A0A077Z037_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z037, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 89 aa.

						>A0A077Z037_TRITR|A0A077Z037
MIYATAQDAFPDEQKKNAATLAIVIRGTHRQTDRQTERERKIALACKGSFLTNSCAGVLFPIKRQRQRSNEPKNLLANGSYSHKSSGRL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45	Very low	51.4	Low	205 Å²	205	131.1 Å²	131.1	100%	1.01	73%	0.725	S	S	*	*				0	106.4	0	-121.3	-172.8	-96.2	0	0	106.9	Y3	M1-Y3 HydrophobicContact CB-CE2 4.35Å; M1-Y3 HydrophobicContact SD-CE2 4.43Å
2	I	49.6	Very low	52	Low	173 Å²	173	128.7 Å²	128.7	89%	0.887	71%	0.71	S	S	*	*			trans	-91.5	107.2	178.8	-59.1	174.1	0	0	0	105.9	A4	I2-A4 PolarHBondContact O-N 3.14Å
3	Y	45.9	Very low	52.3	Low	192 Å²	192	127 Å²	127	75%	0.753	69%	0.694	S	S	*	*			trans	-76	102.1	172.6	-74.1	-88.4	0	0	0	107.6	M1 T5	M1-Y3 HydrophobicContact CB-CE2 4.35Å; M1-Y3 HydrophobicContact SD-CE2 4.43Å; Y3-T5 PolarHBondContact O-N 2.81Å
4	A	53.2	Low	52.4	Low	96 Å²	96	128.8 Å²	128.8	79%	0.793	70%	0.695	S	S	*	*			trans	-66.7	103.1	167.5	0	0	0	0	0	107.7	I2 A6	I2-A4 PolarHBondContact O-N 3.14Å; A4-A6 PolarHBondContact O-N 3.23Å
5	T	51.1	Low	52.9	Low	97 Å²	97	129.5 Å²	129.5	60%	0.595	69%	0.689	S	S	*	*			trans	-64.5	124.1	173	38.1	0	0	0	0	108.4	Y3 Q7	Y3-T5 PolarHBondContact O-N 2.81Å; T5-Q7 PolarHBondContact O-N 2.88Å
6	A	54.8	Low	53.3	Low	97 Å²	97	130.3 Å²	130.3	80%	0.802	68%	0.684	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.2	23.7	-179.5	0	0	0	0	0	114.5	A4	A4-A6 PolarHBondContact O-N 3.23Å
7	Q	53.4	Low	53.6	Low	172 Å²	172	129 Å²	129	80%	0.804	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.9	-12	-176.5	-71.5	-171.7	-27.9	0	0	113.6	T5	T5-Q7 PolarHBondContact O-N 2.88Å
8	D	51.7	Low	53.9	Low	150 Å²	150	125.3 Å²	125.3	80%	0.802	67%	0.67	S	S	*	*	S	Bend	trans	-96.1	-4.8	177.4	-79.7	-32	0	0	0	114.3
9	A	52.1	Low	54.2	Low	53 Å²	53	121.6 Å²	121.6	44%	0.438	66%	0.658	S	S	.	*	S	Bend	trans	-91	125.9	169.9	0	0	0	0	0	108.3
10	F	52.2	Low	54.5	Low	122 Å²	122	119.7 Å²	119.7	54%	0.535	65%	0.65	S	S	.	*			trans	94.7	41.2	162.9	-46.7	-69.8	0	0	0	120.7	D12 E13	F10-D12 PolarHBondContact O-N 3.13Å; F10-E13 HydrophobicContact CB-CB 3.96Å; F10-E13 HydrophobicContact CD1-CB 4.11Å; F10-E13 HydrophobicContact CD1-CG 4.29Å; F10-E13 VanDerWaalsContact CD1-OE2 3.22Å; F10-E13 WeakPolarHBondContact CD1-OE2 3.42Å; F10-E13 HydrophobicContact CG-CB 4.39Å
11	P	56.7	Low	54.7	Low	85 Å²	85	119.4 Å²	119.4	55%	0.552	65%	0.648	S	S	*	*	H	α-helix	trans	-62.9	-25.5	163.4	26.3	-31.4	0	0	0	112.6	K15	P11-K15 WeakPolarHBondContact O-CD 3.33Å; P11-K15 VanDerWaalsContact O-CG 3.27Å; P11-K15 WeakPolarHBondContact O-CG 3.37Å
12	D	58.1	Low	55.3	Low	102 Å²	102	111.6 Å²	111.6	55%	0.545	62%	0.616	S	S	.	*	H	α-helix	trans	-87.3	-28.3	-177.2	-75.5	-18.1	0	0	0	114.3	F10 K15 K16	F10-D12 PolarHBondContact O-N 3.13Å; D12-K15 IonicContact OD1-NZ 3.9Å; D12-K16 WeakPolarHBondContact O-CG 3.45Å; D12-K16 PolarHBondContact O-N 2.8Å; D12-K16 VanDerWaalsContact O-N 3.12Å
13	E	55.6	Low	55.7	Low	107 Å²	107	109.2 Å²	109.2	50%	0.5	60%	0.604	S	S	.	*	H	α-helix	trans	-74.9	-37	177.2	-110.7	178.7	-165.6	0	0	111.7	F10 K15 K16 N17	F10-E13 HydrophobicContact CB-CB 3.96Å; F10-E13 HydrophobicContact CD1-CB 4.11Å; F10-E13 HydrophobicContact CD1-CG 4.29Å; F10-E13 VanDerWaalsContact CD1-OE2 3.22Å; F10-E13 WeakPolarHBondContact CD1-OE2 3.42Å; F10-E13 HydrophobicContact CG-CB 4.39Å; E13-K15 PolarHBondContact O-N 3.05Å; E13-K16 PolarHBondContact O-N 2.97Å; E13-N17 PolarHBondContact O-N 2.91Å
14	Q	54.9	Low	56.3	Low	152 Å²	152	104.2 Å²	104.2	71%	0.71	59%	0.593	S	S	*	*	H	α-helix	trans	-65.6	-37.4	172.1	-68.3	-150.8	12.5	0	0	112.4	N17 A18	Q14-N17 PolarHBondContact O-N 3.38Å; Q14-A18 WeakPolarHBondContact O-CB 3.08Å; Q14-A18 PolarHBondContact O-N 3.26Å
15	K	59.1	Low	56.5	Low	139 Å²	139	104.3 Å²	104.3	60%	0.604	58%	0.579	S	S	*	*	H	α-helix	trans	-62.8	-41.5	174	-75.5	173.1	-171.5	170.1	0	112.2	P11 D12 E13 A18 A19	P11-K15 WeakPolarHBondContact O-CD 3.33Å; P11-K15 VanDerWaalsContact O-CG 3.27Å; P11-K15 WeakPolarHBondContact O-CG 3.37Å; D12-K15 IonicContact OD1-NZ 3.9Å; E13-K15 PolarHBondContact O-N 3.05Å; K15-A18 PolarHBondContact O-N 2.95Å; K15-A19 WeakPolarHBondContact O-CB 3.47Å; K15-A19 PolarHBondContact O-N 3.36Å
16	K	58.9	Low	56.8	Low	142 Å²	142	108.8 Å²	108.8	62%	0.617	59%	0.585	S	S	*	*	H	α-helix	trans	-64.8	-40.7	176.1	-73.5	174.9	-176	177	0	112.2	D12 E13 A19 T20	D12-K16 WeakPolarHBondContact O-CG 3.45Å; D12-K16 PolarHBondContact O-N 2.8Å; D12-K16 VanDerWaalsContact O-N 3.12Å; E13-K16 PolarHBondContact O-N 2.97Å; K16-A19 PolarHBondContact O-N 3.32Å; K16-T20 WeakPolarHBondContact O-CB 3.31Å; K16-T20 PolarHBondContact O-N 3.33Å; K16-T20 PolarHBondContact O-OG1 2.98Å
17	N	58.7	Low	56.9	Low	109 Å²	109	105.9 Å²	105.9	58%	0.583	56%	0.564	S	S	*	*	H	α-helix	trans	-66.5	-42.5	177.1	-73.1	-13.3	0	0	0	111.9	E13 Q14 T20 L21	E13-N17 PolarHBondContact O-N 2.91Å; Q14-N17 PolarHBondContact O-N 3.38Å; N17-T20 PolarHBondContact O-N 2.93Å; N17-L21 PolarHBondContact O-N 3.35Å
18	A	59.2	Low	57	Low	63 Å²	63	100.8 Å²	100.8	52%	0.521	55%	0.545	S	S	.	.	H	α-helix	trans	-63.3	-42	176	0	0	0	0	0	112.5	Q14 K15 T20 L21 A22	Q14-A18 WeakPolarHBondContact O-CB 3.08Å; Q14-A18 PolarHBondContact O-N 3.26Å; K15-A18 PolarHBondContact O-N 2.95Å; A18-T20 VanDerWaalsContact C-N 3.35Å; A18-T20 PolarHBondContact O-N 3.03Å; A18-L21 PolarHBondContact O-N 2.97Å; A18-A22 WeakPolarHBondContact O-CB 3.26Å; A18-A22 PolarHBondContact O-N 3.45Å
19	A	60	Low	57.2	Low	55 Å²	55	99 Å²	99	46%	0.455	53%	0.532	S	S	.	.	H	α-helix	trans	-63.2	-41	175.6	0	0	0	0	0	112	K15 K16 A22 I23	K15-A19 WeakPolarHBondContact O-CB 3.47Å; K15-A19 PolarHBondContact O-N 3.36Å; K16-A19 PolarHBondContact O-N 3.32Å; A19-A22 PolarHBondContact O-N 2.84Å; A19-I23 WeakPolarHBondContact O-CG1 3.27Å; A19-I23 PolarHBondContact O-N 3.35Å
20	T	59.8	Low	57.4	Low	82 Å²	82	105.2 Å²	105.2	50%	0.503	54%	0.544	S	S	.	.	H	α-helix	trans	-64.9	-45	176.9	-54.9	0	0	0	0	111.1	K16 N17 A18 A22 I23 V24	K16-T20 WeakPolarHBondContact O-CB 3.31Å; K16-T20 PolarHBondContact O-N 3.33Å; K16-T20 PolarHBondContact O-OG1 2.98Å; N17-T20 PolarHBondContact O-N 2.93Å; A18-T20 VanDerWaalsContact C-N 3.35Å; A18-T20 PolarHBondContact O-N 3.03Å; T20-A22 VanDerWaalsContact C-N 3.3Å; T20-A22 PolarHBondContact O-N 3.07Å; T20-I23 PolarHBondContact O-N 2.92Å; T20-V24 WeakPolarHBondContact O-CG2 3.36Å; T20-V24 PolarHBondContact O-N 3.12Å
21	L	58.6	Low	57.7	Low	115 Å²	115	106 Å²	106	60%	0.602	55%	0.549	S	S	*	.	H	α-helix	trans	-59.7	-42.3	175.5	-140.7	90.7	0	0	0	111.2	N17 A18 I23 V24 I25	N17-L21 PolarHBondContact O-N 3.35Å; A18-L21 PolarHBondContact O-N 2.97Å; L21-I23 PolarHBondContact O-N 2.96Å; L21-V24 PolarHBondContact O-N 3.48Å; L21-I25 HydrophobicContact CD2-CD1 3.98Å; L21-I25 HydrophobicContact CG-CD1 4.2Å; L21-I25 WeakPolarHBondContact O-CB 3.5Å; L21-I25 WeakPolarHBondContact O-CD1 3.5Å; L21-I25 WeakPolarHBondContact O-CG1 3.35Å; L21-I25 PolarHBondContact O-N 3.37Å
22	A	57.2	Low	57.8	Low	40 Å²	40	105.8 Å²	105.8	33%	0.331	55%	0.546	S	S	.	.	H	α-helix	trans	-64.5	-36.4	177.8	0	0	0	0	0	112.9	A18 A19 T20 R26	A18-A22 WeakPolarHBondContact O-CB 3.26Å; A18-A22 PolarHBondContact O-N 3.45Å; A19-A22 PolarHBondContact O-N 2.84Å; T20-A22 VanDerWaalsContact C-N 3.3Å; T20-A22 PolarHBondContact O-N 3.07Å; A22-R26 WeakPolarHBondContact O-CB 3.46Å; A22-R26 VanDerWaalsContact O-CG 3.3Å; A22-R26 WeakPolarHBondContact O-CG 3.25Å; A22-R26 PolarHBondContact O-N 2.96Å
23	I	58.9	Low	58	Low	124 Å²	124	104.8 Å²	104.8	64%	0.636	54%	0.541	S	S	*	.	H	α-helix	trans	-66.7	-45.2	174.2	-68	164.5	0	0	0	110.4	A19 T20 L21 R26 G27	A19-I23 WeakPolarHBondContact O-CG1 3.27Å; A19-I23 PolarHBondContact O-N 3.35Å; T20-I23 PolarHBondContact O-N 2.92Å; L21-I23 PolarHBondContact O-N 2.96Å; I23-R26 PolarHBondContact O-N 3.12Å; I23-G27 PolarHBondContact O-N 3.02Å
24	V	58.7	Low	58.2	Low	86 Å²	86	109.3 Å²	109.3	52%	0.521	55%	0.553	S	S	.	*	H	α-helix	trans	-61.9	-46.8	177.5	174.3	0	0	0	0	110.4	T20 L21 R26 G27 T28	T20-V24 WeakPolarHBondContact O-CG2 3.36Å; T20-V24 PolarHBondContact O-N 3.12Å; L21-V24 PolarHBondContact O-N 3.48Å; V24-R26 PolarHBondContact O-N 2.83Å; V24-G27 PolarHBondContact O-N 3.28Å; V24-G27 VanDerWaalsContact O-N 3.16Å; V24-T28 HydrophobicContact CG1-CG2 4.25Å; V24-T28 WeakPolarHBondContact O-CG2 3.42Å; V24-T28 PolarHBondContact O-N 3.43Å; V24-T28 PolarHBondContact O-OG1 2.82Å; V24-T28 VanDerWaalsContact O-OG1 3.11Å
25	I	57.7	Low	58.4	Low	98 Å²	98	107.8 Å²	107.8	50%	0.503	55%	0.546	S	S	.	.	H	α-helix	trans	-62.9	-41.7	178.8	-67.1	164.2	0	0	0	111.5	L21 G27 T28 H29	L21-I25 HydrophobicContact CD2-CD1 3.98Å; L21-I25 HydrophobicContact CG-CD1 4.2Å; L21-I25 WeakPolarHBondContact O-CB 3.5Å; L21-I25 WeakPolarHBondContact O-CD1 3.5Å; L21-I25 WeakPolarHBondContact O-CG1 3.35Å; L21-I25 PolarHBondContact O-N 3.37Å; I25-G27 VanDerWaalsContact C-N 3.34Å; I25-T28 WeakPolarHBondContact CA-OG1 3.39Å; I25-T28 PolarHBondContact O-OG1 3.17Å; I25-H29 WeakPolarHBondContact O-CB 3.44Å; I25-H29 PolarHBondContact O-N 3.47Å
26	R	56.6	Low	58.5	Low	192 Å²	192	103.7 Å²	103.7	73%	0.725	53%	0.533	S	S	*	.	H	α-helix	trans	-66.9	-36.2	174.7	-74.7	-179.5	-166.6	-176.2	5.3	112.3	A22 I23 V24 R30	A22-R26 WeakPolarHBondContact O-CB 3.46Å; A22-R26 VanDerWaalsContact O-CG 3.3Å; A22-R26 WeakPolarHBondContact O-CG 3.25Å; A22-R26 PolarHBondContact O-N 2.96Å; I23-R26 PolarHBondContact O-N 3.12Å; V24-R26 PolarHBondContact O-N 2.83Å; R26-R30 PolarHBondContact O-N 2.98Å
27	G	56.9	Low	58.8	Low	35 Å²	35	101.1 Å²	101.1	36%	0.361	52%	0.523	S	S	.	.	H	α-helix	trans	-66.3	-46.2	176.2	0	0	0	0	0	112.2	I23 V24 I25 R30 Q31	I23-G27 PolarHBondContact O-N 3.02Å; V24-G27 PolarHBondContact O-N 3.28Å; V24-G27 VanDerWaalsContact O-N 3.16Å; I25-G27 VanDerWaalsContact C-N 3.34Å; G27-R30 PolarHBondContact O-N 3.37Å; G27-Q31 WeakPolarHBondContact O-CG 3.39Å; G27-Q31 PolarHBondContact O-N 3.14Å
28	T	55	Low	59	Low	65 Å²	65	104.6 Å²	104.6	40%	0.399	53%	0.528	S	S	.	.	H	α-helix	trans	-67.8	-41.5	178.9	55	0	0	0	0	111.4	V24 I25 R30 Q31 T32	V24-T28 HydrophobicContact CG1-CG2 4.25Å; V24-T28 WeakPolarHBondContact O-CG2 3.42Å; V24-T28 PolarHBondContact O-N 3.43Å; V24-T28 PolarHBondContact O-OG1 2.82Å; V24-T28 VanDerWaalsContact O-OG1 3.11Å; I25-T28 WeakPolarHBondContact CA-OG1 3.39Å; I25-T28 PolarHBondContact O-OG1 3.17Å; T28-R30 VanDerWaalsContact C-N 3.35Å; T28-R30 PolarHBondContact O-N 3.46Å; T28-Q31 PolarHBondContact O-N 3.37Å; T28-T32 PolarHBondContact O-N 2.92Å; T28-T32 PolarHBondContact O-OG1 2.89Å
29	H	56	Low	59.2	Low	113 Å²	113	106.3 Å²	106.3	52%	0.523	53%	0.525	S	S	.	.	H	α-helix	trans	-57	-45.9	175.8	-169.4	-72.5	0	0	0	112.3	I25 Q31 T32 D33	I25-H29 WeakPolarHBondContact O-CB 3.44Å; I25-H29 PolarHBondContact O-N 3.47Å; H29-Q31 VanDerWaalsContact C-N 3.26Å; H29-Q31 PolarHBondContact O-N 2.89Å; H29-T32 PolarHBondContact O-N 2.87Å; H29-D33 IonicContact CE1-OD1 2.98Å; H29-D33 PolarHBondContact CE1-OD1 2.81Å; H29-D33 IonicContact CE1-OD2 3.97Å; H29-D33 PolarHBondContact CE1-OD2 2.83Å; H29-D33 IonicContact CG-OD2 3.72Å; H29-D33 IonicContact ND1-OD1 2.74Å; H29-D33 IonicContact ND1-OD2 3.46Å; H29-D33 PolarHBondContact ND1-OD2 3.46Å; H29-D33 VanDerWaalsContact O-CG 3.23Å; H29-D33 PolarHBondContact O-N 3.48Å
30	R	56.3	Low	59.2	Low	184 Å²	184	111.4 Å²	111.4	69%	0.694	53%	0.533	S	S	*	.	H	α-helix	trans	-64.1	-30	177.3	-76.4	-176.9	173.5	-179.9	-1.1	113.3	R26 G27 T28 R34	R26-R30 PolarHBondContact O-N 2.98Å; G27-R30 PolarHBondContact O-N 3.37Å; T28-R30 VanDerWaalsContact C-N 3.35Å; T28-R30 PolarHBondContact O-N 3.46Å; R30-R34 WeakPolarHBondContact O-CG 3.46Å; R30-R34 PolarHBondContact O-N 3.15Å
31	Q	58	Low	59.4	Low	139 Å²	139	113.8 Å²	113.8	65%	0.65	54%	0.536	S	S	*	.	H	α-helix	trans	-76.4	-44.4	176.1	-72.7	-179.1	-22.6	0	0	111.2	G27 T28 H29 R34 Q35	G27-Q31 WeakPolarHBondContact O-CG 3.39Å; G27-Q31 PolarHBondContact O-N 3.14Å; T28-Q31 PolarHBondContact O-N 3.37Å; H29-Q31 VanDerWaalsContact C-N 3.26Å; H29-Q31 PolarHBondContact O-N 2.89Å; Q31-R34 PolarHBondContact O-N 2.95Å; Q31-Q35 WeakPolarHBondContact O-CB 3.46Å; Q31-Q35 PolarHBondContact O-N 2.82Å
32	T	60.1	Low	59.5	Low	79 Å²	79	112.8 Å²	112.8	49%	0.485	53%	0.53	S	S	.	.	H	α-helix	trans	-60.3	-46.1	176.1	-48.7	0	0	0	0	110.9	T28 H29 R34 Q35 T36	T28-T32 PolarHBondContact O-N 2.92Å; T28-T32 PolarHBondContact O-OG1 2.89Å; H29-T32 PolarHBondContact O-N 2.87Å; T32-R34 PolarHBondContact O-N 3.23Å; T32-Q35 PolarHBondContact O-N 3.46Å; T32-Q35 VanDerWaalsContact O-N 3.15Å; T32-T36 WeakPolarHBondContact O-CB 3.4Å; T32-T36 PolarHBondContact O-N 3.32Å; T32-T36 PolarHBondContact O-OG1 2.98Å
33	D	61.1	Low	59.4	Low	82 Å²	82	113.1 Å²	113.1	44%	0.439	53%	0.534	S	S	.	.	H	α-helix	trans	-58.9	-45.1	178.9	-70.3	-27.9	0	0	0	112.4	H29 Q35 T36 E37	H29-D33 IonicContact CE1-OD1 2.98Å; H29-D33 PolarHBondContact CE1-OD1 2.81Å; H29-D33 IonicContact CE1-OD2 3.97Å; H29-D33 PolarHBondContact CE1-OD2 2.83Å; H29-D33 IonicContact CG-OD2 3.72Å; H29-D33 IonicContact ND1-OD1 2.74Å; H29-D33 IonicContact ND1-OD2 3.46Å; H29-D33 PolarHBondContact ND1-OD2 3.46Å; H29-D33 VanDerWaalsContact O-CG 3.23Å; H29-D33 PolarHBondContact O-N 3.48Å; D33-Q35 VanDerWaalsContact C-N 3.32Å; D33-Q35 PolarHBondContact O-N 2.86Å; D33-T36 PolarHBondContact O-N 3.07Å; D33-E37 VanDerWaalsContact O-CB 3.25Å; D33-E37 WeakPolarHBondContact O-CB 3.42Å; D33-E37 PolarHBondContact O-N 2.92Å
34	R	60.4	Low	59.2	Low	201 Å²	201	113.3 Å²	113.3	76%	0.758	54%	0.535	S	S	*	.	H	α-helix	trans	-65.6	-36.9	178.4	-75.6	179.4	178.1	176	-0.2	112	R30 Q31 T32 R38	R30-R34 WeakPolarHBondContact O-CG 3.46Å; R30-R34 PolarHBondContact O-N 3.15Å; Q31-R34 PolarHBondContact O-N 2.95Å; T32-R34 PolarHBondContact O-N 3.23Å; R34-R38 WeakPolarHBondContact O-CB 3.33Å; R34-R38 PolarHBondContact O-N 3.37Å; R34-R38 VanDerWaalsContact O-N 3.12Å
35	Q	60.4	Low	59.1	Low	121 Å²	121	112.7 Å²	112.7	57%	0.565	54%	0.539	S	S	*	.	H	α-helix	trans	-70.7	-46.6	177.9	-174.3	175	-21.4	0	0	111	Q31 T32 D33 E37 R38 E39	Q31-Q35 WeakPolarHBondContact O-CB 3.46Å; Q31-Q35 PolarHBondContact O-N 2.82Å; T32-Q35 PolarHBondContact O-N 3.46Å; T32-Q35 VanDerWaalsContact O-N 3.15Å; D33-Q35 VanDerWaalsContact C-N 3.32Å; D33-Q35 PolarHBondContact O-N 2.86Å; Q35-E37 VanDerWaalsContact C-N 3.33Å; Q35-E37 PolarHBondContact O-N 3.31Å; Q35-R38 WeakPolarHBondContact O-CB 3.39Å; Q35-R38 PolarHBondContact O-N 3.32Å; Q35-R38 VanDerWaalsContact O-N 3.17Å; Q35-E39 WeakPolarHBondContact CG-OE1 3.36Å; Q35-E39 PolarHBondContact NE2-OE1 2.94Å; Q35-E39 VanDerWaalsContact NE2-OE1 3.14Å; Q35-E39 WeakPolarHBondContact O-CG 3.41Å; Q35-E39 PolarHBondContact O-N 2.86Å
36	T	60.8	Low	58.9	Low	53 Å²	53	112.5 Å²	112.5	33%	0.325	55%	0.545	S	S	.	.	H	α-helix	trans	-63.3	-37.5	177	-53.9	0	0	0	0	111.7	T32 D33 E39 R40	T32-T36 WeakPolarHBondContact O-CB 3.4Å; T32-T36 PolarHBondContact O-N 3.32Å; T32-T36 PolarHBondContact O-OG1 2.98Å; D33-T36 PolarHBondContact O-N 3.07Å; T36-E39 PolarHBondContact O-N 2.98Å; T36-R40 WeakPolarHBondContact O-CB 3.41Å; T36-R40 WeakPolarHBondContact O-CG 3.35Å; T36-R40 PolarHBondContact O-N 2.98Å
37	E	64.1	Low	58.7	Low	88 Å²	88	112.1 Å²	112.1	41%	0.411	55%	0.549	S	S	.	.	H	α-helix	trans	-66.2	-38.9	174.6	-173.5	60.2	-159.1	0	0	111.8	D33 Q35 R40 K41	D33-E37 VanDerWaalsContact O-CB 3.25Å; D33-E37 WeakPolarHBondContact O-CB 3.42Å; D33-E37 PolarHBondContact O-N 2.92Å; Q35-E37 VanDerWaalsContact C-N 3.33Å; Q35-E37 PolarHBondContact O-N 3.31Å; E37-R40 PolarHBondContact O-N 2.74Å; E37-K41 WeakPolarHBondContact O-CG 3.48Å; E37-K41 PolarHBondContact O-N 3.46Å; E37-K41 VanDerWaalsContact OE1-CE 3.31Å; E37-K41 WeakPolarHBondContact OE1-CE 3.47Å
38	R	63.7	Low	58.2	Low	181 Å²	181	113.7 Å²	113.7	68%	0.683	57%	0.565	S	S	*	*	H	α-helix	trans	-64.9	-42.7	173.6	-170.5	-178.2	-178.1	-158.7	0.9	111.3	R34 Q35 K41 I42	R34-R38 WeakPolarHBondContact O-CB 3.33Å; R34-R38 PolarHBondContact O-N 3.37Å; R34-R38 VanDerWaalsContact O-N 3.12Å; Q35-R38 WeakPolarHBondContact O-CB 3.39Å; Q35-R38 PolarHBondContact O-N 3.32Å; Q35-R38 VanDerWaalsContact O-N 3.17Å; R38-K41 PolarHBondContact O-N 3.46Å; R38-I42 HydrophobicContact CG-CD1 4.05Å; R38-I42 VanDerWaalsContact O-CG1 3.26Å; R38-I42 WeakPolarHBondContact O-CG1 3.46Å; R38-I42 PolarHBondContact O-N 2.91Å
39	E	62.3	Low	57.8	Low	100 Å²	100	114.8 Å²	114.8	47%	0.467	58%	0.575	S	S	.	*	H	α-helix	trans	-64.6	-41	176.6	-73	171.3	-170.4	0	0	111.7	Q35 T36 I42 A43	Q35-E39 WeakPolarHBondContact CG-OE1 3.36Å; Q35-E39 PolarHBondContact NE2-OE1 2.94Å; Q35-E39 VanDerWaalsContact NE2-OE1 3.14Å; Q35-E39 WeakPolarHBondContact O-CG 3.41Å; Q35-E39 PolarHBondContact O-N 2.86Å; T36-E39 PolarHBondContact O-N 2.98Å; E39-I42 PolarHBondContact O-N 3.16Å; E39-A43 VanDerWaalsContact O-CB 3.27Å; E39-A43 WeakPolarHBondContact O-CB 3.19Å; E39-A43 PolarHBondContact O-N 3.11Å
40	R	61	Low	57.3	Low	161 Å²	161	118.3 Å²	118.3	61%	0.608	59%	0.589	S	S	*	*	H	α-helix	trans	-61.5	-44.7	172.6	-78.8	-178.6	179.9	179.1	0.5	112.1	T36 E37 A43 L44	T36-R40 WeakPolarHBondContact O-CB 3.41Å; T36-R40 WeakPolarHBondContact O-CG 3.35Å; T36-R40 PolarHBondContact O-N 2.98Å; E37-R40 PolarHBondContact O-N 2.74Å; R40-A43 PolarHBondContact O-N 3.29Å; R40-L44 WeakPolarHBondContact O-CB 3.3Å; R40-L44 PolarHBondContact O-N 2.99Å
41	K	63.3	Low	56.8	Low	132 Å²	132	116.9 Å²	116.9	57%	0.574	59%	0.594	S	S	*	*	H	α-helix	trans	-63.1	-40.4	176.8	-75	178.1	-178.3	179.4	0	112.4	E37 R38 A45	E37-K41 WeakPolarHBondContact O-CG 3.48Å; E37-K41 PolarHBondContact O-N 3.46Å; E37-K41 VanDerWaalsContact OE1-CE 3.31Å; E37-K41 WeakPolarHBondContact OE1-CE 3.47Å; R38-K41 PolarHBondContact O-N 3.46Å; K41-A45 WeakPolarHBondContact O-CB 3.36Å; K41-A45 PolarHBondContact O-N 3.46Å
42	I	61.1	Low	56.2	Low	94 Å²	94	116.4 Å²	116.4	48%	0.482	60%	0.601	S	S	.	*	H	α-helix	trans	-66.2	-44.2	174.5	-67.2	165.4	0	0	0	110.2	R38 E39 L44 A45 C46	R38-I42 HydrophobicContact CG-CD1 4.05Å; R38-I42 VanDerWaalsContact O-CG1 3.26Å; R38-I42 WeakPolarHBondContact O-CG1 3.46Å; R38-I42 PolarHBondContact O-N 2.91Å; E39-I42 PolarHBondContact O-N 3.16Å; I42-L44 PolarHBondContact O-N 3.02Å; I42-A45 PolarHBondContact O-N 3.38Å; I42-C46 WeakPolarHBondContact O-CB 3.42Å; I42-C46 PolarHBondContact O-N 2.97Å; I42-C46 PolarHBondContact O-SG 3.47Å
43	A	55.4	Low	55.3	Low	48 Å²	48	120.7 Å²	120.7	40%	0.397	62%	0.621	S	S	.	*	H	α-helix	trans	-64.5	-39.2	178.6	0	0	0	0	0	112.6	E39 R40 C46 K47	E39-A43 VanDerWaalsContact O-CB 3.27Å; E39-A43 WeakPolarHBondContact O-CB 3.19Å; E39-A43 PolarHBondContact O-N 3.11Å; R40-A43 PolarHBondContact O-N 3.29Å; A43-C46 PolarHBondContact O-N 2.85Å; A43-K47 WeakPolarHBondContact O-CB 3.45Å; A43-K47 WeakPolarHBondContact O-CG 3.27Å; A43-K47 PolarHBondContact O-N 3.01Å
44	L	54.3	Low	54.5	Low	128 Å²	128	122.5 Å²	122.5	67%	0.67	64%	0.64	S	S	*	*	H	α-helix	trans	-66.5	-42.7	173.8	-84.6	155.4	0	0	0	111.8	R40 I42 C46 K47 G48	R40-L44 WeakPolarHBondContact O-CB 3.3Å; R40-L44 PolarHBondContact O-N 2.99Å; I42-L44 PolarHBondContact O-N 3.02Å; L44-C46 VanDerWaalsContact C-N 3.26Å; L44-C46 PolarHBondContact O-N 2.8Å; L44-K47 PolarHBondContact O-N 2.92Å; L44-G48 PolarHBondContact O-N 3.01Å
45	A	56.2	Low	54	Low	72 Å²	72	118.7 Å²	118.7	60%	0.595	64%	0.643	S	S	*	*	H	α-helix	trans	-61.2	-36.1	173.7	0	0	0	0	0	112	K41 I42	K41-A45 WeakPolarHBondContact O-CB 3.36Å; K41-A45 PolarHBondContact O-N 3.46Å; I42-A45 PolarHBondContact O-N 3.38Å
46	C	53.3	Low	53.3	Low	94 Å²	94	117.7 Å²	117.7	64%	0.635	66%	0.655	S	S	*	*	H	α-helix	trans	-81.2	-24.1	178.6	-68.1	0	0	0	0	114.2	I42 A43 L44	I42-C46 WeakPolarHBondContact O-CB 3.42Å; I42-C46 PolarHBondContact O-N 2.97Å; I42-C46 PolarHBondContact O-SG 3.47Å; A43-C46 PolarHBondContact O-N 2.85Å; L44-C46 VanDerWaalsContact C-N 3.26Å; L44-C46 PolarHBondContact O-N 2.8Å
47	K	53.6	Low	52.9	Low	185 Å²	185	118 Å²	118	80%	0.804	67%	0.67	S	S	*	*	H	α-helix	trans	-100.9	-6.6	-178.7	-73.1	-168.9	174.5	-174.2	0	114.9	A43 L44	A43-K47 WeakPolarHBondContact O-CB 3.45Å; A43-K47 WeakPolarHBondContact O-CG 3.27Å; A43-K47 PolarHBondContact O-N 3.01Å; L44-K47 PolarHBondContact O-N 2.92Å
48	G	46.1	Very low	52.5	Low	67 Å²	67	119.2 Å²	119.2	69%	0.691	68%	0.682	S	S	*	*	S	Bend	trans	-93.6	4.7	177.7	0	0	0	0	0	116.2	L44	L44-G48 PolarHBondContact O-N 3.01Å
49	S	46	Very low	52.6	Low	88 Å²	88	118.5 Å²	118.5	62%	0.615	69%	0.691	S	S	*	*			trans	-118.5	52.1	-179.7	57.8	0	0	0	0	112.7
50	F	45.2	Very low	52.7	Low	188 Å²	188	121.5 Å²	121.5	83%	0.825	70%	0.703	S	S	*	*	S	Bend	trans	-78.9	117.5	146	-102.5	-96.4	0	0	0	106.5
51	L	45.7	Very low	53	Low	153 Å²	153	119.6 Å²	119.6	80%	0.801	71%	0.712	S	S	*	*	S	Bend	trans	79.8	62.1	159.4	-44.9	171.5	0	0	0	118.4
52	T	46.1	Very low	53	Low	129 Å²	129	120.6 Å²	120.6	79%	0.791	72%	0.722	S	S	*	*			trans	-142.9	115.7	138.2	43.9	0	0	0	0	110
53	N	42.3	Very low	53.3	Low	169 Å²	169	125.6 Å²	125.6	90%	0.904	74%	0.74	S	S	*	*			trans	-53.6	140.4	172.9	-65.7	-44.4	0	0	0	109.8
54	S	44	Very low	53.8	Low	121 Å²	121	134.6 Å²	134.6	85%	0.846	76%	0.764	S	S	*	*			trans	90.6	57.5	171.2	-149.6	0	0	0	0	117.3
55	C	49.3	Very low	54.3	Low	121 Å²	121	137.1 Å²	137.1	82%	0.818	77%	0.772	S	S	*	*			trans	-127.4	94.7	150.4	-82	0	0	0	0	107.8	G57	C55-G57 PolarHBondContact O-N 3.39Å
56	A	46.6	Very low	54.9	Low	99 Å²	99	144.4 Å²	144.4	82%	0.818	78%	0.784	S	S	*	*			trans	-57.2	95	164	0	0	0	0	0	107.6	V58	A56-V58 PolarHBondContact O-N 3.4Å; A56-V58 VanDerWaalsContact O-N 3.14Å
57	G	50.8	Low	55.5	Low	61 Å²	61	148.8 Å²	148.8	63%	0.629	80%	0.795	S	S	*	*			trans	-57.6	119	178.6	0	0	0	0	0	108.8	C55 L59	C55-G57 PolarHBondContact O-N 3.39Å; G57-L59 PolarHBondContact O-N 3.21Å
58	V	57.2	Low	56	Low	112 Å²	112	151.2 Å²	151.2	68%	0.679	80%	0.799	S	S	*	*			trans	-67.2	87.9	171.6	-174.6	0	0	0	0	107.1	A56 F60	A56-V58 PolarHBondContact O-N 3.4Å; A56-V58 VanDerWaalsContact O-N 3.14Å; V58-F60 HydrophobicContact CB-CE2 4.26Å; V58-F60 HydrophobicContact CG1-CD1 4.48Å; V58-F60 HydrophobicContact CG1-CD2 4.14Å; V58-F60 HydrophobicContact CG1-CE1 4.06Å; V58-F60 HydrophobicContact CG1-CE2 3.68Å; V58-F60 HydrophobicContact CG1-CZ 3.64Å; V58-F60 PolarHBondContact O-N 3.31Å; V58-F60 VanDerWaalsContact O-N 3.13Å
59	L	64.3	Low	57	Low	166 Å²	166	151.7 Å²	151.7	87%	0.869	79%	0.792	S	S	*	*			trans	-74.2	97.8	173.3	-136.5	89	0	0	0	107.1	G57	G57-L59 PolarHBondContact O-N 3.21Å
60	F	64.9	Low	57.9	Low	163 Å²	163	155.3 Å²	155.3	72%	0.715	81%	0.805	S	S	*	*			trans	-67.7	129.6	172	-69.3	-82.7	0	0	0	109.3	V58 I62	V58-F60 HydrophobicContact CB-CE2 4.26Å; V58-F60 HydrophobicContact CG1-CD1 4.48Å; V58-F60 HydrophobicContact CG1-CD2 4.14Å; V58-F60 HydrophobicContact CG1-CE1 4.06Å; V58-F60 HydrophobicContact CG1-CE2 3.68Å; V58-F60 HydrophobicContact CG1-CZ 3.64Å; V58-F60 PolarHBondContact O-N 3.31Å; V58-F60 VanDerWaalsContact O-N 3.13Å; F60-I62 PolarHBondContact O-N 3.33Å
61	P	67	Low	58.7	Low	121 Å²	121	153.4 Å²	153.4	79%	0.786	80%	0.798	S	S	*	*			trans	-68.8	103.3	179.6	26.1	-31.9	0	0	0	109.9	K63	P61-K63 PolarHBondContact O-N 3.5Å
62	I	64.6	Low	59.5	Low	154 Å²	154	151.6 Å²	151.6	79%	0.79	80%	0.796	S	S	*	*			trans	-71	113	167	-59.6	176.1	0	0	0	107.1	F60 R64	F60-I62 PolarHBondContact O-N 3.33Å; I62-R64 PolarHBondContact O-N 2.95Å
63	K	67.2	Low	60.4	Low	199 Å²	199	153.2 Å²	153.2	87%	0.865	79%	0.792	S	S	*	*			trans	-60.1	111.6	170	-70.3	-176.5	-179.6	178.8	0	108	P61 Q65	P61-K63 PolarHBondContact O-N 3.5Å; K63-Q65 PolarHBondContact O-N 3.04Å
64	R	65.6	Low	61.2	Low	237 Å²	237	152.3 Å²	152.3	89%	0.894	79%	0.787	S	S	*	*			trans	-64.5	103.6	169.7	-66.9	-173.8	-179.6	-154	0.7	107.8	I62 R66	I62-R64 PolarHBondContact O-N 2.95Å; R64-R66 PolarHBondContact O-N 3.02Å; R64-R66 VanDerWaalsContact O-N 3.07Å
65	Q	64.6	Low	62	Low	180 Å²	180	154.2 Å²	154.2	84%	0.841	79%	0.787	S	S	*	*			trans	-61.5	111.6	166.8	-175.5	173.7	-8.1	0	0	106.8	K63 Q67	K63-Q65 PolarHBondContact O-N 3.04Å; Q65-Q67 PolarHBondContact O-N 3.12Å
66	R	68.3	Low	62.5	Low	225 Å²	225	156.1 Å²	156.1	85%	0.849	79%	0.788	S	S	*	*			trans	-62.1	103	173.1	-77.3	-173	172.4	-152.8	-2	107.4	R64 R68	R64-R66 PolarHBondContact O-N 3.02Å; R64-R66 VanDerWaalsContact O-N 3.07Å; R66-R68 PolarHBondContact O-N 3.33Å; R66-R68 VanDerWaalsContact O-N 3.12Å
67	Q	67.1	Low	62.7	Low	186 Å²	186	155 Å²	155	87%	0.869	78%	0.779	S	S	*	*			trans	-59.2	115.7	159.2	-80.2	-176.5	-20.8	0	0	106.4	Q65 S69	Q65-Q67 PolarHBondContact O-N 3.12Å; Q67-S69 VanDerWaalsContact C-N 3.3Å; Q67-S69 PolarHBondContact O-N 3.36Å
68	R	63.8	Low	62.9	Low	236 Å²	236	159.7 Å²	159.7	89%	0.891	79%	0.789	S	S	*	*			trans	-65.3	97.4	165.2	-79.6	-178.9	168.7	-179.8	-3.6	105.7	R66 N70	R66-R68 PolarHBondContact O-N 3.33Å; R66-R68 VanDerWaalsContact O-N 3.12Å; R68-N70 PolarHBondContact O-N 3.48Å
69	S	66.8	Low	62.5	Low	77 Å²	77	158.3 Å²	158.3	54%	0.538	80%	0.798	S	S	.	*			trans	-65.9	128.3	160.7	54.8	0	0	0	0	106.9	Q67 E71	Q67-S69 VanDerWaalsContact C-N 3.3Å; Q67-S69 PolarHBondContact O-N 3.36Å; S69-E71 PolarHBondContact O-N 3.49Å
70	N	64.7	Low	62.3	Low	165 Å²	165	155.5 Å²	155.5	88%	0.882	79%	0.792	S	S	*	*			trans	-74.3	29.2	171.8	-75.2	-21.5	0	0	0	111.5	R68	R68-N70 PolarHBondContact O-N 3.48Å
71	E	61.6	Low	61.9	Low	148 Å²	148	157.2 Å²	157.2	69%	0.692	80%	0.795	S	S	*	*			trans	-83.8	126.3	-179.6	-144	174.2	-163.6	0	0	108.1	S69 K73	S69-E71 PolarHBondContact O-N 3.49Å; E71-K73 PolarHBondContact O-N 2.97Å
72	P	63.7	Low	61.3	Low	114 Å²	114	156.3 Å²	156.3	74%	0.74	79%	0.792	S	S	*	*			trans	-61.1	108.6	176.5	24.2	-31.2	0	0	0	108.1	N74	P72-N74 PolarHBondContact O-N 3.29Å
73	K	63.8	Low	61	Low	164 Å²	164	155.5 Å²	155.5	71%	0.713	79%	0.785	S	S	*	*			trans	-67.1	99.2	172	-67.3	179.6	-176.1	176.5	0	107.2	E71 L75	E71-K73 PolarHBondContact O-N 2.97Å; K73-L75 PolarHBondContact O-N 2.75Å
74	N	60	Low	60.5	Low	150 Å²	150	155.9 Å²	155.9	80%	0.802	79%	0.786	S	S	*	*			trans	-59.2	92.1	157.5	-94.3	-31.9	0	0	0	107.1	P72 L76	P72-N74 PolarHBondContact O-N 3.29Å; N74-L76 PolarHBondContact O-N 3.06Å
75	L	60.6	Low	60.3	Low	161 Å²	161	149.7 Å²	149.7	84%	0.843	78%	0.78	S	S	*	*			trans	-69.9	73.1	168.7	-72.7	161.1	0	0	0	107.2	K73 A77	K73-L75 PolarHBondContact O-N 2.75Å; L75-A77 PolarHBondContact O-N 3.35Å
76	L	58.6	Low	60.4	Low	161 Å²	161	146.9 Å²	146.9	84%	0.843	78%	0.78	S	S	*	*			trans	-72.9	93.8	163	-74.1	173.7	0	0	0	106.8	N74	N74-L76 PolarHBondContact O-N 3.06Å
77	A	51.5	Low	59.9	Low	76 Å²	76	140.1 Å²	140.1	63%	0.628	78%	0.78	S	S	*	*			trans	-35.2	131	157	0	0	0	0	0	110.7	L75	L75-A77 PolarHBondContact O-N 3.35Å
78	N	55.9	Low	59.8	Low	158 Å²	158	143.1 Å²	143.1	85%	0.845	78%	0.783	S	S	*	*			trans	178.2	59	138.9	-82.6	-16.3	0	0	0	108
79	G	49.2	Very low	59.4	Low	84 Å²	84	143.6 Å²	143.6	87%	0.866	80%	0.802	S	S	*	*			trans	-102.4	82.3	168.2	0	0	0	0	0	109.1
80	S	58.7	Low	59.1	Low	107 Å²	107	146.9 Å²	146.9	75%	0.748	82%	0.815	S	S	*	*			trans	-159.4	100.4	166.2	52.6	0	0	0	0	109.8
81	Y	56.3	Low	58.8	Low	198 Å²	198	145.9 Å²	145.9	78%	0.776	81%	0.812	S	S	*	*				159.5	117.5	105.3	-163.2	-127.3	0	0	0	109.6	H83	Y81-H83 AromaticContact CD1-CD2 3.81Å; Y81-H83 AromaticContact CE1-CD2 3.08Å; Y81-H83 WeakPolarHBondContact CE1-CD2 3.47Å; Y81-H83 AromaticContact CE1-NE2 3.42Å; Y81-H83 WeakPolarHBondContact CE1-NE2 3.22Å; Y81-H83 AromaticContact CZ-CD2 3.48Å; Y81-H83 VanDerWaalsContact CZ-CD2 3.48Å; Y81-H83 AromaticContact CZ-NE2 3.32Å; Y81-H83 VanDerWaalsContact CZ-NE2 3.32Å; Y81-H83 PolarHBondContact OH-NE2 3.21Å
82	S	54.6	Low	58.6	Low	103 Å²	103	145.8 Å²	145.8	72%	0.72	82%	0.818	S	S	*	*			trans	-88.9	120.4	174.6	164.5	0	0	0	0	108.8
83	H	58	Low	58.3	Low	137 Å²	137	147.7 Å²	147.7	63%	0.634	82%	0.823	S	S	*	*			trans	-134	106.1	149.9	-93.9	-66.5	0	0	0	108.9	Y81	Y81-H83 AromaticContact CD1-CD2 3.81Å; Y81-H83 AromaticContact CE1-CD2 3.08Å; Y81-H83 WeakPolarHBondContact CE1-CD2 3.47Å; Y81-H83 AromaticContact CE1-NE2 3.42Å; Y81-H83 WeakPolarHBondContact CE1-NE2 3.22Å; Y81-H83 AromaticContact CZ-CD2 3.48Å; Y81-H83 VanDerWaalsContact CZ-CD2 3.48Å; Y81-H83 AromaticContact CZ-NE2 3.32Å; Y81-H83 VanDerWaalsContact CZ-NE2 3.32Å; Y81-H83 PolarHBondContact OH-NE2 3.21Å
84	K	56.9	Low	58	Low	207 Å²	207	146.7 Å²	146.7	90%	0.9	83%	0.83	S	S	*	*			trans	-105.5	104.5	155.2	-73.5	-170.1	175.7	-169.6	0	106.8
85	S	61.2	Low	57.9	Low	107 Å²	107	146.5 Å²	146.5	75%	0.748	83%	0.831	S	S	*	*			trans	-131.5	89	155.2	68.5	0	0	0	0	107.8
86	S	67.3	Low	57.7	Low	121 Å²	121	145.4 Å²	145.4	85%	0.846	83%	0.831	S	S	*	*			trans	-98.8	89.1	161.6	70.1	0	0	0	0	107.8
87	G	57.7	Low	57.6	Low	82 Å²	82	144.2 Å²	144.2	85%	0.845	83%	0.83	S	S	*	*			trans	-86	113.6	161.8	0	0	0	0	0	107.9
88	R	64.2	Low	58.1	Low	249 Å²	249	149.9 Å²	149.9	94%	0.94	85%	0.846	S	S	*	*			trans	-119.7	101.4	168.9	-158.9	176.6	-177.4	166.4	0.6	105.9
89	L	57.3	Low	58.3	Low	246 Å²	246	149.2 Å²	149.2	100%	1.288	85%	0.847	S	S	*	*			trans	-90.9	0	153.7	-78.7	170.3	0	0	0	107.5

Retrieved 89 of 89 residues in 60.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).