.45Å; N126-Q130 PolarHBondContact N-O 2.88Å; N126-Q130 VanDerWaalsContact N-O 3.08Å; N126-Q130 WeakPolarHBondContact OD1-CB 3.1Å; N126-Q130 PolarHBondContact OD1-N 3.14Å; N126-Q130 VanDerWaalsContact OD1-N 3.1Å; N126-Q130 PolarHBondContact OD1-O 3.14Å; N126-Q132 VanDerWaalsContact CB-CD 3.41Å; N126-Q132 HydrophobicContact CB-CG 3.91Å; N126-Q132 PolarHBondContact ND2-NE2 2.8Å; N126-Q132 VanDerWaalsContact ND2-NE2 3.15Å
127	G	30.8	Very low	32.8	Very low	69 Å²	69	89.3 Å²	89.3	71%	0.711	55%	0.549	S	S	*	.	S	Bend	trans	74.1	-9.1	-176	0	0	0	0	0	115	S125	S125-G127 VanDerWaalsContact C-N 3.3Å; S125-G127 PolarHBondContact O-N 3.39Å
128	N	31.4	Very low	33	Very low	133 Å²	133	87.7 Å²	87.7	71%	0.711	54%	0.539	S	S	*	.	S	Bend	trans	-109.9	15.7	178.2	-63	-27.5	0	0	0	112.9	N126 Q130	N126-N128 PolarHBondContact O-N 2.98Å; N126-N128 VanDerWaalsContact O-N 3.11Å; N126-N128 WeakPolarHBondContact OD1-CA 3.07Å; N126-N128 WeakPolarHBondContact OD1-CB 3.19Å; N126-N128 PolarHBondContact OD1-N 3.45Å; N128-Q130 PolarHBondContact O-N 3.46Å
129	G	30	Very low	33.2	Very low	67 Å²	67	86.9 Å²	86.9	69%	0.691	55%	0.546	S	S	*	.	S	Bend	trans	72.2	14.3	-176.4	0	0	0	0	0	114.3
130	Q	31.7	Very low	33.6	Very low	117 Å²	117	87.2 Å²	87.2	55%	0.547	54%	0.543	S	S	.	.			trans	-100.2	136	173.2	-52.6	-76.2	-49.3	0	0	109.6	N126 N128	N126-Q130 PolarHBondContact N-O 2.88Å; N126-Q130 VanDerWaalsContact N-O 3.08Å; N126-Q130 WeakPolarHBondContact OD1-CB 3.1Å; N126-Q130 PolarHBondContact OD1-N 3.14Å; N126-Q130 VanDerWaalsContact OD1-N 3.1Å; N126-Q130 PolarHBondContact OD1-O 3.14Å; N128-Q130 PolarHBondContact O-N 3.46Å
131	L	36.5	Very low	34	Very low	101 Å²	101	87 Å²	87	53%	0.529	54%	0.537	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.2	123	174	-63.4	172.4	0	0	0	109.4
132	Q	32.2	Very low	34.2	Very low	104 Å²	104	94.5 Å²	94.5	49%	0.486	56%	0.558	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-109.7	134.4	175.6	-62.2	-175.6	-0.8	0	0	109.7	Y123 Q124 N126 A134	Y123-Q132 CarbonylContact C-O 3.57Å; Y123-Q132 WeakPolarHBondContact CA-O 2.85Å; Q124-Q132 PolarHBondContact N-O 3.38Å; Q124-Q132 PolarHBondContact O-N 3.07Å; N126-Q132 VanDerWaalsContact CB-CD 3.41Å; N126-Q132 HydrophobicContact CB-CG 3.91Å; N126-Q132 PolarHBondContact ND2-NE2 2.8Å; N126-Q132 VanDerWaalsContact ND2-NE2 3.15Å; Q132-A134 PolarHBondContact O-N 3.23Å
133	N	38.4	Very low	34.2	Very low	65 Å²	65	98.6 Å²	98.6	35%	0.348	57%	0.571	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-69.6	111.5	174.3	178.9	-7.4	0	0	0	108.9	Y123 T135 A136	Y123-N133 HydrophobicContact CD1-CB 4.31Å; Y123-N133 HydrophobicContact CE1-CB 4.09Å; N133-T135 PolarHBondContact O-N 3.48Å; N133-T135 WeakPolarHBondContact OD1-CA 3.38Å; N133-T135 WeakPolarHBondContact OD1-CB 3.27Å; N133-T135 PolarHBondContact OD1-N 3.2Å; N133-T135 PolarHBondContact OD1-OG1 3.09Å; N133-A136 HydrophobicContact CB-CB 3.82Å; N133-A136 PolarHBondContact O-N 3.22Å; N133-A136 VanDerWaalsContact O-N 3.09Å; N133-A136 PolarHBondContact OD1-N 2.79Å
134	A	40.9	Very low	34.5	Very low	48 Å²	48	106 Å²	106	40%	0.397	61%	0.61	S	S	.	*	T	Hydrogen-bonded Turn	trans	-68.2	-7.3	-177.3	0	0	0	0	0	113.3	T122 Q124 Q132	T122-A134 HydrophobicContact CG2-CB 4.27Å; T122-A134 WeakPolarHBondContact O-CB 3.35Å; T122-A134 PolarHBondContact O-N 3.31Å; Q124-A134 HydrophobicContact CB-CB 4.42Å; Q124-A134 HydrophobicContact CG-CB 3.86Å; Q132-A134 PolarHBondContact O-N 3.23Å
135	T	39.9	Very low	34.6	Very low	101 Å²	101	105.2 Å²	105.2	62%	0.62	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-106.8	-3	177.4	18	0	0	0	0	113.6	N133 T137	N133-T135 PolarHBondContact O-N 3.48Å; N133-T135 WeakPolarHBondContact OD1-CA 3.38Å; N133-T135 WeakPolarHBondContact OD1-CB 3.27Å; N133-T135 PolarHBondContact OD1-N 3.2Å; N133-T135 PolarHBondContact OD1-OG1 3.09Å; T135-T137 PolarHBondContact O-N 3.1Å
136	A	37	Very low	34.6	Very low	60 Å²	60	106.3 Å²	106.3	50%	0.496	61%	0.612	S	S	.	*			trans	-90	87.3	177.1	0	0	0	0	0	110.4	N133	N133-A136 HydrophobicContact CB-CB 3.82Å; N133-A136 PolarHBondContact O-N 3.22Å; N133-A136 VanDerWaalsContact O-N 3.09Å; N133-A136 PolarHBondContact OD1-N 2.79Å
137	T	30.5	Very low	34.4	Very low	96 Å²	96	109.4 Å²	109.4	59%	0.589	63%	0.632	S	S	*	*			trans	-52.9	128.6	156.2	-46.2	0	0	0	0	107.9	T135 A139	T135-T137 PolarHBondContact O-N 3.1Å; T137-A139 PolarHBondContact O-N 2.81Å; T137-A139 VanDerWaalsContact O-N 3.14Å
138	P	32.2	Very low	34.7	Very low	68 Å²	68	111.8 Å²	111.8	44%	0.442	63%	0.627	S	S	.	*			trans	-51.6	125.2	177.7	-21.6	29.8	0	0	0	109.3	S140 D141	P138-S140 PolarHBondContact O-N 3.01Å; P138-D141 PolarHBondContact O-N 2.84Å
139	A	32.1	Very low	34.9	Very low	70 Å²	70	110.4 Å²	110.4	58%	0.579	62%	0.622	S	S	*	*	G	3₁₀ helix	trans	-61.6	-11.6	175.5	0	0	0	0	0	112.3	T137	T137-A139 PolarHBondContact O-N 2.81Å; T137-A139 VanDerWaalsContact O-N 3.14Å
140	S	34.6	Very low	35.2	Very low	106 Å²	106	113.3 Å²	113.3	74%	0.741	62%	0.617	S	S	*	*	G	3₁₀ helix	trans	-78.7	-11.2	171.1	23.5	0	0	0	0	115.2	P138	P138-S140 PolarHBondContact O-N 3.01Å
141	D	35	Very low	35.4	Very low	124 Å²	124	113.1 Å²	113.1	66%	0.663	62%	0.622	S	S	*	*	G	3₁₀ helix	trans	-94.7	1.6	171.7	-97.9	-56.5	0	0	0	112.9	P138	P138-D141 PolarHBondContact O-N 2.84Å
142	R	35.9	Very low	35.4	Very low	190 Å²	190	114 Å²	114	72%	0.717	63%	0.629	S	S	*	*	S	Bend	trans	-100.1	16.2	179.8	-77.3	-166.2	-78.2	142.4	-6.5	114.2
143	Q	32.1	Very low	35.6	Very low	180 Å²	180	114.8 Å²	114.8	84%	0.841	64%	0.641	S	S	*	*			trans	-121.8	89.9	168.7	-62.6	-151	13.2	0	0	110.2
144	Q	39	Very low	35.4	Very low	270 Å²	270	119.4 Å²	119.4	100%	1.262	67%	0.668	S	S	*	*			trans	-111.5	0	149.5	-78.2	-169	44.3	0	0	107.6

Retrieved 144 of 144 residues in 138.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).