A0A077Z054_TRITR Loading...

BolA domain containing protein

AlphaFold DB , UniProt , Accession A0A077Z054, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 46 aa.

						>A0A077Z054_TRITR|A0A077Z054
MVQRHRLVNNAILAEFNRTLHALSISTSTPQEWKGESHKAVPCHRR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	76.1	Confident	90.5	Very high	176 Å²	176	107.3 Å²	107.3	87%	0.867	55%	0.546	S	S	*	.				0	-64.2	0	-160.8	168.7	-175.5	0	0	112.3	Q3 R4 H5	M1-Q3 VanDerWaalsContact C-N 3.27Å; M1-Q3 PolarHBondContact O-N 3.03Å; M1-Q3 VanDerWaalsContact O-N 3.11Å; M1-R4 WeakPolarHBondContact O-CB 3.18Å; M1-R4 PolarHBondContact O-N 3.5Å; M1-H5 PolarHBondContact O-CD2 3.41Å; M1-H5 PolarHBondContact O-N 3.5Å
2	V	88.2	Confident	90.7	Very high	92 Å²	92	102.7 Å²	102.7	56%	0.558	52%	0.522	S	S	*	.	H	α-helix	trans	-50.5	-40.7	-176.9	179.1	0	0	0	0	114.1	R4 H5 R6	V2-R4 VanDerWaalsContact C-N 3.33Å; V2-R4 PolarHBondContact O-N 3.39Å; V2-H5 PolarHBondContact O-N 3.44Å; V2-R6 HydrophobicContact CG1-CG 4.27Å; V2-R6 WeakPolarHBondContact O-CG 3.21Å; V2-R6 PolarHBondContact O-N 3.02Å
3	Q	91.1	Very high	90.9	Very high	160 Å²	160	101.4 Å²	101.4	75%	0.748	52%	0.517	S	S	*	.	H	α-helix	trans	-60.8	-38	177.9	-72.5	177.3	-26.5	0	0	113.4	M1 R6 L7	M1-Q3 VanDerWaalsContact C-N 3.27Å; M1-Q3 PolarHBondContact O-N 3.03Å; M1-Q3 VanDerWaalsContact O-N 3.11Å; Q3-R6 PolarHBondContact O-N 2.9Å; Q3-L7 PolarHBondContact O-N 3.48Å
4	R	90.4	Very high	91.1	Very high	114 Å²	114	99.1 Å²	99.1	43%	0.43	52%	0.521	S	S	.	.	H	α-helix	trans	-67	-43.6	177.9	-63.3	-175	-178.9	165.6	-2.4	110.7	M1 V2 R6 L7 V8 T27	M1-R4 WeakPolarHBondContact O-CB 3.18Å; M1-R4 PolarHBondContact O-N 3.5Å; V2-R4 VanDerWaalsContact C-N 3.33Å; V2-R4 PolarHBondContact O-N 3.39Å; R4-R6 PolarHBondContact O-N 3.37Å; R4-L7 WeakPolarHBondContact O-CB 3.23Å; R4-L7 PolarHBondContact O-N 2.91Å; R4-V8 PolarHBondContact O-N 3.49Å; R4-T27 HydrophobicContact CB-CG2 4.07Å; R4-T27 WeakPolarHBondContact CB-OG1 3.26Å; R4-T27 WeakPolarHBondContact CD-OG1 3.43Å; R4-T27 PolarHBondContact NH1-O 3.22Å
5	H	91.2	Very high	91.2	Very high	43 Å²	43	98.1 Å²	98.1	20%	0.199	51%	0.512	C	S	.	.	H	α-helix	trans	-62.3	-42.4	174.2	-74.3	-107	0	0	0	111.9	M1 V2 L7 V8 N9 I25	M1-H5 PolarHBondContact O-CD2 3.41Å; M1-H5 PolarHBondContact O-N 3.5Å; V2-H5 PolarHBondContact O-N 3.44Å; H5-L7 VanDerWaalsContact C-N 3.32Å; H5-L7 PolarHBondContact O-N 3.21Å; H5-V8 PolarHBondContact O-N 3.27Å; H5-N9 VanDerWaalsContact O-CB 3.23Å; H5-N9 WeakPolarHBondContact O-CB 3.42Å; H5-N9 PolarHBondContact O-N 3.39Å; H5-N9 PolarHBondContact O-OD1 3.11Å; H5-I25 PolarHBondContact CE1-O 3.29Å; H5-I25 PolarHBondContact NE2-O 3.39Å
6	R	93.1	Very high	91.3	Very high	161 Å²	161	94.9 Å²	94.9	61%	0.608	49%	0.493	S	S	*	.	H	α-helix	trans	-60.5	-41.8	176.7	-74.9	-178.7	-178.1	176.6	1.8	112.1	V2 Q3 R4 N10	V2-R6 HydrophobicContact CG1-CG 4.27Å; V2-R6 WeakPolarHBondContact O-CG 3.21Å; V2-R6 PolarHBondContact O-N 3.02Å; Q3-R6 PolarHBondContact O-N 2.9Å; R4-R6 PolarHBondContact O-N 3.37Å; R6-N10 WeakPolarHBondContact O-CB 3.49Å; R6-N10 PolarHBondContact O-N 2.94Å; R6-N10 PolarHBondContact O-ND2 3.28Å
7	L	93.6	Very high	91.3	Very high	135 Å²	135	97 Å²	97	71%	0.707	51%	0.505	S	S	*	.	H	α-helix	trans	-58.3	-50.3	176.6	-102.9	162.7	0	0	0	111.6	Q3 R4 H5 A11	Q3-L7 PolarHBondContact O-N 3.48Å; R4-L7 WeakPolarHBondContact O-CB 3.23Å; R4-L7 PolarHBondContact O-N 2.91Å; H5-L7 VanDerWaalsContact C-N 3.32Å; H5-L7 PolarHBondContact O-N 3.21Å; L7-A11 PolarHBondContact O-N 3.49Å
8	V	92	Very high	91.3	Very high	52 Å²	52	102.3 Å²	102.3	32%	0.315	52%	0.518	S	S	.	.	H	α-helix	trans	-68.1	-49.9	179.9	-175.6	0	0	0	0	110.6	R4 H5 N10 A11 I12 I25 T27	R4-V8 PolarHBondContact O-N 3.49Å; H5-V8 PolarHBondContact O-N 3.27Å; V8-N10 VanDerWaalsContact C-N 3.29Å; V8-N10 PolarHBondContact O-N 2.8Å; V8-A11 WeakPolarHBondContact O-CA 3.49Å; V8-A11 WeakPolarHBondContact O-CB 3.09Å; V8-A11 PolarHBondContact O-N 3.31Å; V8-I12 HydrophobicContact CG1-CD1 4.49Å; V8-I12 WeakPolarHBondContact O-CG1 3.31Å; V8-I12 PolarHBondContact O-N 3.38Å; V8-I12 VanDerWaalsContact O-N 3.1Å; V8-I25 HydrophobicContact CB-CD1 4.03Å; V8-I25 HydrophobicContact CG1-CD1 3.71Å; V8-I25 HydrophobicContact CG1-CG2 4.49Å; V8-T27 HydrophobicContact CG2-CG2 4.21Å
9	N	92.3	Very high	91.4	Very high	47 Å²	47	102.6 Å²	102.6	25%	0.251	53%	0.525	S	S	.	.	H	α-helix	trans	-59.5	-37.9	-178.3	-71.3	7.6	0	0	0	112.5	H5 A11 I12 L13 F16 I25	H5-N9 VanDerWaalsContact O-CB 3.23Å; H5-N9 WeakPolarHBondContact O-CB 3.42Å; H5-N9 PolarHBondContact O-N 3.39Å; H5-N9 PolarHBondContact O-OD1 3.11Å; N9-A11 VanDerWaalsContact C-N 3.31Å; N9-A11 PolarHBondContact O-N 3.33Å; N9-I12 CarbonylContact O-C 3.4Å; N9-I12 PolarHBondContact O-N 3.43Å; N9-L13 VanDerWaalsContact O-CA 3.31Å; N9-L13 WeakPolarHBondContact O-CA 3.2Å; N9-L13 PolarHBondContact O-N 3.31Å; N9-F16 HydrophobicContact CB-CE2 4.32Å; N9-I25 WeakPolarHBondContact OD1-CD1 3.39Å
10	N	93.8	Very high	91.2	Very high	114 Å²	114	100.8 Å²	100.8	61%	0.61	52%	0.516	S	S	*	.	H	α-helix	trans	-65.8	-35.8	175.3	-76.5	-12.9	0	0	0	111.9	R6 V8 I12	R6-N10 WeakPolarHBondContact O-CB 3.49Å; R6-N10 PolarHBondContact O-N 2.94Å; R6-N10 PolarHBondContact O-ND2 3.28Å; V8-N10 VanDerWaalsContact C-N 3.29Å; V8-N10 PolarHBondContact O-N 2.8Å; N10-I12 VanDerWaalsContact C-N 3.32Å
11	A	93.6	Very high	91.1	Very high	86 Å²	86	105.1 Å²	105.1	71%	0.711	53%	0.534	S	S	*	.	H	α-helix	trans	-68.8	-30.1	176.7	0	0	0	0	0	112.7	L7 V8 N9	L7-A11 PolarHBondContact O-N 3.49Å; V8-A11 WeakPolarHBondContact O-CA 3.49Å; V8-A11 WeakPolarHBondContact O-CB 3.09Å; V8-A11 PolarHBondContact O-N 3.31Å; N9-A11 VanDerWaalsContact C-N 3.31Å; N9-A11 PolarHBondContact O-N 3.33Å
12	I	93	Very high	91.8	Very high	52 Å²	52	100.9 Å²	100.9	27%	0.267	53%	0.527	S	S	.	.	T	Hydrogen-bonded Turn	trans	-110	22.6	179.3	63.2	167.4	0	0	0	113.3	V8 N9 N10 A14 E15 F16 L23	V8-I12 HydrophobicContact CG1-CD1 4.49Å; V8-I12 WeakPolarHBondContact O-CG1 3.31Å; V8-I12 PolarHBondContact O-N 3.38Å; V8-I12 VanDerWaalsContact O-N 3.1Å; N9-I12 CarbonylContact O-C 3.4Å; N9-I12 PolarHBondContact O-N 3.43Å; N10-I12 VanDerWaalsContact C-N 3.32Å; I12-A14 PolarHBondContact O-N 3.05Å; I12-A14 VanDerWaalsContact O-N 3.16Å; I12-E15 WeakPolarHBondContact O-CB 3.38Å; I12-E15 PolarHBondContact O-N 3.24Å; I12-F16 HydrophobicContact CD1-CD2 4.27Å; I12-F16 HydrophobicContact CD1-CE2 3.68Å; I12-F16 HydrophobicContact CG1-CD2 4.11Å; I12-F16 HydrophobicContact CG1-CE2 3.88Å; I12-F16 PolarHBondContact O-N 3.08Å; I12-L23 HydrophobicContact CD1-CD2 3.84Å
13	L	92.8	Very high	91.9	Very high	86 Å²	86	100.5 Å²	100.5	45%	0.45	52%	0.521	S	S	.	.	H	α-helix	trans	-59.5	-33.2	-173.8	-171.7	67	0	0	0	112.3	N9 E15 F16 N17	N9-L13 VanDerWaalsContact O-CA 3.31Å; N9-L13 WeakPolarHBondContact O-CA 3.2Å; N9-L13 PolarHBondContact O-N 3.31Å; L13-E15 VanDerWaalsContact C-N 3.26Å; L13-E15 PolarHBondContact O-N 2.92Å; L13-F16 PolarHBondContact O-N 3.16Å; L13-N17 PolarHBondContact O-N 3.34Å; L13-N17 PolarHBondContact O-ND2 3.31Å
14	A	94.2	Very high	91.7	Very high	70 Å²	70	98.4 Å²	98.4	58%	0.579	52%	0.524	S	S	*	.	H	α-helix	trans	-58.6	-36.6	176	0	0	0	0	0	112.7	I12 N17 R18	I12-A14 PolarHBondContact O-N 3.05Å; I12-A14 VanDerWaalsContact O-N 3.16Å; A14-N17 PolarHBondContact O-N 3.2Å; A14-R18 WeakPolarHBondContact O-CB 3.36Å; A14-R18 PolarHBondContact O-N 3.03Å
15	E	92.8	Very high	91.6	Very high	83 Å²	83	94.2 Å²	94.2	39%	0.388	51%	0.51	S	S	.	.	H	α-helix	trans	-73.8	-35.8	179.5	-60	-56.8	130.2	0	0	111.6	I12 L13 N17 R18 T19 L20	I12-E15 WeakPolarHBondContact O-CB 3.38Å; I12-E15 PolarHBondContact O-N 3.24Å; L13-E15 VanDerWaalsContact C-N 3.26Å; L13-E15 PolarHBondContact O-N 2.92Å; E15-N17 VanDerWaalsContact C-N 3.32Å; E15-N17 PolarHBondContact O-N 3.18Å; E15-R18 PolarHBondContact O-N 3.43Å; E15-T19 PolarHBondContact O-N 3.12Å; E15-L20 HydrophobicContact CB-CD1 3.92Å; E15-L20 PolarHBondContact O-N 2.98Å
16	F	92.4	Very high	91.4	Very high	47 Å²	47	95.6 Å²	95.6	21%	0.206	53%	0.525	C	S	.	.	H	α-helix	trans	-63.2	-38.7	172.3	-83.2	-85.7	0	0	0	112.2	N9 I12 L13 R18 L20 L23	N9-F16 HydrophobicContact CB-CE2 4.32Å; I12-F16 HydrophobicContact CD1-CD2 4.27Å; I12-F16 HydrophobicContact CD1-CE2 3.68Å; I12-F16 HydrophobicContact CG1-CD2 4.11Å; I12-F16 HydrophobicContact CG1-CE2 3.88Å; I12-F16 PolarHBondContact O-N 3.08Å; L13-F16 PolarHBondContact O-N 3.16Å; F16-R18 PolarHBondContact O-N 3.16Å; F16-L20 VanDerWaalsContact CA-O 3.26Å; F16-L20 WeakPolarHBondContact CA-O 3.47Å; F16-L20 HydrophobicContact CD1-CB 4.37Å; F16-L20 WeakPolarHBondContact CD1-O 3.47Å; F16-L20 VanDerWaalsContact O-O 3.14Å; F16-L23 HydrophobicContact CZ-CB 3.92Å
17	N	91.1	Very high	91.2	Very high	131 Å²	131	89.7 Å²	89.7	70%	0.701	51%	0.507	S	S	*	.	H	α-helix	trans	-72.2	-19.4	177.4	-70.6	-23	0	0	0	113.2	L13 A14 E15	L13-N17 PolarHBondContact O-N 3.34Å; L13-N17 PolarHBondContact O-ND2 3.31Å; A14-N17 PolarHBondContact O-N 3.2Å; E15-N17 VanDerWaalsContact C-N 3.32Å; E15-N17 PolarHBondContact O-N 3.18Å
18	R	92.3	Very high	90.9	Very high	193 Å²	193	85.2 Å²	85.2	73%	0.728	49%	0.487	S	S	*	.	H	α-helix	trans	-95.9	-51.1	-174.2	-165	-175.8	166.3	-166	-2.8	112.6	A14 E15 F16	A14-R18 WeakPolarHBondContact O-CB 3.36Å; A14-R18 PolarHBondContact O-N 3.03Å; E15-R18 PolarHBondContact O-N 3.43Å; F16-R18 PolarHBondContact O-N 3.16Å
19	T	91.9	Very high	90.8	Very high	108 Å²	108	85.1 Å²	85.1	66%	0.663	49%	0.486	S	S	*	.	T	Hydrogen-bonded Turn	trans	-150.5	-26.2	-171	50.6	0	0	0	0	114.7	E15	E15-T19 PolarHBondContact O-N 3.12Å
20	L	88.6	Confident	90.7	Very high	66 Å²	66	87.7 Å²	87.7	35%	0.346	51%	0.505	S	S	.	.			trans	-86.9	116.5	-174.4	-73.5	175.1	0	0	0	111.5	E15 F16	E15-L20 HydrophobicContact CB-CD1 3.92Å; E15-L20 PolarHBondContact O-N 2.98Å; F16-L20 VanDerWaalsContact CA-O 3.26Å; F16-L20 WeakPolarHBondContact CA-O 3.47Å; F16-L20 HydrophobicContact CD1-CB 4.37Å; F16-L20 WeakPolarHBondContact CD1-O 3.47Å; F16-L20 VanDerWaalsContact O-O 3.14Å
21	H	87.8	Confident	90.5	Very high	192 Å²	192	89.2 Å²	89.2	89%	0.889	51%	0.509	S	S	*	.	S	Bend	trans	-86.3	-37.2	177.4	-157.3	-166	0	0	0	112.6
22	A	90.7	Very high	90.2	Very high	87 Å²	87	89.6 Å²	89.6	72%	0.719	50%	0.496	S	S	*	.			trans	-152.2	142.6	178	0	0	0	0	0	110.5
23	L	90.4	Very high	89.9	Confident	83 Å²	83	94.4 Å²	94.4	44%	0.435	51%	0.511	S	S	.	.			trans	-135.1	126.1	174.5	-180	63.9	0	0	0	108.9	I12 F16 I25	I12-L23 HydrophobicContact CD1-CD2 3.84Å; F16-L23 HydrophobicContact CZ-CB 3.92Å; L23-I25 HydrophobicContact CB-CG1 4.44Å; L23-I25 HydrophobicContact CD2-CD1 4.02Å; L23-I25 HydrophobicContact CD2-CG1 3.8Å; L23-I25 HydrophobicContact CG-CD1 4.34Å; L23-I25 HydrophobicContact CG-CG1 3.74Å
24	S	87.8	Confident	89.5	Confident	116 Å²	116	99.7 Å²	99.7	81%	0.811	53%	0.53	S	S	*	.			trans	-83.4	124.4	168.6	-169.5	0	0	0	0	108.9
25	I	88.4	Confident	88.4	Confident	27 Å²	27	99.8 Å²	99.8	14%	0.138	54%	0.538	C	S	.	.			trans	-123.5	122.6	-176.1	-52.9	168.3	0	0	0	107.7	H5 V8 N9 L23 T27	H5-I25 PolarHBondContact CE1-O 3.29Å; H5-I25 PolarHBondContact NE2-O 3.39Å; V8-I25 HydrophobicContact CB-CD1 4.03Å; V8-I25 HydrophobicContact CG1-CD1 3.71Å; V8-I25 HydrophobicContact CG1-CG2 4.49Å; N9-I25 WeakPolarHBondContact OD1-CD1 3.39Å; L23-I25 HydrophobicContact CB-CG1 4.44Å; L23-I25 HydrophobicContact CD2-CD1 4.02Å; L23-I25 HydrophobicContact CD2-CG1 3.8Å; L23-I25 HydrophobicContact CG-CD1 4.34Å; L23-I25 HydrophobicContact CG-CG1 3.74Å; I25-T27 HydrophobicContact CG2-CG2 3.81Å
26	S	87.7	Confident	87.1	Confident	72 Å²	72	100 Å²	100	50%	0.503	54%	0.539	S	S	.	.			trans	-92.3	118.1	167.1	-66.9	0	0	0	0	108.9
27	T	87.3	Confident	85.7	Confident	37 Å²	37	101.8 Å²	101.8	23%	0.227	56%	0.558	C	S	.	*			trans	-109.6	108.5	177.7	59	0	0	0	0	110.5	R4 V8 I25	R4-T27 HydrophobicContact CB-CG2 4.07Å; R4-T27 WeakPolarHBondContact CB-OG1 3.26Å; R4-T27 WeakPolarHBondContact CD-OG1 3.43Å; R4-T27 PolarHBondContact NH1-O 3.22Å; V8-T27 HydrophobicContact CG2-CG2 4.21Å; I25-T27 HydrophobicContact CG2-CG2 3.81Å
28	S	88.6	Confident	84.5	Confident	41 Å²	41	100.7 Å²	100.7	29%	0.287	55%	0.548	S	S	.	.			trans	-117.8	147.1	179.1	-48.1	0	0	0	0	110.2	E36	S28-E36 PolarHBondContact OG-OE2 3.12Å
29	T	89.6	Confident	83.2	Confident	50 Å²	50	99.7 Å²	99.7	31%	0.307	55%	0.549	S	S	.	.			trans	-69.4	160	168.7	59.3	0	0	0	0	110.6	Q31 E32 W33	T29-Q31 PolarHBondContact O-N 3.3Å; T29-Q31 VanDerWaalsContact O-N 3.12Å; T29-E32 WeakPolarHBondContact CB-OE2 3.22Å; T29-E32 WeakPolarHBondContact CG2-OE2 3.15Å; T29-E32 PolarHBondContact N-OE2 2.82Å; T29-E32 PolarHBondContact O-N 2.97Å; T29-E32 VanDerWaalsContact O-N 3.08Å; T29-E32 WeakPolarHBondContact OG1-CB 3.37Å; T29-E32 WeakPolarHBondContact OG1-CG 3.38Å; T29-E32 PolarHBondContact OG1-N 3.1Å; T29-E32 PolarHBondContact OG1-OE2 2.72Å; T29-W33 PolarHBondContact O-N 3.3Å
30	P	89.9	Confident	82.3	Confident	100 Å²	100	98.8 Å²	98.8	65%	0.649	55%	0.553	S	S	*	*	H	α-helix	trans	-55.4	-30.9	176.2	-26.6	35.7	0	0	0	113.6
31	Q	89.3	Confident	81.7	Confident	147 Å²	147	102.1 Å²	102.1	69%	0.687	58%	0.575	S	S	*	*	H	α-helix	trans	-71.9	-44.3	176.6	-67.1	79.9	-0.7	0	0	111.9	T29 W33	T29-Q31 PolarHBondContact O-N 3.3Å; T29-Q31 VanDerWaalsContact O-N 3.12Å; Q31-W33 VanDerWaalsContact C-N 3.35Å
32	E	87.9	Confident	81.3	Confident	93 Å²	93	98 Å²	98	44%	0.435	57%	0.566	S	S	.	*	H	α-helix	trans	-65.4	-39.3	177.1	-71.7	162.3	151.2	0	0	111.3	T29 K34 G35	T29-E32 WeakPolarHBondContact CB-OE2 3.22Å; T29-E32 WeakPolarHBondContact CG2-OE2 3.15Å; T29-E32 PolarHBondContact N-OE2 2.82Å; T29-E32 PolarHBondContact O-N 2.97Å; T29-E32 VanDerWaalsContact O-N 3.08Å; T29-E32 WeakPolarHBondContact OG1-CB 3.37Å; T29-E32 WeakPolarHBondContact OG1-CG 3.38Å; T29-E32 PolarHBondContact OG1-N 3.1Å; T29-E32 PolarHBondContact OG1-OE2 2.72Å; E32-K34 PolarHBondContact O-N 2.78Å; E32-G35 PolarHBondContact O-N 3.44Å
33	W	86.6	Confident	80.7	Confident	154 Å²	154	99.7 Å²	99.7	58%	0.583	57%	0.571	S	S	*	*	H	α-helix	trans	-61.7	-27.7	-178.3	-170.7	-94.1	0	0	0	113.8	T29 Q31 G35 E36	T29-W33 PolarHBondContact O-N 3.3Å; Q31-W33 VanDerWaalsContact C-N 3.35Å; W33-G35 PolarHBondContact O-N 3.23Å; W33-E36 PolarHBondContact O-N 3.26Å
34	K	83.8	Confident	80	Confident	196 Å²	196	104 Å²	104	85%	0.852	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.2	-19.1	-178.3	-84.6	-177.9	174.4	-177	0	114	E32	E32-K34 PolarHBondContact O-N 2.78Å
35	G	71.4	Confident	79.3	Confident	73 Å²	73	110.2 Å²	110.2	75%	0.753	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.9	-8.7	-179.4	0	0	0	0	0	115.7	E32 W33	E32-G35 PolarHBondContact O-N 3.44Å; W33-G35 PolarHBondContact O-N 3.23Å
36	E	66	Low	78.6	Confident	86 Å²	86	123.8 Å²	123.8	40%	0.402	64%	0.644	S	S	.	*			trans	-101.7	118.7	-172.4	-88.1	-173.9	124.5	0	0	112.4	S28 W33 H38	S28-E36 PolarHBondContact OG-OE2 3.12Å; W33-E36 PolarHBondContact O-N 3.26Å; E36-H38 IonicContact OE1-CE1 3.44Å; E36-H38 PolarHBondContact OE1-CE1 3.28Å; E36-H38 IonicContact OE1-NE2 3.3Å; E36-H38 PolarHBondContact OE1-NE2 2.92Å; E36-H38 IonicContact OE2-NE2 3.85Å
37	S	63.8	Low	78.1	Confident	86 Å²	86	126.4 Å²	126.4	60%	0.601	65%	0.651	S	S	*	*			trans	-108	93.7	160.8	-172.4	0	0	0	0	107.6	K39	S37-K39 PolarHBondContact O-N 3.08Å; S37-K39 WeakPolarHBondContact OG-CE 3.49Å; S37-K39 WeakPolarHBondContact OG-CG 3.32Å
38	H	64.7	Low	77.7	Confident	108 Å²	108	131.1 Å²	131.1	50%	0.5	67%	0.673	S	S	.	*			trans	-69.1	82.1	170.4	-76.9	-73.5	0	0	0	109.2	E36	E36-H38 IonicContact OE1-CE1 3.44Å; E36-H38 PolarHBondContact OE1-CE1 3.28Å; E36-H38 IonicContact OE1-NE2 3.3Å; E36-H38 PolarHBondContact OE1-NE2 2.92Å; E36-H38 IonicContact OE2-NE2 3.85Å
39	K	65	Low	77.1	Confident	171 Å²	171	136.1 Å²	136.1	74%	0.743	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-81.9	122	172.6	-61.2	-171.6	-177.6	-177.3	0	107.8	S37	S37-K39 PolarHBondContact O-N 3.08Å; S37-K39 WeakPolarHBondContact OG-CE 3.49Å; S37-K39 WeakPolarHBondContact OG-CG 3.32Å
40	A	73.2	Confident	76.3	Confident	90 Å²	90	141.1 Å²	141.1	74%	0.744	72%	0.717	S	S	*	*	P	Polyproline II helix	trans	-53.2	142.5	161.4	0	0	0	0	0	108.3
41	V	76.8	Confident	75.5	Confident	135 Å²	135	143.7 Å²	143.7	82%	0.818	72%	0.722	S	S	*	*	P	Polyproline II helix	trans	-53.2	127.9	178.6	-71.5	0	0	0	0	109.3	C43	V41-C43 PolarHBondContact O-N 3.18Å; V41-C43 VanDerWaalsContact O-N 3.08Å
42	P	77.9	Confident	74.6	Confident	105 Å²	105	143.5 Å²	143.5	68%	0.682	72%	0.724	S	S	*	*	P	Polyproline II helix	trans	-64.1	116.9	-177.6	21.9	-29.8	0	0	0	109.2	H44	P42-H44 PolarHBondContact O-N 3.26Å; P42-H44 VanDerWaalsContact O-N 3.16Å
43	C	79.7	Confident	73.6	Confident	124 Å²	124	147.1 Å²	147.1	84%	0.838	75%	0.745	S	S	*	*			trans	-78.9	95.9	171.9	61.2	0	0	0	0	108.9	V41 R45	V41-C43 PolarHBondContact O-N 3.18Å; V41-C43 VanDerWaalsContact O-N 3.08Å; C43-R45 PolarHBondContact O-N 3.35Å
44	H	75	Confident	72.6	Confident	173 Å²	173	146.5 Å²	146.5	80%	0.801	76%	0.757	S	S	*	*			trans	-77.9	101.4	167	-82.9	-51.6	0	0	0	109.1	P42 R46	P42-H44 PolarHBondContact O-N 3.26Å; P42-H44 VanDerWaalsContact O-N 3.16Å; H44-R46 PolarHBondContact O-N 3.02Å
45	R	73.7	Confident	71.7	Confident	247 Å²	247	142.4 Å²	142.4	93%	0.932	75%	0.749	S	S	*	*			trans	-74	106.4	165.3	-152.5	179.7	-149.1	167.2	5.3	106.9	C43	C43-R45 PolarHBondContact O-N 3.35Å
46	R	72.8	Confident	71.7	Confident	311 Å²	311	148.7 Å²	148.7	100%	1.174	75%	0.749	S	S	*	*			trans	-67.8	0	169.4	-74.8	-169.2	-175.2	-163.2	2.4	110.7	H44	H44-R46 PolarHBondContact O-N 3.02Å

Retrieved 46 of 46 residues in 27 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).