A0A077YZZ3_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077YZZ3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 89 aa.

						>A0A077YZZ3_TRITR|A0A077YZZ3
MFLTASRKFYLLRKGNSLDRDLALDRVLDGDPALDGVAVWDVVAALDADPALDADPALDGVPVLDADTVLDADPPLDGDLALARDLSLE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.3	Low	68.4	Low	212 Å²	212	138 Å²	138	100%	1.044	68%	0.677	S	S	*	*				0	-43.1	0	-149.5	166.1	-155.4	0	0	112.9	L3 T4 A5	M1-L3 PolarHBondContact O-N 3.36Å; M1-T4 PolarHBondContact O-N 3.46Å; M1-A5 PolarHBondContact O-N 3.3Å
2	F	56.9	Low	69	Low	180 Å²	180	136.4 Å²	136.4	79%	0.789	67%	0.673	S	S	*	*	H	α-helix	trans	-58.7	-44.3	-178.3	-66.7	-81.5	0	0	0	115.3	T4 A5 S6	F2-T4 VanDerWaalsContact C-N 3.3Å; F2-T4 PolarHBondContact O-N 2.95Å; F2-A5 PolarHBondContact O-N 3.3Å; F2-S6 PolarHBondContact O-N 3.47Å; F2-S6 VanDerWaalsContact O-N 3.09Å; F2-S6 PolarHBondContact O-OG 2.99Å
3	L	64.2	Low	69.5	Low	152 Å²	152	138.7 Å²	138.7	80%	0.796	67%	0.669	S	S	*	*	H	α-helix	trans	-59.7	-37.9	179.5	-98.4	69	0	0	0	113.2	M1 R7	M1-L3 PolarHBondContact O-N 3.36Å; L3-R7 WeakPolarHBondContact O-CB 3.37Å; L3-R7 PolarHBondContact O-N 3.47Å
4	T	69.3	Low	69.3	Low	106 Å²	106	136.7 Å²	136.7	65%	0.65	66%	0.656	S	S	*	*	H	α-helix	trans	-68.5	-39.2	-180	-45.1	0	0	0	0	111.4	M1 F2 R7 K8	M1-T4 PolarHBondContact O-N 3.46Å; F2-T4 VanDerWaalsContact C-N 3.3Å; F2-T4 PolarHBondContact O-N 2.95Å; T4-R7 PolarHBondContact O-N 3.41Å; T4-K8 WeakPolarHBondContact O-CB 3.47Å; T4-K8 PolarHBondContact O-N 3.35Å
5	A	67.6	Low	69.3	Low	64 Å²	64	129.5 Å²	129.5	53%	0.529	63%	0.632	S	S	.	*	H	α-helix	trans	-65.5	-45.2	176.7	0	0	0	0	0	111.5	M1 F2 R7 K8 F9	M1-A5 PolarHBondContact O-N 3.3Å; F2-A5 PolarHBondContact O-N 3.3Å; A5-R7 PolarHBondContact O-N 3.09Å; A5-K8 PolarHBondContact O-N 2.91Å; A5-F9 WeakPolarHBondContact O-CB 3.28Å; A5-F9 PolarHBondContact O-N 3.29Å
6	S	71.7	Confident	68.9	Low	82 Å²	82	128.1 Å²	128.1	57%	0.573	63%	0.628	S	S	*	*	H	α-helix	trans	-62.1	-41.7	175.6	-58.1	0	0	0	0	112.1	F2 F9 Y10	F2-S6 PolarHBondContact O-N 3.47Å; F2-S6 VanDerWaalsContact O-N 3.09Å; F2-S6 PolarHBondContact O-OG 2.99Å; S6-F9 PolarHBondContact O-N 3.22Å; S6-Y10 PolarHBondContact O-N 2.92Å
7	R	75	Confident	68.7	Low	185 Å²	185	124 Å²	124	70%	0.698	62%	0.615	S	S	*	*	H	α-helix	trans	-65.2	-40.9	176.6	-167.7	168.7	-176	-157.4	0	111.7	L3 T4 A5 Y10 L11	L3-R7 WeakPolarHBondContact O-CB 3.37Å; L3-R7 PolarHBondContact O-N 3.47Å; T4-R7 PolarHBondContact O-N 3.41Å; A5-R7 PolarHBondContact O-N 3.09Å; R7-Y10 PolarHBondContact O-N 3.44Å; R7-L11 HydrophobicContact CG-CD1 4.28Å; R7-L11 WeakPolarHBondContact O-CB 3.48Å; R7-L11 VanDerWaalsContact O-CG 3.28Å; R7-L11 WeakPolarHBondContact O-CG 3.36Å; R7-L11 PolarHBondContact O-N 2.92Å
8	K	74.5	Confident	68.6	Low	163 Å²	163	122.4 Å²	122.4	71%	0.709	61%	0.609	S	S	*	*	H	α-helix	trans	-64	-40.8	176	-159.2	178.5	-174.2	-175.2	0	111.4	T4 A5 L11 L12	T4-K8 WeakPolarHBondContact O-CB 3.47Å; T4-K8 PolarHBondContact O-N 3.35Å; A5-K8 PolarHBondContact O-N 2.91Å; K8-L11 PolarHBondContact O-N 3.47Å; K8-L12 WeakPolarHBondContact O-CB 3.43Å; K8-L12 PolarHBondContact O-N 2.95Å
9	F	72.3	Confident	68.5	Low	123 Å²	123	121.3 Å²	121.3	54%	0.539	61%	0.606	S	S	.	*	H	α-helix	trans	-66	-42.5	176	-174	-98.6	0	0	0	112.6	A5 S6 L12 R13	A5-F9 WeakPolarHBondContact O-CB 3.28Å; A5-F9 PolarHBondContact O-N 3.29Å; S6-F9 PolarHBondContact O-N 3.22Å; F9-L12 PolarHBondContact O-N 2.92Å; F9-R13 VanDerWaalsContact CE1-NH2 3.34Å; F9-R13 WeakPolarHBondContact O-CB 3.36Å; F9-R13 PolarHBondContact O-N 3.38Å
10	Y	67.3	Low	68.4	Low	145 Å²	145	124 Å²	124	57%	0.569	61%	0.608	S	S	*	*	H	α-helix	trans	-61.7	-44.9	175.3	-177.6	-95.6	0	0	0	111.8	S6 R7 R13 K14	S6-Y10 PolarHBondContact O-N 2.92Å; R7-Y10 PolarHBondContact O-N 3.44Å; Y10-R13 PolarHBondContact O-N 3.44Å; Y10-K14 HydrophobicContact CE1-CG 4.03Å; Y10-K14 WeakPolarHBondContact O-CB 3.43Å; Y10-K14 PolarHBondContact O-N 2.93Å
11	L	76.9	Confident	68.2	Low	106 Å²	106	121.7 Å²	121.7	56%	0.555	60%	0.599	S	S	*	*	H	α-helix	trans	-65.6	-39.4	177.3	-69.1	173.1	0	0	0	112.3	R7 K8 K14 G15	R7-L11 HydrophobicContact CG-CD1 4.28Å; R7-L11 WeakPolarHBondContact O-CB 3.48Å; R7-L11 VanDerWaalsContact O-CG 3.28Å; R7-L11 WeakPolarHBondContact O-CG 3.36Å; R7-L11 PolarHBondContact O-N 2.92Å; K8-L11 PolarHBondContact O-N 3.47Å; L11-K14 PolarHBondContact O-N 3.4Å; L11-G15 PolarHBondContact O-N 2.85Å
12	L	75.2	Confident	68.4	Low	119 Å²	119	116.8 Å²	116.8	62%	0.623	58%	0.576	S	S	*	*	H	α-helix	trans	-64.7	-42.3	176.2	-173.2	64.1	0	0	0	111.6	K8 F9 G15 N16	K8-L12 WeakPolarHBondContact O-CB 3.43Å; K8-L12 PolarHBondContact O-N 2.95Å; F9-L12 PolarHBondContact O-N 2.92Å; L12-G15 PolarHBondContact O-N 3.4Å; L12-N16 PolarHBondContact O-N 3.07Å
13	R	75.5	Confident	68.7	Low	166 Å²	166	110.7 Å²	110.7	63%	0.626	56%	0.559	S	S	*	*	H	α-helix	trans	-63.7	-44.5	175.3	-175.1	-174.2	-71	-152	-5.2	111.7	F9 Y10 N16 S17	F9-R13 VanDerWaalsContact CE1-NH2 3.34Å; F9-R13 WeakPolarHBondContact O-CB 3.36Å; F9-R13 PolarHBondContact O-N 3.38Å; Y10-R13 PolarHBondContact O-N 3.44Å; R13-N16 PolarHBondContact O-N 3.23Å; R13-S17 PolarHBondContact O-N 3.04Å; R13-S17 VanDerWaalsContact O-N 3.14Å
14	K	66.4	Low	68.4	Low	111 Å²	111	108.2 Å²	108.2	48%	0.483	55%	0.546	S	S	.	.	H	α-helix	trans	-63.6	-42	176.5	-101.9	-80	-172.5	180	0	111.8	Y10 L11 S17 L18	Y10-K14 HydrophobicContact CE1-CG 4.03Å; Y10-K14 WeakPolarHBondContact O-CB 3.43Å; Y10-K14 PolarHBondContact O-N 2.93Å; L11-K14 PolarHBondContact O-N 3.4Å; K14-S17 WeakPolarHBondContact O-CB 3.49Å; K14-S17 PolarHBondContact O-N 3.14Å; K14-L18 WeakPolarHBondContact O-CG 3.42Å; K14-L18 PolarHBondContact O-N 3.49Å
15	G	70.2	Confident	67.9	Low	29 Å²	29	107.5 Å²	107.5	30%	0.299	54%	0.538	S	S	.	.	H	α-helix	trans	-58.9	-49.2	176.1	0	0	0	0	0	111.8	L11 L12 S17 L18 D19	L11-G15 PolarHBondContact O-N 2.85Å; L12-G15 PolarHBondContact O-N 3.4Å; G15-S17 PolarHBondContact O-N 3.11Å; G15-L18 PolarHBondContact O-N 3.25Å; G15-L18 VanDerWaalsContact O-N 3.11Å; G15-D19 PolarHBondContact O-N 3.25Å; G15-D19 VanDerWaalsContact O-OD2 3.13Å
16	N	62.1	Low	67.3	Low	106 Å²	106	114.2 Å²	114.2	57%	0.567	55%	0.55	S	S	*	.	H	α-helix	trans	-62.7	-29.8	177.6	-126.4	-101.3	0	0	0	113.5	L12 R13 R20	L12-N16 PolarHBondContact O-N 3.07Å; R13-N16 PolarHBondContact O-N 3.23Å; N16-R20 PolarHBondContact O-N 2.94Å
17	S	66.4	Low	66.6	Low	59 Å²	59	115.2 Å²	115.2	41%	0.413	55%	0.552	S	S	.	*	H	α-helix	trans	-68.6	-47.1	173.1	-165.2	0	0	0	0	111.3	R13 K14 G15 D19 R20 D21	R13-S17 PolarHBondContact O-N 3.04Å; R13-S17 VanDerWaalsContact O-N 3.14Å; K14-S17 WeakPolarHBondContact O-CB 3.49Å; K14-S17 PolarHBondContact O-N 3.14Å; G15-S17 PolarHBondContact O-N 3.11Å; S17-D19 VanDerWaalsContact C-N 3.31Å; S17-D19 PolarHBondContact O-N 2.83Å; S17-R20 WeakPolarHBondContact O-CB 3.48Å; S17-R20 PolarHBondContact O-N 2.91Å; S17-R20 VanDerWaalsContact O-N 3.12Å; S17-D21 VanDerWaalsContact O-CG 3.22Å; S17-D21 PolarHBondContact O-N 3.44Å
18	L	65.5	Low	65.6	Low	96 Å²	96	110.8 Å²	110.8	50%	0.503	54%	0.542	S	S	.	.	H	α-helix	trans	-63.5	-37.4	178.5	-69.3	169.3	0	0	0	111.7	K14 G15 R20 D21 L22	K14-L18 WeakPolarHBondContact O-CG 3.42Å; K14-L18 PolarHBondContact O-N 3.49Å; G15-L18 PolarHBondContact O-N 3.25Å; G15-L18 VanDerWaalsContact O-N 3.11Å; L18-R20 VanDerWaalsContact C-N 3.28Å; L18-R20 PolarHBondContact O-N 3.36Å; L18-D21 PolarHBondContact O-N 3.43Å; L18-L22 VanDerWaalsContact O-CB 3.27Å; L18-L22 WeakPolarHBondContact O-CB 3.28Å; L18-L22 VanDerWaalsContact O-CG 3.28Å; L18-L22 WeakPolarHBondContact O-CG 3.27Å; L18-L22 PolarHBondContact O-N 2.92Å
19	D	68.1	Low	64.9	Low	101 Å²	101	110.1 Å²	110.1	54%	0.54	55%	0.546	S	S	.	.	H	α-helix	trans	-62.4	-37.3	174.4	-68.8	-44.1	0	0	0	111.7	G15 S17 A23	G15-D19 PolarHBondContact O-N 3.25Å; G15-D19 VanDerWaalsContact O-OD2 3.13Å; S17-D19 VanDerWaalsContact C-N 3.31Å; S17-D19 PolarHBondContact O-N 2.83Å; D19-A23 VanDerWaalsContact O-CB 3.24Å; D19-A23 WeakPolarHBondContact O-CB 3.49Å; D19-A23 PolarHBondContact O-N 3.15Å
20	R	65.2	Low	63.8	Low	175 Å²	175	107 Å²	107	66%	0.66	55%	0.549	S	S	*	.	H	α-helix	trans	-71.1	-42.6	176.1	-173.7	-178.7	-76	164.4	-5.6	111.5	N16 S17 L18 A23 L24	N16-R20 PolarHBondContact O-N 2.94Å; S17-R20 WeakPolarHBondContact O-CB 3.48Å; S17-R20 PolarHBondContact O-N 2.91Å; S17-R20 VanDerWaalsContact O-N 3.12Å; L18-R20 VanDerWaalsContact C-N 3.28Å; L18-R20 PolarHBondContact O-N 3.36Å; R20-A23 WeakPolarHBondContact O-CB 3.36Å; R20-A23 PolarHBondContact O-N 3.12Å; R20-L24 WeakPolarHBondContact O-CG 3.2Å; R20-L24 PolarHBondContact O-N 3.41Å
21	D	64.4	Low	62.7	Low	76 Å²	76	104.2 Å²	104.2	41%	0.406	54%	0.544	S	S	.	.	H	α-helix	trans	-64.9	-43.6	177.7	-60.6	-28.1	0	0	0	110.5	S17 L18 A23 L24 D25	S17-D21 VanDerWaalsContact O-CG 3.22Å; S17-D21 PolarHBondContact O-N 3.44Å; L18-D21 PolarHBondContact O-N 3.43Å; D21-A23 VanDerWaalsContact C-N 3.31Å; D21-A23 PolarHBondContact O-N 3.23Å; D21-L24 WeakPolarHBondContact O-CB 3.32Å; D21-L24 PolarHBondContact O-N 2.88Å; D21-L24 VanDerWaalsContact O-N 3.15Å; D21-D25 PolarHBondContact O-N 2.92Å
22	L	61.8	Low	61.6	Low	109 Å²	109	104.1 Å²	104.1	57%	0.571	55%	0.55	S	S	*	.	H	α-helix	trans	-64.4	-32.8	172.9	-75.6	165.4	0	0	0	112.8	L18 R26	L18-L22 VanDerWaalsContact O-CB 3.27Å; L18-L22 WeakPolarHBondContact O-CB 3.28Å; L18-L22 VanDerWaalsContact O-CG 3.28Å; L18-L22 WeakPolarHBondContact O-CG 3.27Å; L18-L22 PolarHBondContact O-N 2.92Å; L22-R26 WeakPolarHBondContact O-CB 3.49Å; L22-R26 PolarHBondContact O-N 3.42Å
23	A	62.6	Low	60.5	Low	52 Å²	52	101.5 Å²	101.5	43%	0.43	55%	0.545	S	S	.	.	H	α-helix	trans	-69.2	-37.2	173.4	0	0	0	0	0	111.5	D19 R20 D21 V27	D19-A23 VanDerWaalsContact O-CB 3.24Å; D19-A23 WeakPolarHBondContact O-CB 3.49Å; D19-A23 PolarHBondContact O-N 3.15Å; R20-A23 WeakPolarHBondContact O-CB 3.36Å; R20-A23 PolarHBondContact O-N 3.12Å; D21-A23 VanDerWaalsContact C-N 3.31Å; D21-A23 PolarHBondContact O-N 3.23Å; A23-V27 WeakPolarHBondContact O-CB 3.24Å; A23-V27 WeakPolarHBondContact O-CG2 3.47Å; A23-V27 PolarHBondContact O-N 2.93Å
24	L	58.7	Low	59.3	Low	99 Å²	99	99 Å²	99	52%	0.518	54%	0.543	S	S	.	.	H	α-helix	trans	-66.7	-45.7	173.6	-68.2	168.6	0	0	0	110.8	R20 D21 R26 V27 L28	R20-L24 WeakPolarHBondContact O-CG 3.2Å; R20-L24 PolarHBondContact O-N 3.41Å; D21-L24 WeakPolarHBondContact O-CB 3.32Å; D21-L24 PolarHBondContact O-N 2.88Å; D21-L24 VanDerWaalsContact O-N 3.15Å; L24-R26 VanDerWaalsContact C-N 3.34Å; L24-R26 PolarHBondContact O-N 2.97Å; L24-V27 PolarHBondContact O-N 3.17Å; L24-L28 VanDerWaalsContact O-CG 3.29Å; L24-L28 WeakPolarHBondContact O-CG 3.5Å; L24-L28 PolarHBondContact O-N 3.45Å
25	D	58.1	Low	58.7	Low	92 Å²	92	100.2 Å²	100.2	49%	0.492	56%	0.555	S	S	.	*	H	α-helix	trans	-60.3	-42.2	175.4	-78	-8.2	0	0	0	111.5	D21 V27 L28 D29	D21-D25 PolarHBondContact O-N 2.92Å; D25-V27 VanDerWaalsContact C-N 3.35Å; D25-V27 PolarHBondContact O-N 3.17Å; D25-L28 WeakPolarHBondContact O-CB 3.29Å; D25-L28 PolarHBondContact O-N 3.06Å; D25-L28 VanDerWaalsContact O-N 3.17Å; D25-D29 PolarHBondContact O-N 2.85Å
26	R	55.9	Low	57.4	Low	205 Å²	205	100 Å²	100	77%	0.774	55%	0.553	S	S	*	*	H	α-helix	trans	-68.4	-32	177	-171.4	-176.5	-84.6	173.1	-5.8	112.8	L22 L24 L28 G30	L22-R26 WeakPolarHBondContact O-CB 3.49Å; L22-R26 PolarHBondContact O-N 3.42Å; L24-R26 VanDerWaalsContact C-N 3.34Å; L24-R26 PolarHBondContact O-N 2.97Å; R26-L28 VanDerWaalsContact C-N 3.32Å; R26-G30 PolarHBondContact O-N 2.92Å
27	V	57.7	Low	56.8	Low	103 Å²	103	99.9 Å²	99.9	62%	0.624	56%	0.556	S	S	*	*	H	α-helix	trans	-68.6	-35.8	172.4	168.9	0	0	0	0	110.4	A23 L24 D25	A23-V27 WeakPolarHBondContact O-CB 3.24Å; A23-V27 WeakPolarHBondContact O-CG2 3.47Å; A23-V27 PolarHBondContact O-N 2.93Å; L24-V27 PolarHBondContact O-N 3.17Å; D25-V27 VanDerWaalsContact C-N 3.35Å; D25-V27 PolarHBondContact O-N 3.17Å
28	L	52.1	Low	56.2	Low	92 Å²	92	100.6 Å²	100.6	48%	0.482	57%	0.565	S	S	.	*	H	α-helix	trans	-71.3	-37	175.5	-67.9	166.6	0	0	0	112.7	L24 D25 R26 G30 L34	L24-L28 VanDerWaalsContact O-CG 3.29Å; L24-L28 WeakPolarHBondContact O-CG 3.5Å; L24-L28 PolarHBondContact O-N 3.45Å; D25-L28 WeakPolarHBondContact O-CB 3.29Å; D25-L28 PolarHBondContact O-N 3.06Å; D25-L28 VanDerWaalsContact O-N 3.17Å; R26-L28 VanDerWaalsContact C-N 3.32Å; L28-G30 VanDerWaalsContact C-N 3.34Å; L28-L34 HydrophobicContact CD2-CD1 3.33Å
29	D	59.7	Low	55.6	Low	149 Å²	149	100.3 Å²	100.3	80%	0.797	57%	0.567	S	S	*	*	H	α-helix	trans	-75.3	-22.8	176	-81.2	-19.6	0	0	0	113.2	D25	D25-D29 PolarHBondContact O-N 2.85Å
30	G	49.7	Very low	54.7	Low	58 Å²	58	105.8 Å²	105.8	60%	0.598	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.2	-9.5	-176.3	0	0	0	0	0	114.9	R26 L28 P32	R26-G30 PolarHBondContact O-N 2.92Å; L28-G30 VanDerWaalsContact C-N 3.34Å; G30-P32 WeakPolarHBondContact O-CD 3.37Å
31	D	44.9	Very low	54	Low	85 Å²	85	103.2 Å²	103.2	46%	0.455	58%	0.58	S	S	.	*			trans	-107.2	97.1	-178.2	-155.2	-31.2	0	0	0	110.8	A33 L34	D31-A33 PolarHBondContact O-N 3.41Å; D31-A33 WeakPolarHBondContact OD1-CA 3.22Å; D31-A33 WeakPolarHBondContact OD1-CB 3.31Å; D31-A33 PolarHBondContact OD1-N 3.12Å; D31-L34 PolarHBondContact O-N 2.93Å; D31-L34 VanDerWaalsContact O-N 3.12Å
32	P	53	Low	53.3	Low	105 Å²	105	103.6 Å²	103.6	68%	0.682	59%	0.585	S	S	*	*	G	3₁₀ helix	trans	-59	-4	170.3	22.6	-30.6	0	0	0	113.3	G30 L34 D35	G30-P32 WeakPolarHBondContact O-CD 3.37Å; P32-L34 VanDerWaalsContact C-N 3.25Å; P32-L34 PolarHBondContact O-N 3.36Å; P32-D35 VanDerWaalsContact O-CB 3.31Å; P32-D35 WeakPolarHBondContact O-CB 2.93Å; P32-D35 PolarHBondContact O-N 3.36Å
33	A	52.6	Low	52.8	Low	63 Å²	63	103 Å²	103	52%	0.521	59%	0.586	S	S	.	*	G	3₁₀ helix	trans	-67.6	-20.9	170.7	0	0	0	0	0	113.7	D31 G36	D31-A33 PolarHBondContact O-N 3.41Å; D31-A33 WeakPolarHBondContact OD1-CA 3.22Å; D31-A33 WeakPolarHBondContact OD1-CB 3.31Å; D31-A33 PolarHBondContact OD1-N 3.12Å; A33-G36 WeakPolarHBondContact O-CA 3.49Å; A33-G36 PolarHBondContact O-N 3.1Å; A33-G36 VanDerWaalsContact O-N 3.1Å
34	L	50.1	Low	52.4	Low	113 Å²	113	103.4 Å²	103.4	59%	0.592	59%	0.589	S	S	*	*	G	3₁₀ helix	trans	-86.9	-8.7	173.1	-63	-176.5	0	0	0	113.8	L28 D31 P32 G36	L28-L34 HydrophobicContact CD2-CD1 3.33Å; D31-L34 PolarHBondContact O-N 2.93Å; D31-L34 VanDerWaalsContact O-N 3.12Å; P32-L34 VanDerWaalsContact C-N 3.25Å; P32-L34 PolarHBondContact O-N 3.36Å; L34-G36 PolarHBondContact O-N 2.85Å
35	D	53.2	Low	52.1	Low	137 Å²	137	101.7 Å²	101.7	73%	0.733	59%	0.589	S	S	*	*	G	3₁₀ helix	trans	-68.6	-5.1	156.5	-154.1	23.8	0	0	0	111	P32 V37	P32-D35 VanDerWaalsContact O-CB 3.31Å; P32-D35 WeakPolarHBondContact O-CB 2.93Å; P32-D35 PolarHBondContact O-N 3.36Å; D35-V37 PolarHBondContact O-N 3.28Å
36	G	42.8	Very low	51.8	Low	24 Å²	24	103.9 Å²	103.9	25%	0.247	60%	0.6	C	S	.	*			trans	-69.2	47.3	166.3	0	0	0	0	0	113.6	A33 L34 A38 V39	A33-G36 WeakPolarHBondContact O-CA 3.49Å; A33-G36 PolarHBondContact O-N 3.1Å; A33-G36 VanDerWaalsContact O-N 3.1Å; L34-G36 PolarHBondContact O-N 2.85Å; G36-A38 PolarHBondContact O-N 2.82Å; G36-V39 PolarHBondContact O-N 2.92Å
37	V	49.9	Very low	51.7	Low	105 Å²	105	101.4 Å²	101.4	64%	0.636	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.8	-13.1	161.9	-150.5	0	0	0	0	111.3	D35 V39	D35-V37 PolarHBondContact O-N 3.28Å; V37-V39 VanDerWaalsContact C-N 3.33Å; V37-V39 PolarHBondContact O-N 3.25Å
38	A	54.2	Low	51.4	Low	73 Å²	73	99.9 Å²	99.9	60%	0.603	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.4	-20.4	166.3	0	0	0	0	0	115.6	G36 D41	G36-A38 PolarHBondContact O-N 2.82Å; A38-D41 WeakPolarHBondContact O-CB 3.44Å; A38-D41 PolarHBondContact O-N 2.84Å
39	V	53	Low	51.1	Low	91 Å²	91	99.9 Å²	99.9	55%	0.552	60%	0.601	S	S	*	*	H	α-helix	trans	-76.3	-26.7	-178.8	-179.2	0	0	0	0	112	G36 V37 D41 V42	G36-V39 PolarHBondContact O-N 2.92Å; V37-V39 VanDerWaalsContact C-N 3.33Å; V37-V39 PolarHBondContact O-N 3.25Å; V39-D41 PolarHBondContact O-N 3.46Å; V39-V42 WeakPolarHBondContact O-CB 3.46Å; V39-V42 PolarHBondContact O-N 3.4Å; V39-V42 VanDerWaalsContact O-N 3.14Å
40	W	48.3	Very low	50.9	Low	215 Å²	215	97.4 Å²	97.4	81%	0.814	59%	0.593	S	S	*	*	H	α-helix	trans	-70.1	-21.6	174.3	-68.7	76.8	0	0	0	112.3	V42	W40-V42 VanDerWaalsContact C-N 3.33Å
41	D	51.1	Low	51.2	Low	122 Å²	122	98.2 Å²	98.2	65%	0.652	59%	0.593	S	S	*	*	H	α-helix	trans	-75.1	-24.6	172.8	-140	-3.4	0	0	0	111.9	A38 V39 A44 A45	A38-D41 WeakPolarHBondContact O-CB 3.44Å; A38-D41 PolarHBondContact O-N 2.84Å; V39-D41 PolarHBondContact O-N 3.46Å; D41-A44 PolarHBondContact O-N 3.2Å; D41-A45 PolarHBondContact O-N 3.33Å
42	V	50.9	Low	51.6	Low	83 Å²	83	101.8 Å²	101.8	50%	0.503	61%	0.612	S	S	.	*	H	α-helix	trans	-71.3	-30.3	176	176.8	0	0	0	0	111.8	V39 W40 A45 L46	V39-V42 WeakPolarHBondContact O-CB 3.46Å; V39-V42 PolarHBondContact O-N 3.4Å; V39-V42 VanDerWaalsContact O-N 3.14Å; W40-V42 VanDerWaalsContact C-N 3.33Å; V42-A45 PolarHBondContact O-N 3.18Å; V42-L46 WeakPolarHBondContact O-CG 3.49Å; V42-L46 PolarHBondContact O-N 3.4Å
43	V	51.1	Low	51.7	Low	98 Å²	98	104.2 Å²	104.2	59%	0.594	62%	0.619	S	S	*	*	H	α-helix	trans	-71.9	-32.9	176.8	-174.1	0	0	0	0	111.1	A45 L46	V43-A45 VanDerWaalsContact C-N 3.34Å; V43-L46 PolarHBondContact O-N 3.14Å
44	A	53.3	Low	51.7	Low	60 Å²	60	104.9 Å²	104.9	50%	0.496	62%	0.624	S	S	.	*	H	α-helix	trans	-69.9	-31.3	172.9	0	0	0	0	0	112.4	D41	D41-A44 PolarHBondContact O-N 3.2Å
45	A	52.9	Low	51.4	Low	63 Å²	63	105.9 Å²	105.9	52%	0.521	63%	0.63	S	S	.	*	H	α-helix	trans	-70.3	-28.6	174.5	0	0	0	0	0	113.4	D41 V42 V43 A48	D41-A45 PolarHBondContact O-N 3.33Å; V42-A45 PolarHBondContact O-N 3.18Å; V43-A45 VanDerWaalsContact C-N 3.34Å; A45-A48 PolarHBondContact O-N 3.48Å
46	L	51.4	Low	51.6	Low	137 Å²	137	103.9 Å²	103.9	72%	0.717	63%	0.625	S	S	*	*	H	α-helix	trans	-76.5	-23.3	177.5	-71.2	171	0	0	0	113.7	V42 V43 A48	V42-L46 WeakPolarHBondContact O-CG 3.49Å; V42-L46 PolarHBondContact O-N 3.4Å; V43-L46 PolarHBondContact O-N 3.14Å; L46-A48 VanDerWaalsContact C-N 3.31Å
47	D	53.7	Low	52.2	Low	154 Å²	154	106.5 Å²	106.5	82%	0.824	64%	0.644	S	S	*	*	H	α-helix	trans	-83.4	-12.1	174.9	-157.1	30.6	0	0	0	112.3
48	A	52.4	Low	52.4	Low	71 Å²	71	110 Å²	110	59%	0.587	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-115	33.4	-178.7	0	0	0	0	0	112.7	A45 L46 P50	A45-A48 PolarHBondContact O-N 3.48Å; L46-A48 VanDerWaalsContact C-N 3.31Å; A48-P50 WeakPolarHBondContact O-CD 2.87Å
49	D	45.9	Very low	52.6	Low	92 Å²	92	113.8 Å²	113.8	49%	0.492	67%	0.668	S	S	.	*			trans	-98	79.2	165.3	-162.8	-0.3	0	0	0	111.5	A51	D49-A51 PolarHBondContact O-N 3.14Å; D49-A51 VanDerWaalsContact O-N 3.14Å; D49-A51 WeakPolarHBondContact OD1-CA 2.92Å; D49-A51 WeakPolarHBondContact OD1-CB 3.41Å; D49-A51 PolarHBondContact OD1-N 3.47Å
50	P	55.3	Low	52.4	Low	97 Å²	97	111.6 Å²	111.6	63%	0.63	67%	0.665	S	S	*	*	G	3₁₀ helix	trans	-68.2	2	168	30.2	-33	0	0	0	112.4	A48 L52 D53 A54	A48-P50 WeakPolarHBondContact O-CD 2.87Å; P50-L52 PolarHBondContact O-N 3.15Å; P50-D53 PolarHBondContact O-N 3.31Å; P50-D53 VanDerWaalsContact O-N 3.15Å; P50-A54 PolarHBondContact O-N 2.93Å
51	A	55	Low	52.1	Low	74 Å²	74	107.9 Å²	107.9	61%	0.612	67%	0.665	S	S	*	*	G	3₁₀ helix	trans	-69.8	-15.9	174.9	0	0	0	0	0	112.9	D49	D49-A51 PolarHBondContact O-N 3.14Å; D49-A51 VanDerWaalsContact O-N 3.14Å; D49-A51 WeakPolarHBondContact OD1-CA 2.92Å; D49-A51 WeakPolarHBondContact OD1-CB 3.41Å; D49-A51 PolarHBondContact OD1-N 3.47Å
52	L	52.9	Low	51.9	Low	161 Å²	161	107 Å²	107	84%	0.843	67%	0.667	S	S	*	*	G	3₁₀ helix	trans	-80.4	-18.1	170.7	-76.6	174.7	0	0	0	113.9	P50	P50-L52 PolarHBondContact O-N 3.15Å
53	D	56.8	Low	52.1	Low	155 Å²	155	109.2 Å²	109.2	83%	0.829	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.8	-10	-174.1	-156.9	27.7	0	0	0	113.9	P50	P50-D53 PolarHBondContact O-N 3.31Å; P50-D53 VanDerWaalsContact O-N 3.15Å
54	A	52.3	Low	52.1	Low	77 Å²	77	112.1 Å²	112.1	64%	0.636	69%	0.691	S	S	*	*	S	Bend	trans	-151.7	72.4	-177.3	0	0	0	0	0	114.3	P50	P50-A54 PolarHBondContact O-N 2.93Å
55	D	44.2	Very low	52.1	Low	134 Å²	134	116.4 Å²	116.4	72%	0.717	71%	0.706	S	S	*	*				-162.5	115.4	121.9	-143	-30.4	0	0	0	110.3	A57	D55-A57 PolarHBondContact O-N 2.75Å
56	P	56.3	Low	51.9	Low	95 Å²	95	116 Å²	116	62%	0.617	70%	0.703	S	S	*	*			trans	-69.2	61.4	166.1	32.4	-34.2	0	0	0	110	L58 D59	P56-L58 PolarHBondContact O-N 2.83Å; P56-D59 VanDerWaalsContact O-CB 3.3Å; P56-D59 WeakPolarHBondContact O-CB 3.3Å; P56-D59 PolarHBondContact O-N 3.42Å
57	A	54.8	Low	52	Low	79 Å²	79	116.2 Å²	116.2	65%	0.653	70%	0.704	S	S	*	*	G	3₁₀ helix	trans	-62.9	-3.3	164.4	0	0	0	0	0	112.2	D55 D59	D55-A57 PolarHBondContact O-N 2.75Å; A57-D59 PolarHBondContact O-N 3.03Å
58	L	53.8	Low	51.9	Low	180 Å²	180	115.6 Å²	115.6	94%	0.942	71%	0.707	S	S	*	*	G	3₁₀ helix	trans	-69.9	-9.3	161.7	-66.6	178.1	0	0	0	113.5	P56 G60	P56-L58 PolarHBondContact O-N 2.83Å; L58-G60 PolarHBondContact O-N 3.44Å
59	D	58.4	Low	52	Low	151 Å²	151	116.9 Å²	116.9	81%	0.807	71%	0.707	S	S	*	*	G	3₁₀ helix	trans	-89.2	16.7	176	-146.4	14.1	0	0	0	112.7	P56 A57	P56-D59 VanDerWaalsContact O-CB 3.3Å; P56-D59 WeakPolarHBondContact O-CB 3.3Å; P56-D59 PolarHBondContact O-N 3.42Å; A57-D59 PolarHBondContact O-N 3.03Å
60	G	49.7	Very low	52.2	Low	46 Å²	46	119.4 Å²	119.4	47%	0.474	72%	0.72	S	S	.	*	S	Bend	trans	-132	48.7	-157.5	0	0	0	0	0	118	L58	L58-G60 PolarHBondContact O-N 3.44Å
61	V	41.5	Very low	52.2	Low	136 Å²	136	121.6 Å²	121.6	82%	0.824	73%	0.726	S	S	*	*			trans	74.5	149.1	146.1	-164.3	0	0	0	0	117.6
62	P	48.5	Very low	52.2	Low	105 Å²	105	122.7 Å²	122.7	68%	0.682	74%	0.735	S	S	*	*			cis	-115.2	157.3	-12.2	18.7	3.1	0	0	0	113	L64	P62-L64 PolarHBondContact O-N 2.7Å
63	V	53.5	Low	52.1	Low	128 Å²	128	121.3 Å²	121.3	78%	0.776	73%	0.728	S	S	*	*			trans	-17.2	116.5	144.7	177.8	0	0	0	0	110.6	D65	V63-D65 PolarHBondContact O-N 3.18Å
64	L	52	Low	51.9	Low	159 Å²	159	119.6 Å²	119.6	83%	0.832	73%	0.726	S	S	*	*			trans	-44.2	89.5	155.5	-69.5	149.6	0	0	0	107.4	P62 A66	P62-L64 PolarHBondContact O-N 2.7Å; L64-A66 WeakPolarHBondContact O-CB 3.04Å; L64-A66 PolarHBondContact O-N 3.06Å
65	D	52.1	Low	51.7	Low	150 Å²	150	121 Å²	121	80%	0.802	73%	0.728	S	S	*	*			trans	-70.1	67.2	149.6	-146.1	27.8	0	0	0	102.7	V63	V63-D65 PolarHBondContact O-N 3.18Å
66	A	49.2	Very low	52	Low	56 Å²	56	122 Å²	122	46%	0.463	73%	0.733	S	S	.	*				36.5	102.3	85.1	0	0	0	0	0	108.5	L64	L64-A66 WeakPolarHBondContact O-CB 3.04Å; L64-A66 PolarHBondContact O-N 3.06Å
67	D	53.9	Low	51.9	Low	140 Å²	140	124.8 Å²	124.8	75%	0.749	74%	0.743	S	S	*	*			trans	72.9	51.8	152.1	-50.9	-42.6	0	0	0	116.3	V69	D67-V69 HydrophobicContact CB-CG2 4.23Å; D67-V69 WeakPolarHBondContact O-CG2 3.03Å
68	T	52.7	Low	51.5	Low	142 Å²	142	124.7 Å²	124.7	87%	0.871	75%	0.749	S	S	*	*				-91	67.2	128.1	27.2	0	0	0	0	107.9
69	V	53	Low	51.2	Low	98 Å²	98	122 Å²	122	59%	0.594	74%	0.736	S	S	*	*				60.4	100.1	94.6	170.6	0	0	0	0	110.2	D67	D67-V69 HydrophobicContact CB-CG2 4.23Å; D67-V69 WeakPolarHBondContact O-CG2 3.03Å
70	L	50	Low	50.9	Low	145 Å²	145	120.6 Å²	120.6	76%	0.759	73%	0.728	S	S	*	*			trans	66	117.9	133.1	-92.5	59.2	0	0	0	117.8
71	D	55.6	Low	51	Low	143 Å²	143	123.1 Å²	123.1	77%	0.765	74%	0.744	S	S	*	*				76.4	50.6	111.2	-139.6	21.6	0	0	0	115.4
72	A	54.6	Low	51.5	Low	97 Å²	97	125.1 Å²	125.1	80%	0.802	75%	0.749	S	S	*	*			trans	-99.3	84.8	151.9	0	0	0	0	0	108.4
73	D	51.4	Low	51.7	Low	131 Å²	131	122.8 Å²	122.8	70%	0.701	74%	0.738	S	S	*	*			trans	15.5	122.6	157.1	-81.5	-64.7	0	0	0	117.4
74	P	52.6	Low	51.7	Low	120 Å²	120	126.5 Å²	126.5	78%	0.779	74%	0.739	S	S	*	*				-150.2	129.3	101.6	33.6	-15.7	0	0	0	114.5
75	P	48.6	Very low	51.6	Low	106 Å²	106	123.8 Å²	123.8	69%	0.688	73%	0.725	S	S	*	*			trans	-110	116.1	143.1	31.4	-21	0	0	0	109.7	D77	P75-D77 PolarHBondContact O-N 3.47Å
76	L	50	Low	51.5	Low	156 Å²	156	123.3 Å²	123.3	82%	0.817	72%	0.721	S	S	*	*			trans	6.4	112.2	143.1	-82	57.4	0	0	0	115.8
77	D	55.2	Low	51.9	Low	153 Å²	153	126.1 Å²	126.1	82%	0.818	74%	0.738	S	S	*	*				-170.3	46.5	130	-108.6	-6.6	0	0	0	112.9	P75 D79	P75-D77 PolarHBondContact O-N 3.47Å; D77-D79 VanDerWaalsContact C-N 3.27Å
78	G	45.1	Very low	51.5	Low	76 Å²	76	126 Å²	126	78%	0.784	74%	0.736	S	S	*	*			trans	-99.7	40	161.5	0	0	0	0	0	110.8	L80	G78-L80 PolarHBondContact O-N 3.22Å
79	D	47.7	Very low	51.4	Low	125 Å²	125	132 Å²	132	67%	0.668	75%	0.754	S	S	*	*	T	Hydrogen-bonded Turn	trans	-50.3	137.1	173.1	-149.6	-4.8	0	0	0	109.3	D77 A81	D77-D79 VanDerWaalsContact C-N 3.27Å; D79-A81 PolarHBondContact O-N 3.45Å
80	L	51.7	Low	51.4	Low	121 Å²	121	133.7 Å²	133.7	63%	0.634	76%	0.762	S	S	*	*	T	Hydrogen-bonded Turn	trans	67.8	34.8	154.7	-78	147.2	0	0	0	120	G78 L82	G78-L80 PolarHBondContact O-N 3.22Å; L80-L82 PolarHBondContact O-N 3.49Å
81	A	52.5	Low	51.4	Low	98 Å²	98	133.1 Å²	133.1	81%	0.81	76%	0.763	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.6	0.9	153.3	0	0	0	0	0	113.4	D79 A83	D79-A81 PolarHBondContact O-N 3.45Å; A81-A83 PolarHBondContact O-N 3.43Å
82	L	51.5	Low	51.2	Low	178 Å²	178	132.5 Å²	132.5	93%	0.932	76%	0.762	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.9	17.3	164	-71.3	-179.4	0	0	0	113.3	L80	L80-L82 PolarHBondContact O-N 3.49Å
83	A	53.5	Low	51	Low	56 Å²	56	134.6 Å²	134.6	46%	0.463	76%	0.76	S	S	.	*			trans	-121.7	95.5	170.5	0	0	0	0	0	107.8	A81	A81-A83 PolarHBondContact O-N 3.43Å
84	R	53.4	Low	51	Low	207 Å²	207	134.8 Å²	134.8	78%	0.781	76%	0.764	S	S	*	*			trans	153.8	72.8	153.6	-81.2	-69.3	100.6	97	-7.9	104.3
85	D	48.7	Very low	50.9	Low	102 Å²	102	135.8 Å²	135.8	55%	0.545	76%	0.763	S	S	.	*				66.9	110.2	98.1	-87	-26.2	0	0	0	110.4
86	L	51.7	Low	51	Low	139 Å²	139	137.9 Å²	137.9	73%	0.728	77%	0.768	S	S	*	*				60	79.2	106.5	-59	169.3	0	0	0	111.1
87	S	56.6	Low	51.1	Low	115 Å²	115	136.5 Å²	136.5	80%	0.804	76%	0.764	S	S	*	*			trans	-138.2	72.8	150.8	-70.3	0	0	0	0	104.9
88	L	46	Very low	50.8	Low	138 Å²	138	135.2 Å²	135.2	72%	0.723	76%	0.76	S	S	*	*				86.3	119.4	81.8	-75.7	171.5	0	0	0	109.4
89	E	51.2	Low	51.3	Low	267 Å²	267	140.5 Å²	140.5	100%	1.248	76%	0.758	S	S	*	*			trans	75	0	161.5	-63.1	-176	95.3	0	0	119.1

Retrieved 89 of 89 residues in 18.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).