A0A077YZU4_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YZU4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 115 aa.

						>A0A077YZU4_TRITR|A0A077YZU4
MGSSNRELVLQLEKLYVLAKLVSERCALDPASENVQRTAVELLEDRGVAVGVVAFQMIVVIHMVGDVVHMGIVIQTAVVVHAGDAILAAVRVVAVQMVHTQLILKMKISSMEINI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.6	Very low	43.5	Very low	251 Å²	251	109 Å²	109	100%	1.236	59%	0.59	S	S	*	*				0	49.7	0	-67.7	164.7	107.6	0	0	111.5
2	G	47.1	Very low	43.3	Very low	60 Å²	60	105.9 Å²	105.9	62%	0.619	57%	0.573	S	S	*	*			trans	-125.6	-9.8	-177.1	0	0	0	0	0	115.2
3	S	47.9	Very low	43.4	Very low	97 Å²	97	106.5 Å²	106.5	68%	0.678	57%	0.57	S	S	*	*	H	α-helix	trans	-79.9	-33.5	-177.7	54.2	0	0	0	0	113.2	N5 R6 E7	S3-N5 PolarHBondContact O-N 3.06Å; S3-R6 PolarHBondContact O-N 2.9Å; S3-E7 WeakPolarHBondContact O-CB 3.45Å; S3-E7 PolarHBondContact O-N 2.95Å
4	S	49.1	Very low	43.6	Very low	76 Å²	76	108.5 Å²	108.5	53%	0.531	57%	0.57	S	S	.	*	H	α-helix	trans	-62.4	-44.6	-172.8	-165	0	0	0	0	113.2	E7 L8	S4-E7 PolarHBondContact O-N 3.06Å; S4-L8 WeakPolarHBondContact O-CB 3.46Å; S4-L8 PolarHBondContact O-N 2.95Å
5	N	37.8	Very low	43.5	Very low	119 Å²	119	103.7 Å²	103.7	64%	0.636	55%	0.545	S	S	*	.	H	α-helix	trans	-70.8	-38.2	-177.1	-68.4	-3.4	0	0	0	111.6	S3 L8 V9	S3-N5 PolarHBondContact O-N 3.06Å; N5-L8 PolarHBondContact O-N 2.9Å; N5-V9 VanDerWaalsContact O-CG2 3.31Å; N5-V9 WeakPolarHBondContact O-CG2 3.48Å; N5-V9 PolarHBondContact O-N 3.24Å
6	R	42.2	Very low	43.6	Very low	194 Å²	194	107 Å²	107	73%	0.732	55%	0.549	S	S	*	.	H	α-helix	trans	-67.2	-40.1	177.8	-169.1	174.1	-179.4	167.2	0.1	111.2	S3 V9 L10	S3-R6 PolarHBondContact O-N 2.9Å; R6-V9 PolarHBondContact O-N 3.31Å; R6-L10 HydrophobicContact CG-CD1 4.48Å; R6-L10 WeakPolarHBondContact O-CG 3.32Å; R6-L10 PolarHBondContact O-N 3.44Å; R6-L10 VanDerWaalsContact O-N 3.08Å
7	E	45.5	Very low	43.8	Very low	91 Å²	91	106.1 Å²	106.1	43%	0.425	55%	0.55	S	S	.	.	H	α-helix	trans	-64.5	-43.6	174.5	-172.2	57.9	-148.1	0	0	111.4	S3 S4 V9 L10 Q11	S3-E7 WeakPolarHBondContact O-CB 3.45Å; S3-E7 PolarHBondContact O-N 2.95Å; S4-E7 PolarHBondContact O-N 3.06Å; E7-V9 PolarHBondContact O-N 2.81Å; E7-L10 WeakPolarHBondContact O-CB 3.47Å; E7-L10 PolarHBondContact O-N 2.77Å; E7-Q11 WeakPolarHBondContact O-CG 3.42Å; E7-Q11 PolarHBondContact O-N 3.39Å
8	L	39	Very low	43.9	Very low	61 Å²	61	105.4 Å²	105.4	32%	0.319	55%	0.546	S	S	.	.	H	α-helix	trans	-58.5	-45	174.8	-100.3	153.2	0	0	0	113	S4 N5 Q11 L12 M63	S4-L8 WeakPolarHBondContact O-CB 3.46Å; S4-L8 PolarHBondContact O-N 2.95Å; N5-L8 PolarHBondContact O-N 2.9Å; L8-Q11 PolarHBondContact O-N 3.01Å; L8-L12 WeakPolarHBondContact O-CG 3.48Å; L8-L12 PolarHBondContact O-N 3.47Å; L8-M63 HydrophobicContact CD2-CE 3.68Å; L8-M63 HydrophobicContact CD2-SD 4.12Å
9	V	40.6	Very low	44	Very low	79 Å²	79	100.7 Å²	100.7	48%	0.479	53%	0.525	S	S	.	.	H	α-helix	trans	-61.7	-45.1	176.8	171.3	0	0	0	0	110.6	N5 R6 E7 Q11 L12 E13	N5-V9 VanDerWaalsContact O-CG2 3.31Å; N5-V9 WeakPolarHBondContact O-CG2 3.48Å; N5-V9 PolarHBondContact O-N 3.24Å; R6-V9 PolarHBondContact O-N 3.31Å; E7-V9 PolarHBondContact O-N 2.81Å; V9-Q11 VanDerWaalsContact C-N 3.28Å; V9-Q11 PolarHBondContact O-N 3.47Å; V9-L12 PolarHBondContact O-N 3.4Å; V9-E13 WeakPolarHBondContact O-CG 3.33Å; V9-E13 PolarHBondContact O-N 3.43Å
10	L	46.8	Very low	44.2	Very low	68 Å²	68	101.2 Å²	101.2	36%	0.356	52%	0.523	S	S	.	.	H	α-helix	trans	-60.9	-37.1	175.9	-80.7	162.4	0	0	0	112.3	R6 E7 K14	R6-L10 HydrophobicContact CG-CD1 4.48Å; R6-L10 WeakPolarHBondContact O-CG 3.32Å; R6-L10 PolarHBondContact O-N 3.44Å; R6-L10 VanDerWaalsContact O-N 3.08Å; E7-L10 WeakPolarHBondContact O-CB 3.47Å; E7-L10 PolarHBondContact O-N 2.77Å; L10-K14 WeakPolarHBondContact O-CB 3.49Å; L10-K14 VanDerWaalsContact O-CG 3.22Å; L10-K14 WeakPolarHBondContact O-CG 3.39Å; L10-K14 PolarHBondContact O-N 3.45Å
11	Q	42.5	Very low	44.3	Very low	103 Å²	103	99.4 Å²	99.4	48%	0.481	51%	0.513	S	S	.	.	H	α-helix	trans	-69.4	-40.7	176	-72.3	179.6	0.5	0	0	112.1	E7 L8 V9 K14 L15	E7-Q11 WeakPolarHBondContact O-CG 3.42Å; E7-Q11 PolarHBondContact O-N 3.39Å; L8-Q11 PolarHBondContact O-N 3.01Å; V9-Q11 VanDerWaalsContact C-N 3.28Å; V9-Q11 PolarHBondContact O-N 3.47Å; Q11-K14 PolarHBondContact O-N 3.08Å; Q11-L15 VanDerWaalsContact O-CB 3.32Å; Q11-L15 WeakPolarHBondContact O-CB 3.31Å; Q11-L15 PolarHBondContact O-N 2.97Å
12	L	40.9	Very low	44.5	Very low	72 Å²	72	89.5 Å²	89.5	38%	0.377	47%	0.467	S	S	.	.	H	α-helix	trans	-65	-40.7	174.9	-75.9	169.3	0	0	0	112.1	L8 V9 L15 Y16 M63	L8-L12 WeakPolarHBondContact O-CG 3.48Å; L8-L12 PolarHBondContact O-N 3.47Å; V9-L12 PolarHBondContact O-N 3.4Å; L12-L15 PolarHBondContact O-N 3.35Å; L12-Y16 WeakPolarHBondContact O-CB 3.24Å; L12-Y16 PolarHBondContact O-N 2.79Å; L12-M63 HydrophobicContact CD2-SD 4.22Å
13	E	44.8	Very low	44.4	Very low	114 Å²	114	89.5 Å²	89.5	53%	0.533	46%	0.458	S	S	.	.	H	α-helix	trans	-62.5	-47.3	174.1	-76.1	-179.9	162.6	0	0	111.3	V9 L15 Y16 V17	V9-E13 WeakPolarHBondContact O-CG 3.33Å; V9-E13 PolarHBondContact O-N 3.43Å; E13-L15 VanDerWaalsContact C-N 3.26Å; E13-L15 PolarHBondContact O-N 3.05Å; E13-Y16 PolarHBondContact O-N 2.76Å; E13-V17 WeakPolarHBondContact O-CG2 3.44Å; E13-V17 PolarHBondContact O-N 2.76Å
14	K	45.4	Very low	44.3	Very low	134 Å²	134	90.4 Å²	90.4	58%	0.583	45%	0.451	S	S	*	.	H	α-helix	trans	-57.4	-41.2	174.3	-75	169.7	-175.8	173.2	0	111.4	L10 Q11 L18	L10-K14 WeakPolarHBondContact O-CB 3.49Å; L10-K14 VanDerWaalsContact O-CG 3.22Å; L10-K14 WeakPolarHBondContact O-CG 3.39Å; L10-K14 PolarHBondContact O-N 3.45Å; Q11-K14 PolarHBondContact O-N 3.08Å; K14-L18 WeakPolarHBondContact O-CB 3.48Å; K14-L18 PolarHBondContact O-N 2.88Å
15	L	42.1	Very low	43.6	Very low	36 Å²	36	96.1 Å²	96.1	19%	0.188	46%	0.461	C	S	.	.	H	α-helix	trans	-68.3	-42.2	178.6	-173.3	73.2	0	0	0	112.3	Q11 L12 E13 V17 L18 A19 I61 V68 M70	Q11-L15 VanDerWaalsContact O-CB 3.32Å; Q11-L15 WeakPolarHBondContact O-CB 3.31Å; Q11-L15 PolarHBondContact O-N 2.97Å; L12-L15 PolarHBondContact O-N 3.35Å; E13-L15 VanDerWaalsContact C-N 3.26Å; E13-L15 PolarHBondContact O-N 3.05Å; L15-V17 VanDerWaalsContact C-N 3.35Å; L15-L18 CarbonylContact O-C 3.48Å; L15-L18 WeakPolarHBondContact O-CB 3.32Å; L15-L18 PolarHBondContact O-N 3.21Å; L15-A19 WeakPolarHBondContact O-CB 3.46Å; L15-A19 PolarHBondContact O-N 3.36Å; L15-I61 HydrophobicContact CD2-CD1 4.06Å; L15-I61 HydrophobicContact CD2-CG2 3.75Å; L15-V68 HydrophobicContact CD1-CG1 4.45Å; L15-V68 HydrophobicContact CD2-CG1 3.51Å; L15-M70 HydrophobicContact CD1-CE 3.58Å; L15-M70 HydrophobicContact CD2-CE 3.95Å; L15-M70 HydrophobicContact CG-CE 3.57Å
16	Y	44.9	Very low	43.6	Very low	157 Å²	157	94 Å²	94	62%	0.616	45%	0.454	S	S	*	.	H	α-helix	trans	-62.1	-44.3	175.2	176.8	-97.7	0	0	0	110.9	L12 E13 L18 A19 K20	L12-Y16 WeakPolarHBondContact O-CB 3.24Å; L12-Y16 PolarHBondContact O-N 2.79Å; E13-Y16 PolarHBondContact O-N 2.76Å; Y16-L18 VanDerWaalsContact C-N 3.29Å; Y16-L18 PolarHBondContact O-N 2.89Å; Y16-A19 PolarHBondContact O-N 3.22Å; Y16-K20 WeakPolarHBondContact O-CB 3.47Å; Y16-K20 PolarHBondContact O-N 3.02Å
17	V	48.1	Very low	43.4	Very low	91 Å²	91	86.6 Å²	86.6	55%	0.552	44%	0.435	S	S	*	.	H	α-helix	trans	-60.6	-41.4	173.2	172.9	0	0	0	0	110.5	E13 L15 K20 L21	E13-V17 WeakPolarHBondContact O-CG2 3.44Å; E13-V17 PolarHBondContact O-N 2.76Å; L15-V17 VanDerWaalsContact C-N 3.35Å; V17-K20 PolarHBondContact O-N 2.8Å; V17-L21 WeakPolarHBondContact O-CB 3.45Å; V17-L21 PolarHBondContact O-N 2.76Å
18	L	45.3	Very low	43.2	Very low	94 Å²	94	84.1 Å²	84.1	49%	0.492	43%	0.425	S	S	.	.	H	α-helix	trans	-65.6	-41.9	176.7	-154.7	93.7	0	0	0	111.9	K14 L15 Y16 L21 V22	K14-L18 WeakPolarHBondContact O-CB 3.48Å; K14-L18 PolarHBondContact O-N 2.88Å; L15-L18 CarbonylContact O-C 3.48Å; L15-L18 WeakPolarHBondContact O-CB 3.32Å; L15-L18 PolarHBondContact O-N 3.21Å; Y16-L18 VanDerWaalsContact C-N 3.29Å; Y16-L18 PolarHBondContact O-N 2.89Å; L18-L21 CarbonylContact O-C 3.53Å; L18-L21 PolarHBondContact O-N 3.41Å; L18-V22 WeakPolarHBondContact O-CB 3.44Å; L18-V22 VanDerWaalsContact O-CG2 3.23Å; L18-V22 WeakPolarHBondContact O-CG2 3.32Å; L18-V22 PolarHBondContact O-N 3.17Å
19	A	45.9	Very low	43.1	Very low	17 Å²	17	87.2 Å²	87.2	14%	0.14	44%	0.441	C	S	.	.	H	α-helix	trans	-65.5	-42.2	177.4	0	0	0	0	0	111.4	L15 Y16 V22 S23 M70	L15-A19 WeakPolarHBondContact O-CB 3.46Å; L15-A19 PolarHBondContact O-N 3.36Å; Y16-A19 PolarHBondContact O-N 3.22Å; A19-V22 PolarHBondContact O-N 2.88Å; A19-S23 WeakPolarHBondContact O-CB 3.02Å; A19-S23 PolarHBondContact O-N 2.89Å; A19-M70 HydrophobicContact CB-CE 3.86Å; A19-M70 HydrophobicContact CB-SD 4.29Å
20	K	46.9	Very low	42.8	Very low	110 Å²	110	86.8 Å²	86.8	48%	0.478	44%	0.44	S	S	.	.	H	α-helix	trans	-62.6	-45.9	172.6	-166.6	-173.6	-173.7	-155.2	0	110.6	Y16 V17 V22 S23 E24	Y16-K20 WeakPolarHBondContact O-CB 3.47Å; Y16-K20 PolarHBondContact O-N 3.02Å; V17-K20 PolarHBondContact O-N 2.8Å; K20-V22 VanDerWaalsContact C-N 3.31Å; K20-V22 PolarHBondContact O-N 3.44Å; K20-S23 CarbonylContact O-C 3.49Å; K20-S23 WeakPolarHBondContact O-CB 3.23Å; K20-S23 PolarHBondContact O-N 2.78Å; K20-E24 WeakPolarHBondContact CE-OE1 3.05Å; K20-E24 HydrophobicContact CG-CG 4.46Å; K20-E24 WeakPolarHBondContact CG-OE1 3.38Å; K20-E24 IonicContact NZ-OE1 2.77Å; K20-E24 WeakPolarHBondContact O-CB 3.32Å; K20-E24 VanDerWaalsContact O-CG 3.25Å; K20-E24 WeakPolarHBondContact O-CG 3.35Å; K20-E24 PolarHBondContact O-N 2.78Å
21	L	47.4	Very low	42.4	Very low	63 Å²	63	85.6 Å²	85.6	33%	0.33	44%	0.441	S	S	.	.	H	α-helix	trans	-63	-36.4	175.9	-168.2	78.1	0	0	0	111.6	V17 L18 E24 R25	V17-L21 WeakPolarHBondContact O-CB 3.45Å; V17-L21 PolarHBondContact O-N 2.76Å; L18-L21 CarbonylContact O-C 3.53Å; L18-L21 PolarHBondContact O-N 3.41Å; L21-E24 PolarHBondContact O-N 3.27Å; L21-R25 HydrophobicContact CD1-CG 3.93Å; L21-R25 HydrophobicContact CG-CG 3.89Å; L21-R25 WeakPolarHBondContact O-CA 3.45Å; L21-R25 WeakPolarHBondContact O-CB 3.4Å; L21-R25 WeakPolarHBondContact O-CG 3.22Å; L21-R25 PolarHBondContact O-N 2.79Å
22	V	43.9	Very low	42.3	Very low	43 Å²	43	82 Å²	82	26%	0.261	43%	0.427	S	S	.	.	H	α-helix	trans	-67.7	-45.3	173.4	162.5	0	0	0	0	109.4	L18 A19 K20 E24 C26	L18-V22 WeakPolarHBondContact O-CB 3.44Å; L18-V22 VanDerWaalsContact O-CG2 3.23Å; L18-V22 WeakPolarHBondContact O-CG2 3.32Å; L18-V22 PolarHBondContact O-N 3.17Å; A19-V22 PolarHBondContact O-N 2.88Å; K20-V22 VanDerWaalsContact C-N 3.31Å; K20-V22 PolarHBondContact O-N 3.44Å; V22-E24 VanDerWaalsContact C-N 3.28Å; V22-E24 PolarHBondContact O-N 3.28Å; V22-C26 HydrophobicContact CG1-CB 4.43Å; V22-C26 WeakPolarHBondContact O-CA 3.47Å; V22-C26 WeakPolarHBondContact O-CB 3.35Å; V22-C26 PolarHBondContact O-N 3.34Å
23	S	45.5	Very low	42.3	Very low	60 Å²	60	82.8 Å²	82.8	42%	0.42	43%	0.429	S	S	.	.	H	α-helix	trans	-58	-41.9	173.9	-170.5	0	0	0	0	112.1	A19 K20	A19-S23 WeakPolarHBondContact O-CB 3.02Å; A19-S23 PolarHBondContact O-N 2.89Å; K20-S23 CarbonylContact O-C 3.49Å; K20-S23 WeakPolarHBondContact O-CB 3.23Å; K20-S23 PolarHBondContact O-N 2.78Å
24	E	45.5	Very low	42.1	Very low	116 Å²	116	81.8 Å²	81.8	54%	0.542	43%	0.427	S	S	.	.	H	α-helix	trans	-76.4	-46.2	-179.7	-70.9	171.2	178.3	0	0	112.4	K20 L21 V22	K20-E24 WeakPolarHBondContact CE-OE1 3.05Å; K20-E24 HydrophobicContact CG-CG 4.46Å; K20-E24 WeakPolarHBondContact CG-OE1 3.38Å; K20-E24 IonicContact NZ-OE1 2.77Å; K20-E24 WeakPolarHBondContact O-CB 3.32Å; K20-E24 VanDerWaalsContact O-CG 3.25Å; K20-E24 WeakPolarHBondContact O-CG 3.35Å; K20-E24 PolarHBondContact O-N 2.78Å; L21-E24 PolarHBondContact O-N 3.27Å; V22-E24 VanDerWaalsContact C-N 3.28Å; V22-E24 PolarHBondContact O-N 3.28Å
25	R	35.4	Very low	41.9	Very low	196 Å²	196	77.3 Å²	77.3	74%	0.74	41%	0.411	S	S	*	.	H	α-helix	trans	-90.6	-30.4	-173.8	-70.5	-163.2	174.9	-156.1	1.4	115.1	L21 A27	L21-R25 HydrophobicContact CD1-CG 3.93Å; L21-R25 HydrophobicContact CG-CG 3.89Å; L21-R25 WeakPolarHBondContact O-CA 3.45Å; L21-R25 WeakPolarHBondContact O-CB 3.4Å; L21-R25 WeakPolarHBondContact O-CG 3.22Å; L21-R25 PolarHBondContact O-N 2.79Å; R25-A27 PolarHBondContact O-N 2.75Å
26	C	37.8	Very low	42	Very low	74 Å²	74	78.5 Å²	78.5	50%	0.5	42%	0.415	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64	-2.9	169.8	-75.3	0	0	0	0	111.2	V22 L28	V22-C26 HydrophobicContact CG1-CB 4.43Å; V22-C26 WeakPolarHBondContact O-CA 3.47Å; V22-C26 WeakPolarHBondContact O-CB 3.35Å; V22-C26 PolarHBondContact O-N 3.34Å; C26-L28 HydrophobicContact CB-CD1 4.39Å; C26-L28 HydrophobicContact CB-CD2 4.43Å; C26-L28 HydrophobicContact CB-CG 3.87Å; C26-L28 PolarHBondContact O-N 2.83Å
27	A	38.2	Very low	42.1	Very low	40 Å²	40	76.7 Å²	76.7	33%	0.331	41%	0.407	S	S	.	.	T	Hydrogen-bonded Turn	trans	44.9	48.2	178.7	0	0	0	0	0	106.4	R25 D29 P30 A31	R25-A27 PolarHBondContact O-N 2.75Å; A27-D29 PolarHBondContact O-N 2.92Å; A27-P30 VanDerWaalsContact C-CD 3.45Å; A27-P30 HydrophobicContact CB-CG 3.41Å; A27-P30 VanDerWaalsContact CB-CG 3.41Å; A27-P30 WeakPolarHBondContact O-CD 3.38Å; A27-P30 WeakPolarHBondContact O-CG 3.34Å; A27-A31 PolarHBondContact O-N 3.35Å; A27-A31 VanDerWaalsContact O-N 3.08Å
28	L	39.9	Very low	42	Very low	39 Å²	39	75 Å²	75	20%	0.204	40%	0.397	C	S	.	.	H	α-helix	trans	-63.8	-10.2	176.6	-75	170.3	0	0	0	109	C26 A31 S32 M57	C26-L28 HydrophobicContact CB-CD1 4.39Å; C26-L28 HydrophobicContact CB-CD2 4.43Å; C26-L28 HydrophobicContact CB-CG 3.87Å; C26-L28 PolarHBondContact O-N 2.83Å; L28-A31 HydrophobicContact CD2-CB 3.96Å; L28-S32 WeakPolarHBondContact O-CA 3.45Å; L28-S32 WeakPolarHBondContact O-CB 3.35Å; L28-S32 PolarHBondContact O-N 3.48Å; L28-S32 PolarHBondContact O-OG 3.26Å; L28-M57 HydrophobicContact CB-CE 4.26Å; L28-M57 HydrophobicContact CD1-CE 3.65Å; L28-M57 HydrophobicContact CD1-SD 4.43Å
29	D	37.6	Very low	41.9	Very low	125 Å²	125	71.7 Å²	71.7	67%	0.668	38%	0.383	S	S	*	.	H	α-helix	trans	-55.2	-66.6	160.4	-136.5	-3.8	0	0	0	111.1	A27 A31 S32 E33	A27-D29 PolarHBondContact O-N 2.92Å; D29-A31 VanDerWaalsContact C-N 3.34Å; D29-A31 PolarHBondContact O-N 2.67Å; D29-S32 CarbonylContact O-C 3.59Å; D29-S32 PolarHBondContact O-N 3.17Å; D29-S32 VanDerWaalsContact O-N 3.08Å; D29-S32 PolarHBondContact O-OG 2.76Å; D29-E33 VanDerWaalsContact O-CB 3.31Å; D29-E33 WeakPolarHBondContact O-CB 3.25Å; D29-E33 PolarHBondContact O-N 2.81Å
30	P	34.9	Very low	41.9	Very low	70 Å²	70	72.4 Å²	72.4	46%	0.455	39%	0.386	S	S	.	.	H	α-helix	trans	-63.4	-30	174.4	17.4	-30	0	0	0	114.7	A27 N34	A27-P30 VanDerWaalsContact C-CD 3.45Å; A27-P30 HydrophobicContact CB-CG 3.41Å; A27-P30 VanDerWaalsContact CB-CG 3.41Å; A27-P30 WeakPolarHBondContact O-CD 3.38Å; A27-P30 WeakPolarHBondContact O-CG 3.34Å; P30-N34 WeakPolarHBondContact O-CA 3.15Å; P30-N34 WeakPolarHBondContact O-CB 3.15Å; P30-N34 PolarHBondContact O-N 3.32Å
31	A	38.2	Very low	42	Very low	44 Å²	44	71.7 Å²	71.7	36%	0.364	38%	0.384	S	S	.	.	H	α-helix	trans	-68	-38.2	173.2	0	0	0	0	0	111.5	A27 L28 D29 V35	A27-A31 PolarHBondContact O-N 3.35Å; A27-A31 VanDerWaalsContact O-N 3.08Å; L28-A31 HydrophobicContact CD2-CB 3.96Å; D29-A31 VanDerWaalsContact C-N 3.34Å; D29-A31 PolarHBondContact O-N 2.67Å; A31-V35 WeakPolarHBondContact O-CB 3.27Å; A31-V35 WeakPolarHBondContact O-CG2 3.43Å; A31-V35 PolarHBondContact O-N 2.72Å
32	S	39.4	Very low	42	Very low	28 Å²	28	73.4 Å²	73.4	20%	0.196	39%	0.394	C	S	.	.	H	α-helix	trans	-70.4	-41.8	174.5	77	0	0	0	0	110.8	L28 D29 N34 V35 Q36	L28-S32 WeakPolarHBondContact O-CA 3.45Å; L28-S32 WeakPolarHBondContact O-CB 3.35Å; L28-S32 PolarHBondContact O-N 3.48Å; L28-S32 PolarHBondContact O-OG 3.26Å; D29-S32 CarbonylContact O-C 3.59Å; D29-S32 PolarHBondContact O-N 3.17Å; D29-S32 VanDerWaalsContact O-N 3.08Å; D29-S32 PolarHBondContact O-OG 2.76Å; S32-N34 VanDerWaalsContact C-N 3.34Å; S32-V35 CarbonylContact O-C 3.59Å; S32-V35 PolarHBondContact O-N 2.8Å; S32-Q36 WeakPolarHBondContact O-CB 3.35Å; S32-Q36 VanDerWaalsContact O-CG 3.23Å; S32-Q36 WeakPolarHBondContact O-CG 3.26Å; S32-Q36 PolarHBondContact O-N 3.48Å
33	E	40.6	Very low	42	Very low	88 Å²	88	72.9 Å²	72.9	41%	0.411	39%	0.389	S	S	.	.	H	α-helix	trans	-65.7	-38.8	176.6	-160.6	-162.9	152.2	0	0	110.1	D29 Q36 R37	D29-E33 VanDerWaalsContact O-CB 3.31Å; D29-E33 WeakPolarHBondContact O-CB 3.25Å; D29-E33 PolarHBondContact O-N 2.81Å; E33-Q36 WeakPolarHBondContact O-CB 3.35Å; E33-Q36 PolarHBondContact O-N 3.41Å; E33-R37 WeakPolarHBondContact O-CB 3.19Å; E33-R37 PolarHBondContact O-N 3.32Å; E33-R37 IonicContact OE1-CZ 3.51Å; E33-R37 IonicContact OE1-NH2 3.9Å; E33-R37 PolarHBondContact OE1-NH2 2.81Å
34	N	41.6	Very low	42.4	Very low	92 Å²	92	75.6 Å²	75.6	49%	0.492	40%	0.395	S	S	.	.	H	α-helix	trans	-72	-37.2	175.3	-153	35.5	0	0	0	110.5	P30 S32 R37 T38	P30-N34 WeakPolarHBondContact O-CA 3.15Å; P30-N34 WeakPolarHBondContact O-CB 3.15Å; P30-N34 PolarHBondContact O-N 3.32Å; S32-N34 VanDerWaalsContact C-N 3.34Å; N34-R37 PolarHBondContact O-N 2.78Å; N34-T38 VanDerWaalsContact O-CB 3.26Å; N34-T38 WeakPolarHBondContact O-CB 3.34Å; N34-T38 PolarHBondContact O-N 2.75Å; N34-T38 PolarHBondContact O-OG1 2.77Å
35	V	41.5	Very low	42.8	Very low	40 Å²	40	77.2 Å²	77.2	24%	0.242	41%	0.407	C	S	.	.	H	α-helix	trans	-65.5	-39.3	171.4	167.6	0	0	0	0	111.6	A31 S32 A39	A31-V35 WeakPolarHBondContact O-CB 3.27Å; A31-V35 WeakPolarHBondContact O-CG2 3.43Å; A31-V35 PolarHBondContact O-N 2.72Å; S32-V35 CarbonylContact O-C 3.59Å; S32-V35 PolarHBondContact O-N 2.8Å; V35-A39 WeakPolarHBondContact O-CB 3.33Å; V35-A39 PolarHBondContact O-N 2.85Å
36	Q	42.7	Very low	43.4	Very low	62 Å²	62	77.6 Å²	77.6	29%	0.29	41%	0.409	S	S	.	.	H	α-helix	trans	-59.4	-56.1	172.4	-78.6	175.2	17.6	0	0	109.5	S32 E33 A39 V40 V53 F55	S32-Q36 WeakPolarHBondContact O-CB 3.35Å; S32-Q36 VanDerWaalsContact O-CG 3.23Å; S32-Q36 WeakPolarHBondContact O-CG 3.26Å; S32-Q36 PolarHBondContact O-N 3.48Å; E33-Q36 WeakPolarHBondContact O-CB 3.35Å; E33-Q36 PolarHBondContact O-N 3.41Å; Q36-A39 CarbonylContact O-C 3.54Å; Q36-A39 WeakPolarHBondContact O-CB 2.87Å; Q36-A39 PolarHBondContact O-N 2.93Å; Q36-A39 VanDerWaalsContact O-N 3.11Å; Q36-V40 WeakPolarHBondContact O-CB 3.42Å; Q36-V40 VanDerWaalsContact O-CG2 3.23Å; Q36-V40 WeakPolarHBondContact O-CG2 3.19Å; Q36-V40 PolarHBondContact O-N 3.23Å; Q36-V53 HydrophobicContact CG-CB 4.49Å; Q36-V53 HydrophobicContact CG-CG1 4.28Å; Q36-F55 HydrophobicContact CB-CZ 4.23Å; Q36-F55 HydrophobicContact CG-CD2 4.24Å; Q36-F55 HydrophobicContact CG-CE1 4.06Å; Q36-F55 HydrophobicContact CG-CE2 3.1Å; Q36-F55 HydrophobicContact CG-CZ 2.99Å
37	R	47.1	Very low	43.9	Very low	118 Å²	118	77.6 Å²	77.6	45%	0.445	42%	0.421	S	S	.	.	H	α-helix	trans	-61.1	-48.5	-176.3	-167.9	-174.5	-59	164.4	2.3	110.7	E33 N34 A39 V40 E41	E33-R37 WeakPolarHBondContact O-CB 3.19Å; E33-R37 PolarHBondContact O-N 3.32Å; E33-R37 IonicContact OE1-CZ 3.51Å; E33-R37 IonicContact OE1-NH2 3.9Å; E33-R37 PolarHBondContact OE1-NH2 2.81Å; N34-R37 PolarHBondContact O-N 2.78Å; R37-A39 VanDerWaalsContact C-N 3.3Å; R37-A39 PolarHBondContact O-N 2.89Å; R37-V40 CarbonylContact O-C 3.58Å; R37-V40 PolarHBondContact O-N 2.76Å; R37-V40 VanDerWaalsContact O-N 3.16Å; R37-E41 WeakPolarHBondContact CD-OE1 3.47Å; R37-E41 HydrophobicContact CG-CG 4.18Å; R37-E41 WeakPolarHBondContact CG-OE1 3.06Å; R37-E41 VanDerWaalsContact O-CB 3.29Å; R37-E41 WeakPolarHBondContact O-CB 3.34Å; R37-E41 VanDerWaalsContact O-CG 3.24Å; R37-E41 WeakPolarHBondContact O-CG 3.17Å; R37-E41 PolarHBondContact O-N 3.08Å
38	T	46.3	Very low	44.2	Very low	56 Å²	56	77.1 Å²	77.1	34%	0.344	41%	0.414	S	S	.	.	H	α-helix	trans	-61.6	-38.3	174.7	-56.3	0	0	0	0	111.7	N34 L42	N34-T38 VanDerWaalsContact O-CB 3.26Å; N34-T38 WeakPolarHBondContact O-CB 3.34Å; N34-T38 PolarHBondContact O-N 2.75Å; N34-T38 PolarHBondContact O-OG1 2.77Å; T38-L42 HydrophobicContact CG2-CD1 3.9Å; T38-L42 HydrophobicContact CG2-CG 4.38Å; T38-L42 VanDerWaalsContact O-CB 3.23Å; T38-L42 WeakPolarHBondContact O-CB 3.45Å; T38-L42 WeakPolarHBondContact O-CD1 3.38Å; T38-L42 WeakPolarHBondContact O-CG 3.23Å; T38-L42 PolarHBondContact O-N 3.08Å
39	A	42.4	Very low	44.6	Very low	24 Å²	24	78.4 Å²	78.4	20%	0.198	43%	0.431	C	S	.	.	H	α-helix	trans	-66.2	-41.6	175.3	0	0	0	0	0	111.8	V35 Q36 R37 L43 V78	V35-A39 WeakPolarHBondContact O-CB 3.33Å; V35-A39 PolarHBondContact O-N 2.85Å; Q36-A39 CarbonylContact O-C 3.54Å; Q36-A39 WeakPolarHBondContact O-CB 2.87Å; Q36-A39 PolarHBondContact O-N 2.93Å; Q36-A39 VanDerWaalsContact O-N 3.11Å; R37-A39 VanDerWaalsContact C-N 3.3Å; R37-A39 PolarHBondContact O-N 2.89Å; A39-L43 VanDerWaalsContact O-CD1 3.27Å; A39-L43 WeakPolarHBondContact O-CD1 3.37Å; A39-L43 WeakPolarHBondContact O-CG 3.44Å; A39-L43 PolarHBondContact O-N 3.03Å; A39-V78 HydrophobicContact CB-CG2 4.12Å
40	V	46.5	Very low	45.1	Very low	33 Å²	33	74.2 Å²	74.2	20%	0.2	41%	0.41	C	S	.	.	H	α-helix	trans	-66	-52	177	172.8	0	0	0	0	110.5	Q36 R37 L42 L43 E44 V50 V53	Q36-V40 WeakPolarHBondContact O-CB 3.42Å; Q36-V40 VanDerWaalsContact O-CG2 3.23Å; Q36-V40 WeakPolarHBondContact O-CG2 3.19Å; Q36-V40 PolarHBondContact O-N 3.23Å; R37-V40 CarbonylContact O-C 3.58Å; R37-V40 PolarHBondContact O-N 2.76Å; R37-V40 VanDerWaalsContact O-N 3.16Å; V40-L42 VanDerWaalsContact C-N 3.34Å; V40-L42 PolarHBondContact O-N 3Å; V40-L43 CarbonylContact O-C 3.52Å; V40-L43 WeakPolarHBondContact O-CA 3.05Å; V40-L43 WeakPolarHBondContact O-CB 2.91Å; V40-L43 PolarHBondContact O-N 2.98Å; V40-E44 HydrophobicContact CG1-CG 4.01Å; V40-E44 WeakPolarHBondContact O-CB 3.48Å; V40-E44 WeakPolarHBondContact O-CG 2.95Å; V40-E44 PolarHBondContact O-N 2.88Å; V40-V50 HydrophobicContact CB-CG2 4.48Å; V40-V50 HydrophobicContact CG1-CB 4.44Å; V40-V50 HydrophobicContact CG1-CG2 4.22Å; V40-V50 HydrophobicContact CG2-CB 4.34Å; V40-V50 HydrophobicContact CG2-CG1 4.02Å; V40-V50 HydrophobicContact CG2-CG2 4.41Å; V40-V53 HydrophobicContact CG2-CG2 4.18Å
41	E	49.9	Very low	45.7	Very low	94 Å²	94	73.2 Å²	73.2	44%	0.439	41%	0.411	S	S	.	.	H	α-helix	trans	-55.4	-45.9	177	-74.1	169.8	172.9	0	0	111.3	R37 L43 E44 D45	R37-E41 WeakPolarHBondContact CD-OE1 3.47Å; R37-E41 HydrophobicContact CG-CG 4.18Å; R37-E41 WeakPolarHBondContact CG-OE1 3.06Å; R37-E41 VanDerWaalsContact O-CB 3.29Å; R37-E41 WeakPolarHBondContact O-CB 3.34Å; R37-E41 VanDerWaalsContact O-CG 3.24Å; R37-E41 WeakPolarHBondContact O-CG 3.17Å; R37-E41 PolarHBondContact O-N 3.08Å; E41-L43 PolarHBondContact O-N 2.98Å; E41-E44 PolarHBondContact O-N 2.69Å; E41-D45 VanDerWaalsContact O-CB 3.3Å; E41-D45 WeakPolarHBondContact O-CB 3.3Å; E41-D45 PolarHBondContact O-N 3.29Å
42	L	46.6	Very low	46.1	Very low	100 Å²	100	75.5 Å²	75.5	52%	0.524	42%	0.421	S	S	.	.	H	α-helix	trans	-63	-27.6	177	-79.5	169.1	0	0	0	113.5	T38 V40 R46	T38-L42 HydrophobicContact CG2-CD1 3.9Å; T38-L42 HydrophobicContact CG2-CG 4.38Å; T38-L42 VanDerWaalsContact O-CB 3.23Å; T38-L42 WeakPolarHBondContact O-CB 3.45Å; T38-L42 WeakPolarHBondContact O-CD1 3.38Å; T38-L42 WeakPolarHBondContact O-CG 3.23Å; T38-L42 PolarHBondContact O-N 3.08Å; V40-L42 VanDerWaalsContact C-N 3.34Å; V40-L42 PolarHBondContact O-N 3Å; L42-R46 WeakPolarHBondContact O-CG 3.24Å
43	L	45	Very low	46.4	Very low	31 Å²	31	76 Å²	76	16%	0.162	42%	0.422	C	S	.	.	H	α-helix	trans	-86.2	-40.4	178.2	-70.1	166.7	0	0	0	111.3	A39 V40 E41 R46 G47 V48 V50 V78 V80	A39-L43 VanDerWaalsContact O-CD1 3.27Å; A39-L43 WeakPolarHBondContact O-CD1 3.37Å; A39-L43 WeakPolarHBondContact O-CG 3.44Å; A39-L43 PolarHBondContact O-N 3.03Å; V40-L43 CarbonylContact O-C 3.52Å; V40-L43 WeakPolarHBondContact O-CA 3.05Å; V40-L43 WeakPolarHBondContact O-CB 2.91Å; V40-L43 PolarHBondContact O-N 2.98Å; E41-L43 PolarHBondContact O-N 2.98Å; L43-R46 CarbonylContact O-C 3.56Å; L43-R46 WeakPolarHBondContact O-CA 3.23Å; L43-R46 WeakPolarHBondContact O-CB 3.29Å; L43-R46 PolarHBondContact O-N 2.87Å; L43-R46 VanDerWaalsContact O-N 3.11Å; L43-G47 PolarHBondContact O-N 2.81Å; L43-V48 WeakPolarHBondContact O-CB 3.13Å; L43-V48 WeakPolarHBondContact O-CG2 3.07Å; L43-V48 PolarHBondContact O-N 3.11Å; L43-V50 HydrophobicContact CB-CG2 3.64Å; L43-V50 HydrophobicContact CD1-CG2 3.73Å; L43-V50 HydrophobicContact CG-CG2 4.36Å; L43-V78 HydrophobicContact CD1-CG1 3.6Å; L43-V80 HydrophobicContact CD1-CG2 3.49Å; L43-V80 VanDerWaalsContact CD1-CG2 3.49Å; L43-V80 HydrophobicContact CD2-CG1 4.37Å; L43-V80 HydrophobicContact CD2-CG2 4.05Å; L43-V80 HydrophobicContact CG-CG2 4.38Å
44	E	53.3	Low	46.7	Very low	117 Å²	117	74.4 Å²	74.4	55%	0.547	43%	0.425	S	S	.	.	H	α-helix	trans	-65	-41.2	175.2	-72.5	-177.8	163.5	0	0	111.7	V40 E41 R46 G47	V40-E44 HydrophobicContact CG1-CG 4.01Å; V40-E44 WeakPolarHBondContact O-CB 3.48Å; V40-E44 WeakPolarHBondContact O-CG 2.95Å; V40-E44 PolarHBondContact O-N 2.88Å; E41-E44 PolarHBondContact O-N 2.69Å; E44-R46 PolarHBondContact O-N 2.81Å; E44-R46 VanDerWaalsContact O-N 3.14Å; E44-G47 WeakPolarHBondContact O-CA 3.48Å; E44-G47 PolarHBondContact O-N 3.14Å
45	D	53.8	Low	47.2	Very low	150 Å²	150	73.2 Å²	73.2	80%	0.802	42%	0.415	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.3	-23.4	173	-91.2	3.1	0	0	0	112.3	E41 G47	E41-D45 VanDerWaalsContact O-CB 3.3Å; E41-D45 WeakPolarHBondContact O-CB 3.3Å; E41-D45 PolarHBondContact O-N 3.29Å; D45-G47 VanDerWaalsContact C-N 3.34Å
46	R	48.2	Very low	47.5	Very low	204 Å²	204	76.7 Å²	76.7	77%	0.77	43%	0.429	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.3	5.7	173.9	-67.4	-177.6	-179.7	-151.6	0.3	113.2	L42 L43 E44 V48	L42-R46 WeakPolarHBondContact O-CG 3.24Å; L43-R46 CarbonylContact O-C 3.56Å; L43-R46 WeakPolarHBondContact O-CA 3.23Å; L43-R46 WeakPolarHBondContact O-CB 3.29Å; L43-R46 PolarHBondContact O-N 2.87Å; L43-R46 VanDerWaalsContact O-N 3.11Å; E44-R46 PolarHBondContact O-N 2.81Å; E44-R46 VanDerWaalsContact O-N 3.14Å; R46-V48 HydrophobicContact CB-CG2 3.93Å
47	G	47.9	Very low	48	Very low	74 Å²	74	77.4 Å²	77.4	76%	0.763	43%	0.433	S	S	*	.	T	Hydrogen-bonded Turn	trans	75.3	23.2	179.5	0	0	0	0	0	113.9	L43 E44 D45	L43-G47 PolarHBondContact O-N 2.81Å; E44-G47 WeakPolarHBondContact O-CA 3.48Å; E44-G47 PolarHBondContact O-N 3.14Å; D45-G47 VanDerWaalsContact C-N 3.34Å
48	V	44	Very low	48.4	Very low	31 Å²	31	75.1 Å²	75.1	19%	0.188	43%	0.429	C	S	.	.			trans	-107.8	124.3	-174.4	-148	0	0	0	0	111.4	L43 R46 V50 V80 A82	L43-V48 WeakPolarHBondContact O-CB 3.13Å; L43-V48 WeakPolarHBondContact O-CG2 3.07Å; L43-V48 PolarHBondContact O-N 3.11Å; R46-V48 HydrophobicContact CB-CG2 3.93Å; V48-V50 PolarHBondContact O-N 3.26Å; V48-V80 HydrophobicContact CB-CG1 3.76Å; V48-V80 HydrophobicContact CG1-CG1 3.05Å; V48-A82 HydrophobicContact CG1-CB 3.72Å
49	A	48.3	Very low	48.7	Very low	66 Å²	66	75.7 Å²	75.7	55%	0.545	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.6	122.8	-179.3	0	0	0	0	0	110.7	H81	A49-H81 PolarHBondContact O-N 3.38Å
50	V	48.6	Very low	49.2	Very low	37 Å²	37	78.2 Å²	78.2	22%	0.224	45%	0.445	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.7	119.4	178.8	-171.7	0	0	0	0	109.6	V40 L43 V48 V53 V78	V40-V50 HydrophobicContact CB-CG2 4.48Å; V40-V50 HydrophobicContact CG1-CB 4.44Å; V40-V50 HydrophobicContact CG1-CG2 4.22Å; V40-V50 HydrophobicContact CG2-CB 4.34Å; V40-V50 HydrophobicContact CG2-CG1 4.02Å; V40-V50 HydrophobicContact CG2-CG2 4.41Å; L43-V50 HydrophobicContact CB-CG2 3.64Å; L43-V50 HydrophobicContact CD1-CG2 3.73Å; L43-V50 HydrophobicContact CG-CG2 4.36Å; V48-V50 PolarHBondContact O-N 3.26Å; V50-V53 HydrophobicContact CG1-CG2 4.1Å; V50-V78 HydrophobicContact CG1-CG1 3.65Å
51	G	47.5	Very low	49.3	Very low	48 Å²	48	80 Å²	80	50%	0.495	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.2	-50.9	-175.3	0	0	0	0	0	112.9	V79	G51-V79 PolarHBondContact N-O 2.75Å
52	V	45.7	Very low	49.2	Very low	93 Å²	93	81 Å²	81	56%	0.564	46%	0.457	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-151.8	137.8	-174.9	-178.4	0	0	0	0	110.1	V79	V52-V79 PolarHBondContact O-N 2.74Å
53	V	46.6	Very low	49	Very low	37 Å²	37	80.1 Å²	80.1	22%	0.224	45%	0.452	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	120.8	167.4	-159.8	0	0	0	0	109.8	Q36 V40 V50 F55 T76 A77 V78	Q36-V53 HydrophobicContact CG-CB 4.49Å; Q36-V53 HydrophobicContact CG-CG1 4.28Å; V40-V53 HydrophobicContact CG2-CG2 4.18Å; V50-V53 HydrophobicContact CG1-CG2 4.1Å; V53-F55 HydrophobicContact CB-CE2 3.86Å; V53-F55 HydrophobicContact CG1-CD2 4.19Å; V53-F55 HydrophobicContact CG1-CE2 3.2Å; V53-F55 HydrophobicContact CG1-CZ 3.59Å; V53-T76 HydrophobicContact CG1-CG2 3.63Å; V53-A77 CarbonylContact C-O 3.39Å; V53-A77 WeakPolarHBondContact CA-O 3.26Å; V53-V78 HydrophobicContact CG1-CB 4.44Å; V53-V78 HydrophobicContact CG1-CG2 3.72Å; V53-V78 HydrophobicContact CG2-CG1 4.21Å; V53-V78 HydrophobicContact CG2-CG2 4.38Å
54	A	46.6	Very low	49.3	Very low	56 Å²	56	82.4 Å²	82.4	46%	0.463	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	141.9	176.1	0	0	0	0	0	111	T76 A77	A54-T76 CarbonylContact O-C 3.56Å; A54-T76 WeakPolarHBondContact O-CA 3.4Å; A54-A77 PolarHBondContact N-O 3.46Å; A54-A77 PolarHBondContact O-N 3.16Å
55	F	52	Low	50	Low	66 Å²	66	80.2 Å²	80.2	29%	0.289	48%	0.475	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.5	137	179.5	-70.3	-100.5	0	0	0	110.8	Q36 V53 Q75 T76	Q36-F55 HydrophobicContact CB-CZ 4.23Å; Q36-F55 HydrophobicContact CG-CD2 4.24Å; Q36-F55 HydrophobicContact CG-CE1 4.06Å; Q36-F55 HydrophobicContact CG-CE2 3.1Å; Q36-F55 HydrophobicContact CG-CZ 2.99Å; V53-F55 HydrophobicContact CB-CE2 3.86Å; V53-F55 HydrophobicContact CG1-CD2 4.19Å; V53-F55 HydrophobicContact CG1-CE2 3.2Å; V53-F55 HydrophobicContact CG1-CZ 3.59Å; F55-Q75 CarbonylContact C-O 3.53Å; F55-Q75 WeakPolarHBondContact CA-O 3.23Å; F55-T76 HydrophobicContact CD1-CG2 4Å; F55-T76 VanDerWaalsContact CD1-OG1 3.23Å; F55-T76 WeakPolarHBondContact CD1-OG1 3.39Å; F55-T76 HydrophobicContact CE1-CG2 3.33Å; F55-T76 WeakPolarHBondContact CE1-OG1 3.5Å; F55-T76 HydrophobicContact CE2-CG2 3.84Å; F55-T76 HydrophobicContact CZ-CG2 3.15Å
56	Q	48.6	Very low	50.2	Low	113 Å²	113	81 Å²	81	53%	0.528	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.7	125.9	170.6	-172.6	174.4	0.2	0	0	109.1	I58 Q75	Q56-I58 HydrophobicContact CG-CG1 4.28Å; Q56-Q75 PolarHBondContact N-O 2.8Å; Q56-Q75 PolarHBondContact O-N 2.86Å
57	M	52.8	Low	50	Low	77 Å²	77	73.9 Å²	73.9	38%	0.379	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	128.1	173.8	-174	-176.8	-59.9	0	0	109.4	L28 I72 V73 I74	L28-M57 HydrophobicContact CB-CE 4.26Å; L28-M57 HydrophobicContact CD1-CE 3.65Å; L28-M57 HydrophobicContact CD1-SD 4.43Å; M57-I72 HydrophobicContact CG-CG2 3.87Å; M57-I72 HydrophobicContact SD-CG2 3.95Å; M57-V73 CarbonylContact C-O 3.59Å; M57-V73 WeakPolarHBondContact CA-O 3.45Å; M57-I74 HydrophobicContact CE-CD1 3.99Å; M57-I74 HydrophobicContact CE-CG1 4.02Å; M57-I74 HydrophobicContact CG-CG1 4.09Å
58	I	55.4	Low	50	Low	70 Å²	70	72.1 Å²	72.1	36%	0.359	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	118	176.9	-57.1	175.6	0	0	0	107.5	Q56 V60 V73	Q56-I58 HydrophobicContact CG-CG1 4.28Å; I58-V60 HydrophobicContact CG2-CG2 4.03Å; I58-V73 PolarHBondContact N-O 3.11Å; I58-V73 PolarHBondContact O-N 3.36Å
59	V	52.4	Low	50.3	Low	68 Å²	68	73.1 Å²	73.1	41%	0.412	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.6	119.6	172.8	-175.3	0	0	0	0	108.3	I61 M70 G71 I72	V59-I61 HydrophobicContact CG1-CD1 4.45Å; V59-I61 HydrophobicContact CG1-CG1 4.08Å; V59-M70 HydrophobicContact CG1-CG 4.16Å; V59-M70 HydrophobicContact CG1-SD 4.48Å; V59-G71 CarbonylContact C-O 3.47Å; V59-I72 HydrophobicContact CG1-CG1 4.31Å; V59-I72 HydrophobicContact CG2-CG1 4.29Å; V59-I72 HydrophobicContact CG2-CG2 4.36Å
60	V	53.4	Low	50.3	Low	78 Å²	78	70.6 Å²	70.6	47%	0.473	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.8	119	176.3	-176.3	0	0	0	0	108.3	I58 G71	I58-V60 HydrophobicContact CG2-CG2 4.03Å; V60-G71 PolarHBondContact N-O 2.73Å; V60-G71 PolarHBondContact O-N 2.86Å; V60-G71 VanDerWaalsContact O-O 3.14Å
61	I	48.4	Very low	50.6	Low	70 Å²	70	69.8 Å²	69.8	36%	0.359	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	122.2	176.4	-54.5	174.4	0	0	0	107.4	L15 V59 V68 H69 M70	L15-I61 HydrophobicContact CD2-CD1 4.06Å; L15-I61 HydrophobicContact CD2-CG2 3.75Å; V59-I61 HydrophobicContact CG1-CD1 4.45Å; V59-I61 HydrophobicContact CG1-CG1 4.08Å; I61-V68 HydrophobicContact CG2-CG1 3.85Å; I61-H69 WeakPolarHBondContact CA-O 3.47Å; I61-M70 HydrophobicContact CD1-CE 3.88Å; I61-M70 HydrophobicContact CG1-CE 4.09Å; I61-M70 HydrophobicContact CG1-CG 4.28Å
62	H	47.5	Very low	50.8	Low	116 Å²	116	68.3 Å²	68.3	54%	0.537	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	130.5	179.3	-170.9	-109.2	0	0	0	109.8	V64 H69	H62-V64 VanDerWaalsContact CE1-CG2 3.45Å; H62-V64 WeakPolarHBondContact CE1-CG2 3.31Å; H62-V64 VanDerWaalsContact ND1-CG2 3.32Å; H62-V64 WeakPolarHBondContact ND1-CG2 3.38Å; H62-H69 HydrophobicContact CB-CB 4.47Å; H62-H69 PolarHBondContact N-O 2.98Å; H62-H69 WeakPolarHBondContact O-CA 3.27Å; H62-H69 WeakPolarHBondContact O-CB 3.16Å; H62-H69 PolarHBondContact O-N 3.37Å
63	M	42	Very low	51.2	Low	81 Å²	81	65.7 Å²	65.7	40%	0.399	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.3	127.6	176	-62.5	-157.6	-60.1	0	0	110.1	L8 L12 V67 V68	L8-M63 HydrophobicContact CD2-CE 3.68Å; L8-M63 HydrophobicContact CD2-SD 4.12Å; L12-M63 HydrophobicContact CD2-SD 4.22Å; M63-V67 WeakPolarHBondContact CA-O 3.46Å; M63-V68 HydrophobicContact CG-CG2 4.14Å; M63-V68 HydrophobicContact SD-CG2 4.02Å
64	V	52.8	Low	51.4	Low	79 Å²	79	65.4 Å²	65.4	48%	0.479	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	103.1	174.1	-175.5	0	0	0	0	107.9	H62 D66 V67	H62-V64 VanDerWaalsContact CE1-CG2 3.45Å; H62-V64 WeakPolarHBondContact CE1-CG2 3.31Å; H62-V64 VanDerWaalsContact ND1-CG2 3.32Å; H62-V64 WeakPolarHBondContact ND1-CG2 3.38Å; V64-D66 PolarHBondContact O-N 3.24Å; V64-V67 PolarHBondContact N-O 2.98Å; V64-V67 PolarHBondContact O-N 3.36Å
65	G	66.5	Low	51.5	Low	70 Å²	70	65.9 Å²	65.9	72%	0.722	37%	0.366	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.5	-124.9	-169.9	0	0	0	0	0	110.7	V67	G65-V67 VanDerWaalsContact C-N 3.32Å
66	D	58.6	Low	51.3	Low	166 Å²	166	63 Å²	63	89%	0.888	35%	0.354	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.3	4	178.3	-54.9	-37.5	0	0	0	113.2	V64	V64-D66 PolarHBondContact O-N 3.24Å
67	V	44.4	Very low	51.2	Low	55 Å²	55	59.2 Å²	59.2	33%	0.333	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	119.4	-176.9	-173.5	0	0	0	0	110.5	M63 V64 G65 H69	M63-V67 WeakPolarHBondContact CA-O 3.46Å; V64-V67 PolarHBondContact N-O 2.98Å; V64-V67 PolarHBondContact O-N 3.36Å; G65-V67 VanDerWaalsContact C-N 3.32Å; V67-H69 WeakPolarHBondContact CG1-NE2 3.23Å
68	V	48.2	Very low	50.9	Low	38 Å²	38	55.8 Å²	55.8	23%	0.23	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.8	121.3	168.6	-178.5	0	0	0	0	109.4	L15 I61 M63	L15-V68 HydrophobicContact CD1-CG1 4.45Å; L15-V68 HydrophobicContact CD2-CG1 3.51Å; I61-V68 HydrophobicContact CG2-CG1 3.85Å; M63-V68 HydrophobicContact CG-CG2 4.14Å; M63-V68 HydrophobicContact SD-CG2 4.02Å
69	H	49.1	Very low	50.4	Low	51 Å²	51	54.8 Å²	54.8	24%	0.236	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.5	120.9	167.8	-66.8	-103.2	0	0	0	108.5	I61 H62 V67	I61-H69 WeakPolarHBondContact CA-O 3.47Å; H62-H69 HydrophobicContact CB-CB 4.47Å; H62-H69 PolarHBondContact N-O 2.98Å; H62-H69 WeakPolarHBondContact O-CA 3.27Å; H62-H69 WeakPolarHBondContact O-CB 3.16Å; H62-H69 PolarHBondContact O-N 3.37Å; V67-H69 WeakPolarHBondContact CG1-NE2 3.23Å
70	M	49.2	Very low	50.2	Low	14 Å²	14	51.6 Å²	51.6	7%	0.069	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	118.2	173.7	-179.4	-178.8	-72.3	0	0	108.6	L15 A19 V59 I61 I72 M97	L15-M70 HydrophobicContact CD1-CE 3.58Å; L15-M70 HydrophobicContact CD2-CE 3.95Å; L15-M70 HydrophobicContact CG-CE 3.57Å; A19-M70 HydrophobicContact CB-CE 3.86Å; A19-M70 HydrophobicContact CB-SD 4.29Å; V59-M70 HydrophobicContact CG1-CG 4.16Å; V59-M70 HydrophobicContact CG1-SD 4.48Å; I61-M70 HydrophobicContact CD1-CE 3.88Å; I61-M70 HydrophobicContact CG1-CE 4.09Å; I61-M70 HydrophobicContact CG1-CG 4.28Å; M70-I72 HydrophobicContact CG-CG1 4.45Å; M70-M97 HydrophobicContact CB-CB 4.3Å; M70-M97 PolarHBondContact N-O 3.44Å; M70-M97 PolarHBondContact O-N 2.77Å
71	G	55	Low	49.9	Very low	20 Å²	20	52.2 Å²	52.2	21%	0.206	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	128.5	168.3	0	0	0	0	0	109.7	V59 V60 V95	V59-G71 CarbonylContact C-O 3.47Å; V60-G71 PolarHBondContact N-O 2.73Å; V60-G71 PolarHBondContact O-N 2.86Å; V60-G71 VanDerWaalsContact O-O 3.14Å; G71-V95 CarbonylContact C-O 3.45Å; G71-V95 VanDerWaalsContact CA-O 3.24Å; G71-V95 WeakPolarHBondContact CA-O 3.47Å
72	I	52.5	Low	49.8	Very low	17 Å²	17	51.4 Å²	51.4	9%	0.087	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	119.2	167.6	-56.3	174.3	0	0	0	106.6	M57 V59 M70 I74 A94 V95	M57-I72 HydrophobicContact CG-CG2 3.87Å; M57-I72 HydrophobicContact SD-CG2 3.95Å; V59-I72 HydrophobicContact CG1-CG1 4.31Å; V59-I72 HydrophobicContact CG2-CG1 4.29Å; V59-I72 HydrophobicContact CG2-CG2 4.36Å; M70-I72 HydrophobicContact CG-CG1 4.45Å; I72-I74 HydrophobicContact CG2-CG1 4.13Å; I72-A94 CarbonylContact O-C 3.53Å; I72-A94 VanDerWaalsContact O-CA 3.32Å; I72-A94 WeakPolarHBondContact O-CA 3.47Å; I72-V95 HydrophobicContact CB-CB 4.29Å; I72-V95 PolarHBondContact N-O 2.78Å; I72-V95 PolarHBondContact O-N 3.33Å
73	V	54.1	Low	50.2	Low	38 Å²	38	49.2 Å²	49.2	23%	0.23	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	116.9	174.9	-176.7	0	0	0	0	108.2	M57 I58 Q75 V92 V93 A94	M57-V73 CarbonylContact C-O 3.59Å; M57-V73 WeakPolarHBondContact CA-O 3.45Å; I58-V73 PolarHBondContact N-O 3.11Å; I58-V73 PolarHBondContact O-N 3.36Å; V73-Q75 HydrophobicContact CG1-CG 4.17Å; V73-V92 HydrophobicContact CG1-CG1 3.46Å; V73-V92 VanDerWaalsContact CG1-CG1 3.46Å; V73-V93 CarbonylContact C-O 3.53Å; V73-V93 WeakPolarHBondContact CA-O 3.46Å; V73-A94 HydrophobicContact CG2-CB 4.37Å
74	I	50.6	Low	50.3	Low	30 Å²	30	53.8 Å²	53.8	15%	0.154	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.8	116.7	173.9	-54.4	173.7	0	0	0	106.9	M57 I72 V92 V93	M57-I74 HydrophobicContact CE-CD1 3.99Å; M57-I74 HydrophobicContact CE-CG1 4.02Å; M57-I74 HydrophobicContact CG-CG1 4.09Å; I72-I74 HydrophobicContact CG2-CG1 4.13Å; I74-V92 CarbonylContact O-C 3.57Å; I74-V92 VanDerWaalsContact O-CA 3.27Å; I74-V92 WeakPolarHBondContact O-CA 3.42Å; I74-V93 HydrophobicContact CB-CB 4.36Å; I74-V93 PolarHBondContact N-O 2.82Å; I74-V93 PolarHBondContact O-N 2.86Å
75	Q	47.9	Very low	49.5	Very low	67 Å²	67	52.3 Å²	52.3	31%	0.313	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	128.2	170.6	-57.4	-169.2	-70.2	0	0	109.3	F55 Q56 V73 R91 V92	F55-Q75 CarbonylContact C-O 3.53Å; F55-Q75 WeakPolarHBondContact CA-O 3.23Å; Q56-Q75 PolarHBondContact N-O 2.8Å; Q56-Q75 PolarHBondContact O-N 2.86Å; V73-Q75 HydrophobicContact CG1-CG 4.17Å; Q75-R91 CarbonylContact C-O 3.57Å; Q75-R91 WeakPolarHBondContact CA-O 3.49Å; Q75-V92 HydrophobicContact CG-CG1 4.15Å; Q75-V92 HydrophobicContact CG-CG2 3.95Å
76	T	47.8	Very low	48.2	Very low	5 Å²	5	51.7 Å²	51.7	3%	0.031	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	128.4	173	-56	0	0	0	0	107.7	V53 A54 F55 V78 V90 R91	V53-T76 HydrophobicContact CG1-CG2 3.63Å; A54-T76 CarbonylContact O-C 3.56Å; A54-T76 WeakPolarHBondContact O-CA 3.4Å; F55-T76 HydrophobicContact CD1-CG2 4Å; F55-T76 VanDerWaalsContact CD1-OG1 3.23Å; F55-T76 WeakPolarHBondContact CD1-OG1 3.39Å; F55-T76 HydrophobicContact CE1-CG2 3.33Å; F55-T76 WeakPolarHBondContact CE1-OG1 3.5Å; F55-T76 HydrophobicContact CE2-CG2 3.84Å; F55-T76 HydrophobicContact CZ-CG2 3.15Å; T76-V78 HydrophobicContact CG2-CG2 4.24Å; T76-V90 CarbonylContact O-C 3.59Å; T76-V90 WeakPolarHBondContact O-CA 3.4Å; T76-R91 PolarHBondContact N-O 3.17Å; T76-R91 PolarHBondContact O-N 2.83Å
77	A	46.2	Very low	47.2	Very low	34 Å²	34	46.9 Å²	46.9	28%	0.281	29%	0.289	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.9	119.2	169.8	0	0	0	0	0	108.7	V53 A54 A89 V90	V53-A77 CarbonylContact C-O 3.39Å; V53-A77 WeakPolarHBondContact CA-O 3.26Å; A54-A77 PolarHBondContact N-O 3.46Å; A54-A77 PolarHBondContact O-N 3.16Å; A77-A89 WeakPolarHBondContact CA-O 3.44Å; A77-V90 HydrophobicContact CB-CG2 4.19Å
78	V	46.1	Very low	47	Very low	5 Å²	5	45.2 Å²	45.2	3%	0.03	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.6	121.9	172.9	-175.1	0	0	0	0	107.6	A39 L43 V50 V53 T76 V80 A88 A89	A39-V78 HydrophobicContact CB-CG2 4.12Å; L43-V78 HydrophobicContact CD1-CG1 3.6Å; V50-V78 HydrophobicContact CG1-CG1 3.65Å; V53-V78 HydrophobicContact CG1-CB 4.44Å; V53-V78 HydrophobicContact CG1-CG2 3.72Å; V53-V78 HydrophobicContact CG2-CG1 4.21Å; V53-V78 HydrophobicContact CG2-CG2 4.38Å; T76-V78 HydrophobicContact CG2-CG2 4.24Å; V78-V80 HydrophobicContact CG1-CG2 3.75Å; V78-A88 CarbonylContact O-C 3.53Å; V78-A88 VanDerWaalsContact O-CA 3.25Å; V78-A88 WeakPolarHBondContact O-CA 3.25Å; V78-A89 HydrophobicContact CB-CB 4.38Å; V78-A89 PolarHBondContact N-O 2.85Å; V78-A89 PolarHBondContact O-N 3.06Å
79	V	46.4	Very low	46.6	Very low	48 Å²	48	45.3 Å²	45.3	29%	0.291	29%	0.286	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.4	117.5	173.1	-176	0	0	0	0	108.3	G51 V52 I86	G51-V79 PolarHBondContact N-O 2.75Å; V52-V79 PolarHBondContact O-N 2.74Å; V79-I86 HydrophobicContact CG1-CG2 3.53Å
80	V	47.7	Very low	46.1	Very low	1 Å²	1	45.4 Å²	45.4	1%	0.006	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.7	127.4	-174.6	-172.2	0	0	0	0	108.9	L43 V48 V78 I86 L87	L43-V80 HydrophobicContact CD1-CG2 3.49Å; L43-V80 VanDerWaalsContact CD1-CG2 3.49Å; L43-V80 HydrophobicContact CD2-CG1 4.37Å; L43-V80 HydrophobicContact CD2-CG2 4.05Å; L43-V80 HydrophobicContact CG-CG2 4.38Å; V48-V80 HydrophobicContact CB-CG1 3.76Å; V48-V80 HydrophobicContact CG1-CG1 3.05Å; V78-V80 HydrophobicContact CG1-CG2 3.75Å; V80-I86 CarbonylContact O-C 3.5Å; V80-I86 WeakPolarHBondContact O-CA 3.42Å; V80-L87 HydrophobicContact CB-CB 4.13Å; V80-L87 VanDerWaalsContact CB-O 3.26Å; V80-L87 WeakPolarHBondContact CB-O 3.33Å; V80-L87 WeakPolarHBondContact CG2-O 3.35Å; V80-L87 PolarHBondContact N-O 2.87Å; V80-L87 PolarHBondContact O-N 2.69Å
81	H	46.3	Very low	45.6	Very low	91 Å²	91	48 Å²	48	42%	0.421	30%	0.298	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.3	110.5	173.8	-79	-82.6	0	0	0	109.2	A49	A49-H81 PolarHBondContact O-N 3.38Å
82	A	48	Very low	44.8	Very low	53 Å²	53	49.1 Å²	49.1	44%	0.438	30%	0.301	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	85.1	173	0	0	0	0	0	108.9	V48 D84 A85	V48-A82 HydrophobicContact CG1-CB 3.72Å; A82-D84 PolarHBondContact O-N 2.82Å; A82-A85 PolarHBondContact N-O 2.71Å; A82-A85 PolarHBondContact O-N 2.76Å; A82-A85 VanDerWaalsContact O-N 3.17Å
83	G	54.9	Low	44.5	Very low	70 Å²	70	49.4 Å²	49.4	72%	0.722	30%	0.304	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.9	-120.7	-171.4	0	0	0	0	0	110.9
84	D	43.8	Very low	44.1	Very low	177 Å²	177	49.8 Å²	49.8	95%	0.947	31%	0.311	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.4	-6.1	178.7	-61.9	-39.9	0	0	0	113.6	A82	A82-D84 PolarHBondContact O-N 2.82Å
85	A	37.1	Very low	43.8	Very low	49 Å²	49	49.3 Å²	49.3	41%	0.405	31%	0.309	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	133.8	-178.4	0	0	0	0	0	112.1	A82	A82-A85 PolarHBondContact N-O 2.71Å; A82-A85 PolarHBondContact O-N 2.76Å; A82-A85 VanDerWaalsContact O-N 3.17Å
86	I	37.8	Very low	43.6	Very low	56 Å²	56	51.2 Å²	51.2	29%	0.287	32%	0.318	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	110.2	170	-60.3	-179.2	0	0	0	108.5	V79 V80 I113 I115	V79-I86 HydrophobicContact CG1-CG2 3.53Å; V80-I86 CarbonylContact O-C 3.5Å; V80-I86 WeakPolarHBondContact O-CA 3.42Å; I86-I113 VanDerWaalsContact O-O 3.11Å; I86-I115 HydrophobicContact CB-CD1 4.14Å; I86-I115 HydrophobicContact CD1-CD1 4.1Å; I86-I115 HydrophobicContact CG1-CD1 4.47Å
87	L	39.1	Very low	43.4	Very low	66 Å²	66	53.8 Å²	53.8	35%	0.346	33%	0.33	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.1	115.3	171.9	-150.6	79.5	0	0	0	109	V80 E112	V80-L87 HydrophobicContact CB-CB 4.13Å; V80-L87 VanDerWaalsContact CB-O 3.26Å; V80-L87 WeakPolarHBondContact CB-O 3.33Å; V80-L87 WeakPolarHBondContact CG2-O 3.35Å; V80-L87 PolarHBondContact N-O 2.87Å; V80-L87 PolarHBondContact O-N 2.69Å; L87-E112 HydrophobicContact CD1-CB 4.4Å; L87-E112 HydrophobicContact CD1-CG 4.14Å
88	A	39.4	Very low	43.3	Very low	19 Å²	19	54.8 Å²	54.8	16%	0.157	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.1	106.4	176	0	0	0	0	0	110.4	V78 I113	V78-A88 CarbonylContact O-C 3.53Å; V78-A88 VanDerWaalsContact O-CA 3.25Å; V78-A88 WeakPolarHBondContact O-CA 3.25Å; A88-I113 HydrophobicContact CB-CD1 4.3Å
89	A	40.7	Very low	43.1	Very low	41 Å²	41	60.3 Å²	60.3	34%	0.339	36%	0.358	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.6	113.1	174.6	0	0	0	0	0	110.1	A77 V78	A77-A89 WeakPolarHBondContact CA-O 3.44Å; V78-A89 HydrophobicContact CB-CB 4.38Å; V78-A89 PolarHBondContact N-O 2.85Å; V78-A89 PolarHBondContact O-N 3.06Å
90	V	37.7	Very low	42.7	Very low	52 Å²	52	64.6 Å²	64.6	32%	0.315	39%	0.385	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	118.4	174.8	-176.3	0	0	0	0	110.6	T76 A77 V92	T76-V90 CarbonylContact O-C 3.59Å; T76-V90 WeakPolarHBondContact O-CA 3.4Å; A77-V90 HydrophobicContact CB-CG2 4.19Å; V90-V92 HydrophobicContact CG1-CG2 4.13Å
91	R	38.2	Very low	42.2	Very low	68 Å²	68	71.4 Å²	71.4	26%	0.257	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.4	124.7	172.8	-170.6	-179.5	-173.9	178.4	6	109.7	Q75 T76 V93	Q75-R91 CarbonylContact C-O 3.57Å; Q75-R91 WeakPolarHBondContact CA-O 3.49Å; T76-R91 PolarHBondContact N-O 3.17Å; T76-R91 PolarHBondContact O-N 2.83Å; R91-V93 HydrophobicContact CG-CG2 4.36Å
92	V	39.7	Very low	41.4	Very low	44 Å²	44	72.1 Å²	72.1	27%	0.267	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	113.7	175.9	-173.8	0	0	0	0	109.8	V73 I74 Q75 V90	V73-V92 HydrophobicContact CG1-CG1 3.46Å; V73-V92 VanDerWaalsContact CG1-CG1 3.46Å; I74-V92 CarbonylContact O-C 3.57Å; I74-V92 VanDerWaalsContact O-CA 3.27Å; I74-V92 WeakPolarHBondContact O-CA 3.42Å; Q75-V92 HydrophobicContact CG-CG1 4.15Å; Q75-V92 HydrophobicContact CG-CG2 3.95Å; V90-V92 HydrophobicContact CG1-CG2 4.13Å
93	V	44.9	Very low	40.5	Very low	24 Å²	24	74.1 Å²	74.1	15%	0.145	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.6	114.7	173.8	-176.4	0	0	0	0	108.3	V73 I74 R91 V95 M106	V73-V93 CarbonylContact C-O 3.53Å; V73-V93 WeakPolarHBondContact CA-O 3.46Å; I74-V93 HydrophobicContact CB-CB 4.36Å; I74-V93 PolarHBondContact N-O 2.82Å; I74-V93 PolarHBondContact O-N 2.86Å; R91-V93 HydrophobicContact CG-CG2 4.36Å; V93-V95 HydrophobicContact CG1-CG2 4.3Å; V93-M106 HydrophobicContact CG1-CG 4.49Å
94	A	45.3	Very low	39.3	Very low	46 Å²	46	75.5 Å²	75.5	38%	0.38	42%	0.415	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	114.7	173.1	0	0	0	0	0	109.7	I72 V73 K105	I72-A94 CarbonylContact O-C 3.53Å; I72-A94 VanDerWaalsContact O-CA 3.32Å; I72-A94 WeakPolarHBondContact O-CA 3.47Å; V73-A94 HydrophobicContact CG2-CB 4.37Å; A94-K105 VanDerWaalsContact O-O 3.05Å
95	V	44.8	Very low	38.6	Very low	19 Å²	19	74.4 Å²	74.4	12%	0.115	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.9	116.5	171.6	-174	0	0	0	0	107.5	G71 I72 V93 L102 L104	G71-V95 CarbonylContact C-O 3.45Å; G71-V95 VanDerWaalsContact CA-O 3.24Å; G71-V95 WeakPolarHBondContact CA-O 3.47Å; I72-V95 HydrophobicContact CB-CB 4.29Å; I72-V95 PolarHBondContact N-O 2.78Å; I72-V95 PolarHBondContact O-N 3.33Å; V93-V95 HydrophobicContact CG1-CG2 4.3Å; V95-L102 HydrophobicContact CG1-CD1 3.94Å; V95-L102 HydrophobicContact CG1-CG 4.47Å; V95-L104 HydrophobicContact CG1-CD1 4.42Å; V95-L104 HydrophobicContact CG2-CG 4.29Å
96	Q	44.3	Very low	38.1	Very low	108 Å²	108	77.5 Å²	77.5	51%	0.505	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.5	110.4	176	-170.7	179.9	-15.2	0	0	108.8	V98	Q96-V98 HydrophobicContact CG-CG2 3.97Å
97	M	43.9	Very low	37.7	Very low	58 Å²	58	82.5 Å²	82.5	29%	0.286	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.8	108.1	164.8	-74.8	-174.4	88.9	0	0	108.6	M70 L102	M70-M97 HydrophobicContact CB-CB 4.3Å; M70-M97 PolarHBondContact N-O 3.44Å; M70-M97 PolarHBondContact O-N 2.77Å; M97-L102 HydrophobicContact CE-CD1 4.24Å; M97-L102 HydrophobicContact CG-CD1 3.71Å; M97-L102 HydrophobicContact SD-CD1 3.9Å
98	V	42.9	Very low	37.1	Very low	56 Å²	56	85.3 Å²	85.3	34%	0.339	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	122.4	159.2	-172.1	0	0	0	0	105	Q96 Q101	Q96-V98 HydrophobicContact CG-CG2 3.97Å; V98-Q101 PolarHBondContact O-N 2.93Å
99	H	41.6	Very low	36.7	Very low	120 Å²	120	87.8 Å²	87.8	56%	0.556	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	11.3	106.2	177	-110.8	74.8	0	0	0	116.4	Q101	H99-Q101 PolarHBondContact O-N 2.93Å
100	T	39.1	Very low	36.2	Very low	138 Å²	138	90.8 Å²	90.8	85%	0.847	48%	0.478	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.5	-6.5	172.3	16.2	0	0	0	0	120
101	Q	36	Very low	35.7	Very low	144 Å²	144	94.3 Å²	94.3	67%	0.673	49%	0.493	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.8	108.9	170	-65.8	-159.8	-6.5	0	0	111.3	V98 H99 I103	V98-Q101 PolarHBondContact O-N 2.93Å; H99-Q101 PolarHBondContact O-N 2.93Å; Q101-I103 PolarHBondContact O-N 3.02Å
102	L	29.8	Very low	35.1	Very low	107 Å²	107	97.8 Å²	97.8	56%	0.56	51%	0.512	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-65.4	99.4	172.7	-171.1	87.9	0	0	0	108.6	V95 M97 L104	V95-L102 HydrophobicContact CG1-CD1 3.94Å; V95-L102 HydrophobicContact CG1-CG 4.47Å; M97-L102 HydrophobicContact CE-CD1 4.24Å; M97-L102 HydrophobicContact CG-CD1 3.71Å; M97-L102 HydrophobicContact SD-CD1 3.9Å; L102-L104 HydrophobicContact CD2-CD1 3.62Å; L102-L104 HydrophobicContact CG-CD1 3.97Å
103	I	30.6	Very low	34.4	Very low	95 Å²	95	99.4 Å²	99.4	49%	0.487	52%	0.518	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	101.1	173.1	-57.4	177.2	0	0	0	107.9	Q101 K105	Q101-I103 PolarHBondContact O-N 3.02Å; I103-K105 HydrophobicContact CG2-CG 4.21Å; I103-K105 PolarHBondContact O-N 3.28Å
104	L	27.7	Very low	33.3	Very low	98 Å²	98	105 Å²	105	51%	0.513	55%	0.547	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.8	115	168.1	-97.5	91.4	0	0	0	109.3	V95 L102	V95-L104 HydrophobicContact CG1-CD1 4.42Å; V95-L104 HydrophobicContact CG2-CG 4.29Å; L102-L104 HydrophobicContact CD2-CD1 3.62Å; L102-L104 HydrophobicContact CG-CD1 3.97Å
105	K	29.6	Very low	32.6	Very low	155 Å²	155	111.8 Å²	111.8	67%	0.674	58%	0.575	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-110.7	103.1	165.3	-78.6	-173.4	178	178.9	0	109.3	A94 I103	A94-K105 VanDerWaalsContact O-O 3.05Å; I103-K105 HydrophobicContact CG2-CG 4.21Å; I103-K105 PolarHBondContact O-N 3.28Å
106	M	26.8	Very low	32	Very low	113 Å²	113	116.5 Å²	116.5	56%	0.557	60%	0.598	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-84.4	123.3	175.8	-65.5	168.8	77.6	0	0	109.5	V93	V93-M106 HydrophobicContact CG1-CG 4.49Å
107	K	29.4	Very low	31.3	Very low	162 Å²	162	116.9 Å²	116.9	70%	0.704	60%	0.603	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-125.3	117.4	169.7	-167.7	173.8	-179.1	-178.7	0	108.7
108	I	27.4	Very low	30.6	Very low	124 Å²	124	120.2 Å²	120.2	64%	0.636	62%	0.621	S	S	*	*			trans	-94.3	123.4	179.5	-57.8	171.3	0	0	0	107.2
109	S	31	Very low	29.9	Very low	71 Å²	71	123.9 Å²	123.9	50%	0.497	64%	0.638	S	S	.	*			trans	-123.7	99.1	173.6	-62.4	0	0	0	0	108.4
110	S	30.1	Very low	29.2	Very low	104 Å²	104	124.2 Å²	124.2	73%	0.727	64%	0.643	S	S	*	*			trans	-73.3	129.6	170.2	50.9	0	0	0	0	109.6
111	M	26.5	Very low	28.5	Very low	126 Å²	126	123.3 Å²	123.3	62%	0.621	63%	0.629	S	S	*	*			trans	-118.4	109.1	171	-180	170.5	156.4	0	0	107.6	I113	M111-I113 HydrophobicContact CE-CD1 4.25Å; M111-I113 HydrophobicContact CE-CG1 4.04Å; M111-I113 HydrophobicContact CG-CG1 4.44Å
112	E	24.8	Very low	28	Very low	142 Å²	142	121.8 Å²	121.8	66%	0.664	63%	0.626	S	S	*	*			trans	-76.8	121.5	172.6	-65.9	-177	146.1	0	0	108.6	L87	L87-E112 HydrophobicContact CD1-CB 4.4Å; L87-E112 HydrophobicContact CD1-CG 4.14Å
113	I	25.2	Very low	27.8	Very low	78 Å²	78	122.9 Å²	122.9	40%	0.4	63%	0.631	S	S	.	*			trans	-103.9	104.1	169.9	-56.9	178.6	0	0	0	106.1	I86 A88 M111 I115	I86-I113 VanDerWaalsContact O-O 3.11Å; A88-I113 HydrophobicContact CB-CD1 4.3Å; M111-I113 HydrophobicContact CE-CD1 4.25Å; M111-I113 HydrophobicContact CE-CG1 4.04Å; M111-I113 HydrophobicContact CG-CG1 4.44Å; I113-I115 HydrophobicContact CG2-CG1 4.21Å
114	N	23.4	Very low	27.6	Very low	141 Å²	141	125.3 Å²	125.3	75%	0.754	64%	0.643	S	S	*	*			trans	-78.4	121.8	166.1	-78.5	-48.2	0	0	0	107.7
115	I	29.4	Very low	27.6	Very low	189 Å²	189	127.7 Å²	127.7	97%	0.969	66%	0.655	S	S	*	*			trans	-98.1	0	169.4	-55.7	178.7	0	0	0	108	I86 I113	I86-I115 HydrophobicContact CB-CD1 4.14Å; I86-I115 HydrophobicContact CD1-CD1 4.1Å; I86-I115 HydrophobicContact CG1-CD1 4.47Å; I113-I115 HydrophobicContact CG2-CG1 4.21Å

Retrieved 115 of 115 residues in 86 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).