A0A077Z055_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z055, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 123 aa.

						>A0A077Z055_TRITR|A0A077Z055
MNESKKAKPPTDEETIKAAKEFVDKKLIDDEKAVTWALKSTNITVVKGDKLAGQLIIHFDAKIRECPSETQKKMSKMLHFAVKDPKDNCKKNVIDMEAEHPCSLQYSKFSGNSNLFCKMIRGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.5	Very low	55.7	Low	238 Å²	238	143.3 Å²	143.3	100%	1.172	74%	0.739	S	S	*	*				0	118.1	0	-78.1	174.5	169.8	0	0	106.7	E3	M1-E3 PolarHBondContact O-N 3Å
2	N	39	Very low	58.4	Low	169 Å²	169	138 Å²	138	90%	0.904	71%	0.713	S	S	*	*			trans	-59.1	110.3	174.1	-96.6	-23	0	0	0	107.4	S4	N2-S4 VanDerWaalsContact C-N 3.35Å; N2-S4 PolarHBondContact O-N 2.86Å
3	E	42.9	Very low	60.8	Low	184 Å²	184	140.2 Å²	140.2	86%	0.86	72%	0.718	S	S	*	*			trans	-53.1	106.5	167.7	-70.6	-176.8	155.7	0	0	106.3	M1 K5	M1-E3 PolarHBondContact O-N 3Å; E3-K5 VanDerWaalsContact C-N 3.29Å; E3-K5 PolarHBondContact O-N 2.78Å
4	S	47	Very low	63	Low	109 Å²	109	141.4 Å²	141.4	76%	0.762	72%	0.719	S	S	*	*			trans	-58.4	101.9	175.3	35.3	0	0	0	0	105.5	N2 K6	N2-S4 VanDerWaalsContact C-N 3.35Å; N2-S4 PolarHBondContact O-N 2.86Å; S4-K6 PolarHBondContact O-N 3.16Å
5	K	46.5	Very low	64.7	Low	198 Å²	198	136 Å²	136	86%	0.861	70%	0.696	S	S	*	*			trans	-39.7	111.8	174.9	-75.3	-178	177.3	179.2	0	106	E3 A7	E3-K5 VanDerWaalsContact C-N 3.29Å; E3-K5 PolarHBondContact O-N 2.78Å; K5-A7 PolarHBondContact O-N 2.82Å
6	K	46.9	Very low	66.3	Low	204 Å²	204	130.8 Å²	130.8	89%	0.887	67%	0.669	S	S	*	*			trans	-50.7	111.6	175.3	-76.9	-175.2	178.3	-179.9	0	104.6	S4 K8	S4-K6 PolarHBondContact O-N 3.16Å; K6-K8 PolarHBondContact O-N 2.84Å; K6-K8 VanDerWaalsContact O-N 3.16Å
7	A	56.9	Low	67.9	Low	34 Å²	34	130.9 Å²	130.9	28%	0.281	66%	0.664	S	S	.	*	P	Polyproline II helix	trans	-56.4	128.1	177.5	0	0	0	0	0	105.1	K5 V45	K5-A7 PolarHBondContact O-N 2.82Å; A7-V45 HydrophobicContact CB-CG1 4.22Å; A7-V45 HydrophobicContact CB-CG2 4.27Å
8	K	64.7	Low	69.4	Low	191 Å²	191	126.7 Å²	126.7	83%	0.83	65%	0.652	S	S	*	*	P	Polyproline II helix	trans	-53.2	138.5	176.5	-72.5	-176.6	178.8	-179.1	0	107.4	K6	K6-K8 PolarHBondContact O-N 2.84Å; K6-K8 VanDerWaalsContact O-N 3.16Å
9	P	73.2	Confident	70.6	Confident	85 Å²	85	120.4 Å²	120.4	55%	0.552	62%	0.621	S	S	*	*	P	Polyproline II helix	trans	-53.5	143	176.2	21.9	-31.2	0	0	0	109.3	T11 T44	P9-T11 PolarHBondContact O-N 3.33Å; P9-T44 WeakPolarHBondContact CA-O 3.41Å
10	P	77.8	Confident	71.9	Confident	30 Å²	30	117.4 Å²	117.4	20%	0.195	60%	0.603	C	S	.	*	P	Polyproline II helix	trans	-56.5	133.5	174.9	25.8	-33.5	0	0	0	108.6	I16 I43 T44 V46	P10-I16 HydrophobicContact CB-CG1 4.06Å; P10-I16 HydrophobicContact CG-CD1 4.39Å; P10-I16 HydrophobicContact CG-CG1 3.8Å; P10-I16 WeakPolarHBondContact O-CD1 3.19Å; P10-I43 HydrophobicContact CG-CG2 4.3Å; P10-T44 WeakPolarHBondContact CD-O 3.21Å; P10-V46 HydrophobicContact CG-CG2 4.27Å
11	T	82.1	Confident	73	Confident	134 Å²	134	117.3 Å²	117.3	82%	0.822	60%	0.6	S	S	*	*			trans	-101.1	-11.2	178	54.3	0	0	0	0	112.5	P9 E13	P9-T11 PolarHBondContact O-N 3.33Å; T11-E13 PolarHBondContact O-N 3.41Å
12	D	88.5	Confident	75.8	Confident	80 Å²	80	108.8 Å²	108.8	43%	0.428	56%	0.557	S	S	.	*			trans	-79.3	112.2	179.2	-178.8	64.8	0	0	0	110.4	E14 T15 I16	D12-E14 VanDerWaalsContact C-N 3.31Å; D12-E14 PolarHBondContact O-N 2.57Å; D12-T15 PolarHBondContact O-N 3.41Å; D12-T15 WeakPolarHBondContact OD2-CB 3.5Å; D12-T15 PolarHBondContact OD2-N 3.36Å; D12-T15 PolarHBondContact OD2-OG1 2.87Å; D12-I16 WeakPolarHBondContact O-CG1 3.32Å; D12-I16 PolarHBondContact O-N 2.97Å
13	E	89.1	Confident	78.5	Confident	166 Å²	166	100.8 Å²	100.8	78%	0.776	51%	0.514	S	S	*	.	H	α-helix	trans	-63.5	-36.6	-174.7	-66.6	-173.3	172.9	0	0	112.5	T11 I16 K17	T11-E13 PolarHBondContact O-N 3.41Å; E13-I16 PolarHBondContact O-N 2.82Å; E13-K17 WeakPolarHBondContact O-CB 3.5Å; E13-K17 PolarHBondContact O-N 3.08Å
14	E	91.4	Very high	80.9	Confident	158 Å²	158	93.7 Å²	93.7	74%	0.738	48%	0.482	S	S	*	.	H	α-helix	trans	-67.1	-44.3	179.5	-162.2	177.8	-170	0	0	110.8	D12 K17 A18	D12-E14 VanDerWaalsContact C-N 3.31Å; D12-E14 PolarHBondContact O-N 2.57Å; E14-K17 PolarHBondContact O-N 2.84Å; E14-A18 WeakPolarHBondContact O-CB 3.48Å; E14-A18 PolarHBondContact O-N 2.81Å
15	T	88.7	Confident	83.1	Confident	60 Å²	60	95 Å²	95	37%	0.368	47%	0.474	S	S	.	.	H	α-helix	trans	-61.1	-44	172.8	-63.8	0	0	0	0	111.7	D12 A19 V46	D12-T15 PolarHBondContact O-N 3.41Å; D12-T15 WeakPolarHBondContact OD2-CB 3.5Å; D12-T15 PolarHBondContact OD2-N 3.36Å; D12-T15 PolarHBondContact OD2-OG1 2.87Å; T15-A19 WeakPolarHBondContact O-CB 3.41Å; T15-A19 PolarHBondContact O-N 2.92Å; T15-V46 HydrophobicContact CG2-CB 4.37Å; T15-V46 HydrophobicContact CG2-CG1 4.22Å; T15-V46 HydrophobicContact CG2-CG2 4.37Å
16	I	91	Very high	85.2	Confident	52 Å²	52	87.1 Å²	87.1	27%	0.267	44%	0.439	S	S	.	.	H	α-helix	trans	-61	-46.8	177.6	-70.7	162	0	0	0	110.4	P10 D12 E13 A19 K20 I43	P10-I16 HydrophobicContact CB-CG1 4.06Å; P10-I16 HydrophobicContact CG-CD1 4.39Å; P10-I16 HydrophobicContact CG-CG1 3.8Å; P10-I16 WeakPolarHBondContact O-CD1 3.19Å; D12-I16 WeakPolarHBondContact O-CG1 3.32Å; D12-I16 PolarHBondContact O-N 2.97Å; E13-I16 PolarHBondContact O-N 2.82Å; I16-A19 PolarHBondContact O-N 2.74Å; I16-K20 VanDerWaalsContact O-CB 3.26Å; I16-K20 WeakPolarHBondContact O-CB 3.1Å; I16-K20 PolarHBondContact O-N 3.36Å; I16-I43 HydrophobicContact CG2-CB 4.36Å; I16-I43 HydrophobicContact CG2-CG1 4.33Å
17	K	93.9	Very high	87.3	Confident	133 Å²	133	77.7 Å²	77.7	58%	0.578	40%	0.399	S	S	*	.	H	α-helix	trans	-63.1	-48.1	179.9	-174.7	-178.9	175.2	-173.1	0	111.5	E13 E14 A19 K20 E21	E13-K17 WeakPolarHBondContact O-CB 3.5Å; E13-K17 PolarHBondContact O-N 3.08Å; E14-K17 PolarHBondContact O-N 2.84Å; K17-A19 PolarHBondContact O-N 2.85Å; K17-K20 WeakPolarHBondContact O-CB 3.35Å; K17-K20 PolarHBondContact O-N 2.87Å; K17-E21 WeakPolarHBondContact CE-OE1 3.1Å; K17-E21 WeakPolarHBondContact O-CG 3.27Å; K17-E21 PolarHBondContact O-N 2.84Å
18	A	93.4	Very high	88.9	Confident	56 Å²	56	80.6 Å²	80.6	46%	0.463	41%	0.409	S	S	.	.	H	α-helix	trans	-62.6	-42.3	178	0	0	0	0	0	112	E14 K20 E21 F22	E14-A18 WeakPolarHBondContact O-CB 3.48Å; E14-A18 PolarHBondContact O-N 2.81Å; A18-K20 VanDerWaalsContact C-N 3.34Å; A18-K20 PolarHBondContact O-N 2.89Å; A18-E21 PolarHBondContact O-N 2.98Å; A18-F22 VanDerWaalsContact O-CB 3.3Å; A18-F22 WeakPolarHBondContact O-CB 3.49Å; A18-F22 PolarHBondContact O-N 2.88Å
19	A	93.6	Very high	89.9	Confident	7 Å²	7	75.1 Å²	75.1	6%	0.058	39%	0.388	C	S	.	.	H	α-helix	trans	-62.5	-42	175.1	0	0	0	0	0	111.4	T15 I16 K17 F22 V23 I43 V46 I57	T15-A19 WeakPolarHBondContact O-CB 3.41Å; T15-A19 PolarHBondContact O-N 2.92Å; I16-A19 PolarHBondContact O-N 2.74Å; K17-A19 PolarHBondContact O-N 2.85Å; A19-F22 PolarHBondContact O-N 2.89Å; A19-V23 WeakPolarHBondContact O-CB 3.39Å; A19-V23 VanDerWaalsContact O-CG2 3.24Å; A19-V23 WeakPolarHBondContact O-CG2 3.27Å; A19-V23 PolarHBondContact O-N 3.34Å; A19-I43 HydrophobicContact CB-CG1 4.39Å; A19-I43 HydrophobicContact CB-CG2 4.25Å; A19-V46 HydrophobicContact CB-CG2 3.72Å; A19-I57 HydrophobicContact CB-CD1 4.14Å
20	K	95.4	Very high	90.2	Very high	59 Å²	59	72.9 Å²	72.9	26%	0.257	37%	0.372	S	S	.	.	H	α-helix	trans	-62.5	-49.6	177.1	-171.5	180	-179.6	61.8	0	112.1	I16 K17 A18 F22 V23 D24 S40 T41 I43	I16-K20 VanDerWaalsContact O-CB 3.26Å; I16-K20 WeakPolarHBondContact O-CB 3.1Å; I16-K20 PolarHBondContact O-N 3.36Å; K17-K20 WeakPolarHBondContact O-CB 3.35Å; K17-K20 PolarHBondContact O-N 2.87Å; A18-K20 VanDerWaalsContact C-N 3.34Å; A18-K20 PolarHBondContact O-N 2.89Å; K20-F22 VanDerWaalsContact C-N 3.31Å; K20-F22 PolarHBondContact O-N 3.3Å; K20-V23 PolarHBondContact O-N 3.08Å; K20-D24 WeakPolarHBondContact O-CB 3.4Å; K20-D24 PolarHBondContact O-N 2.87Å; K20-S40 WeakPolarHBondContact CG-OG 3.35Å; K20-S40 VanDerWaalsContact NZ-C 3.26Å; K20-S40 PolarHBondContact NZ-O 3.38Å; K20-S40 PolarHBondContact NZ-OG 2.75Å; K20-T41 PolarHBondContact NZ-O 3.4Å; K20-I43 HydrophobicContact CB-CD1 4.36Å; K20-I43 HydrophobicContact CB-CG1 4.15Å
21	E	95.6	Very high	90.2	Very high	117 Å²	117	72.3 Å²	72.3	55%	0.547	37%	0.367	S	S	.	.	H	α-helix	trans	-60.5	-42.3	177.6	-72.8	175.3	-172.8	0	0	111.5	K17 A18 K25	K17-E21 WeakPolarHBondContact CE-OE1 3.1Å; K17-E21 WeakPolarHBondContact O-CG 3.27Å; K17-E21 PolarHBondContact O-N 2.84Å; A18-E21 PolarHBondContact O-N 2.98Å; E21-K25 WeakPolarHBondContact O-CB 3.41Å; E21-K25 PolarHBondContact O-N 2.78Å
22	F	94.6	Very high	89.5	Confident	58 Å²	58	73.2 Å²	73.2	25%	0.254	36%	0.359	S	S	.	.	H	α-helix	trans	-62.7	-47	175.7	179.1	-105.1	0	0	0	112.3	A18 A19 K20 K25 K26 L55 I57 L104 Y106	A18-F22 VanDerWaalsContact O-CB 3.3Å; A18-F22 WeakPolarHBondContact O-CB 3.49Å; A18-F22 PolarHBondContact O-N 2.88Å; A19-F22 PolarHBondContact O-N 2.89Å; K20-F22 VanDerWaalsContact C-N 3.31Å; K20-F22 PolarHBondContact O-N 3.3Å; F22-K25 PolarHBondContact O-N 2.87Å; F22-K26 HydrophobicContact CE1-CG 4.22Å; F22-K26 HydrophobicContact CE2-CG 4.28Å; F22-K26 HydrophobicContact CZ-CG 4.04Å; F22-K26 WeakPolarHBondContact O-CG 3.4Å; F22-K26 PolarHBondContact O-N 2.83Å; F22-L55 HydrophobicContact CD1-CD2 4.3Å; F22-L55 HydrophobicContact CE1-CD2 4.03Å; F22-I57 HydrophobicContact CD1-CD1 3.86Å; F22-I57 HydrophobicContact CE1-CD1 4.4Å; F22-L104 HydrophobicContact CD1-CD2 4.01Å; F22-L104 HydrophobicContact CE1-CD2 3.68Å; F22-Y106 HydrophobicContact CE1-CG 4.22Å; F22-Y106 AromaticContact CZ-CD1 3.92Å; F22-Y106 HydrophobicContact CZ-CD1 3.92Å; F22-Y106 AromaticContact CZ-CD2 3.84Å; F22-Y106 HydrophobicContact CZ-CD2 3.84Å; F22-Y106 HydrophobicContact CZ-CE1 4.29Å; F22-Y106 HydrophobicContact CZ-CE2 4.2Å; F22-Y106 AromaticContact CZ-CG 3.67Å; F22-Y106 HydrophobicContact CZ-CG 3.67Å
23	V	94.9	Very high	88.5	Confident	1 Å²	1	73.6 Å²	73.6	1%	0.006	37%	0.373	C	S	.	.	H	α-helix	trans	-62.8	-49.2	177.5	167.9	0	0	0	0	110.8	A19 K20 K25 K26 L27 I43 I57 F59 L104	A19-V23 WeakPolarHBondContact O-CB 3.39Å; A19-V23 VanDerWaalsContact O-CG2 3.24Å; A19-V23 WeakPolarHBondContact O-CG2 3.27Å; A19-V23 PolarHBondContact O-N 3.34Å; K20-V23 PolarHBondContact O-N 3.08Å; V23-K25 VanDerWaalsContact C-N 3.27Å; V23-K25 PolarHBondContact O-N 2.86Å; V23-K26 CarbonylContact O-C 3.6Å; V23-K26 WeakPolarHBondContact O-CA 3.49Å; V23-K26 PolarHBondContact O-N 2.85Å; V23-L27 HydrophobicContact CG1-CD1 3.95Å; V23-L27 HydrophobicContact CG1-CG 4.06Å; V23-L27 WeakPolarHBondContact O-CG 3.35Å; V23-L27 PolarHBondContact O-N 2.92Å; V23-I43 HydrophobicContact CG2-CD1 4.45Å; V23-I57 HydrophobicContact CG2-CB 4.21Å; V23-I57 HydrophobicContact CG2-CD1 3.78Å; V23-I57 HydrophobicContact CG2-CG2 3.84Å; V23-F59 HydrophobicContact CG1-CD1 4.05Å; V23-F59 HydrophobicContact CG1-CD2 3.8Å; V23-F59 HydrophobicContact CG1-CE1 3.76Å; V23-F59 HydrophobicContact CG1-CE2 3.47Å; V23-F59 VanDerWaalsContact CG1-CE2 3.47Å; V23-F59 HydrophobicContact CG1-CG 4.08Å; V23-F59 HydrophobicContact CG1-CZ 3.44Å; V23-F59 VanDerWaalsContact CG1-CZ 3.44Å; V23-F59 HydrophobicContact CG2-CD1 4.19Å; V23-F59 HydrophobicContact CG2-CE1 4.24Å; V23-L104 HydrophobicContact CG2-CD2 3.91Å
24	D	94.4	Very high	87.6	Confident	36 Å²	36	67.6 Å²	67.6	19%	0.193	35%	0.348	C	S	.	.	H	α-helix	trans	-60.6	-38.4	-178.7	-79.1	-17.3	0	0	0	111.5	K20 L27 I28 S40	K20-D24 WeakPolarHBondContact O-CB 3.4Å; K20-D24 PolarHBondContact O-N 2.87Å; D24-L27 PolarHBondContact O-N 2.96Å; D24-I28 WeakPolarHBondContact O-CG1 3.47Å; D24-I28 PolarHBondContact O-N 2.7Å; D24-S40 VanDerWaalsContact CG-OG 3.22Å; D24-S40 VanDerWaalsContact OD1-CB 3.22Å; D24-S40 WeakPolarHBondContact OD1-CB 3.33Å; D24-S40 PolarHBondContact OD1-N 3.48Å; D24-S40 PolarHBondContact OD1-OG 2.83Å; D24-S40 PolarHBondContact OD2-OG 3.44Å
25	K	92.9	Very high	87	Confident	137 Å²	137	61.4 Å²	61.4	60%	0.596	32%	0.321	S	S	*	.	H	α-helix	trans	-61.7	-46.4	171.8	-176.4	176	179.3	176.4	0	111.8	E21 F22 V23 I28 D29	E21-K25 WeakPolarHBondContact O-CB 3.41Å; E21-K25 PolarHBondContact O-N 2.78Å; F22-K25 PolarHBondContact O-N 2.87Å; V23-K25 VanDerWaalsContact C-N 3.27Å; V23-K25 PolarHBondContact O-N 2.86Å; K25-I28 PolarHBondContact O-N 3.49Å; K25-D29 PolarHBondContact O-N 2.91Å
26	K	91.2	Very high	87	Confident	31 Å²	31	60.6 Å²	60.6	14%	0.135	31%	0.311	C	S	.	.	H	α-helix	trans	-66	-35.5	178.8	-74.2	-60.9	-164.7	166.9	0	113.3	F22 V23 I28 D29 D30 L104 S113	F22-K26 HydrophobicContact CE1-CG 4.22Å; F22-K26 HydrophobicContact CE2-CG 4.28Å; F22-K26 HydrophobicContact CZ-CG 4.04Å; F22-K26 WeakPolarHBondContact O-CG 3.4Å; F22-K26 PolarHBondContact O-N 2.83Å; V23-K26 CarbonylContact O-C 3.6Å; V23-K26 WeakPolarHBondContact O-CA 3.49Å; V23-K26 PolarHBondContact O-N 2.85Å; K26-I28 VanDerWaalsContact C-N 3.29Å; K26-I28 PolarHBondContact O-N 3.44Å; K26-D29 PolarHBondContact O-N 3.1Å; K26-D30 VanDerWaalsContact O-CB 3.3Å; K26-D30 WeakPolarHBondContact O-CB 3.48Å; K26-D30 PolarHBondContact O-N 3Å; K26-L104 HydrophobicContact CB-CD1 4.32Å; K26-L104 HydrophobicContact CB-CD2 4.04Å; K26-L104 HydrophobicContact CG-CD2 4.11Å; K26-S113 PolarHBondContact NZ-OG 2.83Å
27	L	91	Very high	87	Confident	7 Å²	7	58.2 Å²	58.2	4%	0.037	30%	0.299	C	S	.	.	H	α-helix	trans	-62.7	-36.1	174.3	-69.7	177.9	0	0	0	112.2	V23 D24 E31 L38 F59 L115	V23-L27 HydrophobicContact CG1-CD1 3.95Å; V23-L27 HydrophobicContact CG1-CG 4.06Å; V23-L27 WeakPolarHBondContact O-CG 3.35Å; V23-L27 PolarHBondContact O-N 2.92Å; D24-L27 PolarHBondContact O-N 2.96Å; L27-E31 PolarHBondContact O-N 3.22Å; L27-L38 HydrophobicContact CD1-CB 4.1Å; L27-L38 HydrophobicContact CD2-CB 4.11Å; L27-L38 HydrophobicContact CD2-CD1 4.41Å; L27-F59 HydrophobicContact CD1-CE2 4.05Å; L27-F59 HydrophobicContact CD2-CE2 4.28Å; L27-F59 HydrophobicContact CD2-CZ 4.1Å; L27-L115 HydrophobicContact CD2-CD1 3.81Å; L27-L115 HydrophobicContact CD2-CD2 3.51Å; L27-L115 HydrophobicContact CD2-CG 4.32Å
28	I	88.7	Confident	87	Confident	95 Å²	95	52.6 Å²	52.6	49%	0.487	28%	0.275	S	S	.	.	H	α-helix	trans	-70.3	-44.6	174.5	-65.1	164.7	0	0	0	110.6	D24 K25 K26 D30 E31	D24-I28 WeakPolarHBondContact O-CG1 3.47Å; D24-I28 PolarHBondContact O-N 2.7Å; K25-I28 PolarHBondContact O-N 3.49Å; K26-I28 VanDerWaalsContact C-N 3.29Å; K26-I28 PolarHBondContact O-N 3.44Å; I28-D30 VanDerWaalsContact C-N 3.3Å; I28-D30 PolarHBondContact O-N 2.86Å; I28-E31 WeakPolarHBondContact O-CB 3.35Å; I28-E31 PolarHBondContact O-N 3.43Å
29	D	86.2	Confident	87	Confident	75 Å²	75	55.5 Å²	55.5	40%	0.401	28%	0.277	S	S	.	.	H	α-helix	trans	-60.6	-42.1	177.9	-69.1	-22.9	0	0	0	111.3	K25 K26 E31	K25-D29 PolarHBondContact O-N 2.91Å; K26-D29 PolarHBondContact O-N 3.1Å; D29-E31 VanDerWaalsContact C-N 3.34Å
30	D	79.2	Confident	87.1	Confident	38 Å²	38	55.3 Å²	55.3	20%	0.203	28%	0.276	C	S	.	.	H	α-helix	trans	-81.6	-7.7	-179.9	-71.6	-8.2	0	0	0	113.2	K26 I28 K32 A33 L115	K26-D30 VanDerWaalsContact O-CB 3.3Å; K26-D30 WeakPolarHBondContact O-CB 3.48Å; K26-D30 PolarHBondContact O-N 3Å; I28-D30 VanDerWaalsContact C-N 3.3Å; I28-D30 PolarHBondContact O-N 2.86Å; D30-K32 PolarHBondContact O-N 3.5Å; D30-A33 PolarHBondContact O-N 3.47Å; D30-L115 HydrophobicContact CB-CD2 4.15Å; D30-L115 WeakPolarHBondContact OD2-CB 3.42Å
31	E	77.4	Confident	87	Confident	19 Å²	19	54.7 Å²	54.7	9%	0.089	28%	0.277	C	S	.	.	T	Hydrogen-bonded Turn	trans	-52.9	-23.9	173.8	-169.5	-179.4	154	0	0	111.5	L27 I28 D29 A33 A37 S68 E69	L27-E31 PolarHBondContact O-N 3.22Å; I28-E31 WeakPolarHBondContact O-CB 3.35Å; I28-E31 PolarHBondContact O-N 3.43Å; D29-E31 VanDerWaalsContact C-N 3.34Å; E31-A33 PolarHBondContact O-N 2.96Å; E31-A37 HydrophobicContact CG-CB 4.31Å; E31-S68 WeakPolarHBondContact OE1-CB 3.42Å; E31-E69 PolarHBondContact OE1-N 3.19Å
32	K	67.9	Low	86.9	Confident	153 Å²	153	53.1 Å²	53.1	67%	0.665	27%	0.272	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.3	-25.8	174.3	-65.3	176.7	-177	170.6	0	114.3	D30	D30-K32 PolarHBondContact O-N 3.5Å
33	A	67.6	Low	86.9	Confident	87 Å²	87	50.6 Å²	50.6	72%	0.719	26%	0.261	S	S	*	.	T	Hydrogen-bonded Turn	trans	-107.7	-12.7	-175.4	0	0	0	0	0	113.8	D30 E31	D30-A33 PolarHBondContact O-N 3.47Å; E31-A33 PolarHBondContact O-N 2.96Å
34	V	70.2	Confident	86.9	Confident	40 Å²	40	52.5 Å²	52.5	24%	0.242	27%	0.273	C	S	.	.			trans	-112.8	150	-174	-69.3	0	0	0	0	113	W36 S68	V34-W36 VanDerWaalsContact C-N 3.32Å; V34-W36 VanDerWaalsContact CG2-O 3.22Å; V34-W36 WeakPolarHBondContact CG2-O 3.39Å; V34-S68 PolarHBondContact O-OG 2.96Å; V34-S68 VanDerWaalsContact O-OG 3.07Å
35	T	78.4	Confident	86.8	Confident	28 Å²	28	51.5 Å²	51.5	17%	0.172	27%	0.268	C	S	.	.	S	Bend	trans	-71.1	-30.8	179.5	-53.6	0	0	0	0	113	S68 Q71 N88	T35-S68 PolarHBondContact O-N 2.79Å; T35-Q71 HydrophobicContact CG2-CG 4.34Å; T35-N88 HydrophobicContact CG2-CB 3.58Å
36	W	88.7	Confident	86.8	Confident	44 Å²	44	47.1 Å²	47.1	17%	0.167	25%	0.253	C	S	.	.	S	Bend	trans	-111.6	134.5	-174.1	-52.6	-80.9	0	0	0	109.9	V34 L38 I63 C66 N88 I94 M119	V34-W36 VanDerWaalsContact C-N 3.32Å; V34-W36 VanDerWaalsContact CG2-O 3.22Å; V34-W36 WeakPolarHBondContact CG2-O 3.39Å; W36-L38 HydrophobicContact CB-CD2 4.36Å; W36-L38 PolarHBondContact O-N 2.91Å; W36-I63 HydrophobicContact CB-CD1 4.32Å; W36-I63 HydrophobicContact CB-CG1 4.02Å; W36-I63 HydrophobicContact CB-CG2 4.03Å; W36-I63 HydrophobicContact CG-CD1 3.93Å; W36-I63 HydrophobicContact CG-CG1 4.19Å; W36-I63 HydrophobicContact CG-CG2 4.42Å; W36-C66 PolarHBondContact NE1-SG 2.96Å; W36-C66 VanDerWaalsContact NE1-SG 3.38Å; W36-N88 HydrophobicContact CZ2-CB 4.48Å; W36-N88 PolarHBondContact NE1-O 3.35Å; W36-I94 HydrophobicContact CH2-CD1 4.38Å; W36-I94 HydrophobicContact CZ2-CB 4.22Å; W36-I94 HydrophobicContact CZ2-CD1 4.04Å; W36-I94 HydrophobicContact CZ2-CG1 4.11Å; W36-M119 HydrophobicContact CD2-CE 3.94Å; W36-M119 HydrophobicContact CE3-CE 3.66Å; W36-M119 HydrophobicContact CE3-CG 4.21Å; W36-M119 HydrophobicContact CE3-SD 4.27Å; W36-M119 HydrophobicContact CG-CE 4.41Å; W36-M119 HydrophobicContact CH2-CG 4.32Å; W36-M119 HydrophobicContact CZ3-CB 4.47Å; W36-M119 HydrophobicContact CZ3-CE 4.06Å; W36-M119 HydrophobicContact CZ3-CG 3.72Å; W36-M119 HydrophobicContact CZ3-SD 4.38Å
37	A	92.2	Very high	86.8	Confident	2 Å²	2	51 Å²	51	2%	0.017	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.3	116.2	166.9	0	0	0	0	0	108.1	E31 R64 E65	E31-A37 HydrophobicContact CG-CB 4.31Å; A37-R64 PolarHBondContact O-N 3.45Å; A37-E65 HydrophobicContact CB-CB 4.02Å; A37-E65 PolarHBondContact N-O 3.07Å; A37-E65 PolarHBondContact O-N 3.17Å
38	L	93.5	Very high	86.7	Confident	15 Å²	15	53.8 Å²	53.8	8%	0.079	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	153	-178.4	-64.5	176.8	0	0	0	111.1	L27 W36 A61 K62 I63 C117 M119	L27-L38 HydrophobicContact CD1-CB 4.1Å; L27-L38 HydrophobicContact CD2-CB 4.11Å; L27-L38 HydrophobicContact CD2-CD1 4.41Å; W36-L38 HydrophobicContact CB-CD2 4.36Å; W36-L38 PolarHBondContact O-N 2.91Å; L38-A61 HydrophobicContact CB-CB 4.42Å; L38-K62 CarbonylContact C-O 3.44Å; L38-K62 WeakPolarHBondContact CA-O 3.43Å; L38-I63 HydrophobicContact CD2-CG1 3.82Å; L38-C117 HydrophobicContact CD1-CB 4.38Å; L38-C117 VanDerWaalsContact CD1-SG 3.54Å; L38-M119 HydrophobicContact CD2-CE 4.27Å
39	K	94.3	Very high	86.8	Confident	116 Å²	116	53.1 Å²	53.1	50%	0.504	30%	0.297	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.6	132.5	167.9	-174.6	177.5	-178.9	179	0	108.6	A61 K62 R64	K39-A61 CarbonylContact O-C 3.55Å; K39-A61 VanDerWaalsContact O-CA 3.25Å; K39-A61 WeakPolarHBondContact O-CA 3.46Å; K39-A61 WeakPolarHBondContact O-CB 3.25Å; K39-K62 PolarHBondContact N-O 3.33Å; K39-K62 PolarHBondContact O-N 3.27Å; K39-R64 HydrophobicContact CB-CB 4.42Å
40	S	94.9	Very high	86.8	Confident	3 Å²	3	59.5 Å²	59.5	2%	0.021	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.2	145.8	176.5	70.1	0	0	0	0	110.3	K20 D24 D60	K20-S40 WeakPolarHBondContact CG-OG 3.35Å; K20-S40 VanDerWaalsContact NZ-C 3.26Å; K20-S40 PolarHBondContact NZ-O 3.38Å; K20-S40 PolarHBondContact NZ-OG 2.75Å; D24-S40 VanDerWaalsContact CG-OG 3.22Å; D24-S40 VanDerWaalsContact OD1-CB 3.22Å; D24-S40 WeakPolarHBondContact OD1-CB 3.33Å; D24-S40 PolarHBondContact OD1-N 3.48Å; D24-S40 PolarHBondContact OD1-OG 2.83Å; D24-S40 PolarHBondContact OD2-OG 3.44Å; S40-D60 CarbonylContact C-O 3.55Å
41	T	94.2	Very high	87.3	Confident	46 Å²	46	65.4 Å²	65.4	28%	0.282	35%	0.352	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.2	-75	170.1	52.3	0	0	0	0	108.7	K20 D60 K62 E99	K20-T41 PolarHBondContact NZ-O 3.4Å; T41-D60 PolarHBondContact N-O 3.05Å; T41-D60 WeakPolarHBondContact OG1-CB 3.23Å; T41-D60 PolarHBondContact OG1-O 3.38Å; T41-D60 VanDerWaalsContact OG1-O 3.09Å; T41-K62 HydrophobicContact CG2-CB 4.38Å; T41-K62 HydrophobicContact CG2-CD 3.99Å; T41-K62 HydrophobicContact CG2-CG 3.81Å; T41-E99 PolarHBondContact OG1-OE2 2.99Å
42	N	93.5	Very high	87.9	Confident	84 Å²	84	66.4 Å²	66.4	45%	0.449	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	132.2	-172	-176.5	33.5	0	0	0	111.9	F59 D60	N42-F59 CarbonylContact O-C 3.57Å; N42-F59 WeakPolarHBondContact O-CA 3.07Å; N42-F59 WeakPolarHBondContact O-CB 3.4Å; N42-D60 HydrophobicContact CB-CB 4.44Å; N42-D60 PolarHBondContact O-N 3.43Å
43	I	94.2	Very high	89.1	Confident	5 Å²	5	59.5 Å²	59.5	3%	0.026	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.2	114.8	172.4	-55.6	-55.6	0	0	0	108.4	P10 I16 A19 K20 V23 V46 I57 F59	P10-I43 HydrophobicContact CG-CG2 4.3Å; I16-I43 HydrophobicContact CG2-CB 4.36Å; I16-I43 HydrophobicContact CG2-CG1 4.33Å; A19-I43 HydrophobicContact CB-CG1 4.39Å; A19-I43 HydrophobicContact CB-CG2 4.25Å; K20-I43 HydrophobicContact CB-CD1 4.36Å; K20-I43 HydrophobicContact CB-CG1 4.15Å; V23-I43 HydrophobicContact CG2-CD1 4.45Å; I43-V46 HydrophobicContact CG2-CG2 3.51Å; I43-I57 HydrophobicContact CD1-CG2 4.23Å; I43-I57 HydrophobicContact CG2-CG2 3.97Å; I43-F59 HydrophobicContact CD1-CB 3.63Å; I43-F59 HydrophobicContact CD1-CG 4.4Å
44	T	93.4	Very high	90.3	Very high	42 Å²	42	58.5 Å²	58.5	26%	0.258	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.2	-29.4	-175.4	57.5	0	0	0	0	112.7	P9 P10 H58	P9-T44 WeakPolarHBondContact CA-O 3.41Å; P10-T44 WeakPolarHBondContact CD-O 3.21Å; T44-H58 PolarHBondContact N-O 2.75Å; T44-H58 VanDerWaalsContact OG1-C 3.23Å; T44-H58 WeakPolarHBondContact OG1-CB 3.22Å; T44-H58 PolarHBondContact OG1-O 2.83Å; T44-H58 VanDerWaalsContact OG1-O 3.08Å
45	V	93.4	Very high	91.4	Very high	15 Å²	15	58.8 Å²	58.8	9%	0.091	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.9	137	178.8	-179.2	0	0	0	0	109.7	A7 K47 I57 H58	A7-V45 HydrophobicContact CB-CG1 4.22Å; A7-V45 HydrophobicContact CB-CG2 4.27Å; V45-K47 HydrophobicContact CG1-CD 3.82Å; V45-K47 HydrophobicContact CG1-CG 3.69Å; V45-I57 CarbonylContact O-C 3.58Å; V45-I57 VanDerWaalsContact O-CA 3.27Å; V45-I57 WeakPolarHBondContact O-CA 3.08Å; V45-H58 HydrophobicContact CB-CB 3.85Å; V45-H58 HydrophobicContact CG2-CB 4.12Å; V45-H58 PolarHBondContact N-O 2.77Å; V45-H58 VanDerWaalsContact N-O 3.08Å; V45-H58 PolarHBondContact O-N 2.9Å
46	V	93.1	Very high	92.2	Very high	45 Å²	45	60 Å²	60	27%	0.273	32%	0.322	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.8	120	164.9	-177.2	0	0	0	0	107.9	P10 T15 A19 I43 L55 I57	P10-V46 HydrophobicContact CG-CG2 4.27Å; T15-V46 HydrophobicContact CG2-CB 4.37Å; T15-V46 HydrophobicContact CG2-CG1 4.22Å; T15-V46 HydrophobicContact CG2-CG2 4.37Å; A19-V46 HydrophobicContact CB-CG2 3.72Å; I43-V46 HydrophobicContact CG2-CG2 3.51Å; V46-L55 HydrophobicContact CG1-CD1 4.08Å; V46-I57 HydrophobicContact CG2-CG2 4.42Å
47	K	91.7	Very high	92.5	Very high	113 Å²	113	58 Å²	58	49%	0.491	31%	0.314	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.4	123.8	179.3	-74.8	177.2	-179.7	-178.1	0	109.6	V45 L55 I56	V45-K47 HydrophobicContact CG1-CD 3.82Å; V45-K47 HydrophobicContact CG1-CG 3.69Å; K47-L55 CarbonylContact O-C 3.53Å; K47-I56 HydrophobicContact CB-CB 4.48Å; K47-I56 PolarHBondContact N-O 3.01Å; K47-I56 PolarHBondContact O-N 2.77Å
48	G	88.8	Confident	92.7	Very high	64 Å²	64	61.6 Å²	61.6	66%	0.66	33%	0.33	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-124.6	148.7	176.7	0	0	0	0	0	111.9	Q54	G48-Q54 CarbonylContact C-O 3.5Å; G48-Q54 VanDerWaalsContact CA-O 3.27Å; G48-Q54 WeakPolarHBondContact CA-O 3.24Å
49	D	90.1	Very high	92.8	Very high	81 Å²	81	61 Å²	61	43%	0.433	33%	0.327	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	110.5	164	-177	-24.5	0	0	0	107.8	L51 A52 G53 Q54	D49-L51 WeakPolarHBondContact OD1-CA 3.39Å; D49-L51 WeakPolarHBondContact OD1-CB 3.01Å; D49-L51 PolarHBondContact OD1-N 2.92Å; D49-A52 HydrophobicContact CB-CB 3.94Å; D49-A52 VanDerWaalsContact CG-CB 3.47Å; D49-A52 PolarHBondContact OD1-N 3.09Å; D49-A52 WeakPolarHBondContact OD2-CB 3.16Å; D49-G53 CarbonylContact O-C 3.6Å; D49-G53 WeakPolarHBondContact O-CA 3.46Å; D49-G53 PolarHBondContact O-N 3.03Å; D49-Q54 PolarHBondContact N-O 3.43Å; D49-Q54 PolarHBondContact O-N 2.92Å
50	K	86.6	Confident	92.9	Very high	209 Å²	209	57.1 Å²	57.1	91%	0.909	31%	0.312	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.8	-34	-177.6	-171.7	177.1	179.8	-179.9	0	112.2
51	L	89.1	Confident	92.9	Very high	162 Å²	162	57 Å²	57	85%	0.848	31%	0.311	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.6	-45.2	-180	-68.3	174.2	0	0	0	110.3	D49 G53 F109	D49-L51 WeakPolarHBondContact OD1-CA 3.39Å; D49-L51 WeakPolarHBondContact OD1-CB 3.01Å; D49-L51 PolarHBondContact OD1-N 2.92Å; L51-G53 PolarHBondContact O-N 2.79Å; L51-F109 WeakPolarHBondContact O-CZ 3.24Å
52	A	91.1	Very high	92.9	Very high	41 Å²	41	58.8 Å²	58.8	34%	0.339	32%	0.315	S	S	.	.	T	Hydrogen-bonded Turn	trans	-76.2	-9.2	175.3	0	0	0	0	0	113.2	D49 Q54 F109	D49-A52 HydrophobicContact CB-CB 3.94Å; D49-A52 VanDerWaalsContact CG-CB 3.47Å; D49-A52 PolarHBondContact OD1-N 3.09Å; D49-A52 WeakPolarHBondContact OD2-CB 3.16Å; A52-Q54 HydrophobicContact CB-CB 4.46Å; A52-Q54 HydrophobicContact CB-CG 3.99Å; A52-Q54 PolarHBondContact O-N 3.29Å; A52-F109 WeakPolarHBondContact O-CD2 3.41Å; A52-F109 WeakPolarHBondContact O-CE2 3.26Å
53	G	91.7	Very high	92.9	Very high	8 Å²	8	55.5 Å²	55.5	8%	0.082	30%	0.297	C	S	.	.	T	Hydrogen-bonded Turn	trans	60.1	31.9	-177.1	0	0	0	0	0	112.8	D49 L51 S107 K108	D49-G53 CarbonylContact O-C 3.6Å; D49-G53 WeakPolarHBondContact O-CA 3.46Å; D49-G53 PolarHBondContact O-N 3.03Å; L51-G53 PolarHBondContact O-N 2.79Å; G53-S107 CarbonylContact O-C 3.53Å; G53-S107 WeakPolarHBondContact O-CA 3.43Å; G53-K108 WeakPolarHBondContact O-CB 3.17Å; G53-K108 PolarHBondContact O-N 3.47Å
54	Q	93.7	Very high	92.8	Very high	65 Å²	65	62 Å²	62	30%	0.304	32%	0.321	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.6	140.8	-176.4	-67.9	-73.3	-29.5	0	0	110.4	G48 D49 A52 Y106	G48-Q54 CarbonylContact C-O 3.5Å; G48-Q54 VanDerWaalsContact CA-O 3.27Å; G48-Q54 WeakPolarHBondContact CA-O 3.24Å; D49-Q54 PolarHBondContact N-O 3.43Å; D49-Q54 PolarHBondContact O-N 2.92Å; A52-Q54 HydrophobicContact CB-CB 4.46Å; A52-Q54 HydrophobicContact CB-CG 3.99Å; A52-Q54 PolarHBondContact O-N 3.29Å; Q54-Y106 CarbonylContact C-O 3.47Å; Q54-Y106 WeakPolarHBondContact CA-O 3.27Å
55	L	93.2	Very high	92.7	Very high	46 Å²	46	62.9 Å²	62.9	24%	0.241	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.7	127.4	173	177.6	64.4	0	0	0	108.7	F22 V46 K47 I57 Q105 Y106	F22-L55 HydrophobicContact CD1-CD2 4.3Å; F22-L55 HydrophobicContact CE1-CD2 4.03Å; V46-L55 HydrophobicContact CG1-CD1 4.08Å; K47-L55 CarbonylContact O-C 3.53Å; L55-I57 HydrophobicContact CD1-CG1 4.29Å; L55-I57 HydrophobicContact CD2-CD1 4.05Å; L55-I57 HydrophobicContact CD2-CG1 4.43Å; L55-I57 HydrophobicContact CG-CD1 4.26Å; L55-I57 HydrophobicContact CG-CG1 4.09Å; L55-Q105 CarbonylContact O-C 3.54Å; L55-Q105 WeakPolarHBondContact O-CA 3.36Å; L55-Y106 HydrophobicContact CB-CD1 4.32Å; L55-Y106 PolarHBondContact N-O 3.41Å; L55-Y106 PolarHBondContact O-N 2.58Å
56	I	94.5	Very high	92.6	Very high	55 Å²	55	63.4 Å²	63.4	28%	0.282	33%	0.326	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	122.7	176.9	-59.8	169.7	0	0	0	107.5	K47 L104 Q105	K47-I56 HydrophobicContact CB-CB 4.48Å; K47-I56 PolarHBondContact N-O 3.01Å; K47-I56 PolarHBondContact O-N 2.77Å; I56-L104 WeakPolarHBondContact CA-O 3.25Å; I56-Q105 HydrophobicContact CG1-CG 4.03Å
57	I	95.1	Very high	92.5	Very high	1 Å²	1	61.6 Å²	61.6	1%	0.005	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.7	124.8	176.1	-55.2	173.8	0	0	0	108	A19 F22 V23 I43 V45 V46 L55 F59 S103 L104	A19-I57 HydrophobicContact CB-CD1 4.14Å; F22-I57 HydrophobicContact CD1-CD1 3.86Å; F22-I57 HydrophobicContact CE1-CD1 4.4Å; V23-I57 HydrophobicContact CG2-CB 4.21Å; V23-I57 HydrophobicContact CG2-CD1 3.78Å; V23-I57 HydrophobicContact CG2-CG2 3.84Å; I43-I57 HydrophobicContact CD1-CG2 4.23Å; I43-I57 HydrophobicContact CG2-CG2 3.97Å; V45-I57 CarbonylContact O-C 3.58Å; V45-I57 VanDerWaalsContact O-CA 3.27Å; V45-I57 WeakPolarHBondContact O-CA 3.08Å; V46-I57 HydrophobicContact CG2-CG2 4.42Å; L55-I57 HydrophobicContact CD1-CG1 4.29Å; L55-I57 HydrophobicContact CD2-CD1 4.05Å; L55-I57 HydrophobicContact CD2-CG1 4.43Å; L55-I57 HydrophobicContact CG-CD1 4.26Å; L55-I57 HydrophobicContact CG-CG1 4.09Å; I57-F59 HydrophobicContact CG2-CD1 4.17Å; I57-S103 CarbonylContact O-C 3.58Å; I57-S103 WeakPolarHBondContact O-CA 3.45Å; I57-L104 PolarHBondContact N-O 2.91Å; I57-L104 PolarHBondContact O-N 2.83Å
58	H	96.2	Very high	92.5	Very high	78 Å²	78	56.2 Å²	56.2	36%	0.361	29%	0.292	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.9	138.9	165.7	-57.7	176	0	0	0	108.6	T44 V45 C102	T44-H58 PolarHBondContact N-O 2.75Å; T44-H58 VanDerWaalsContact OG1-C 3.23Å; T44-H58 WeakPolarHBondContact OG1-CB 3.22Å; T44-H58 PolarHBondContact OG1-O 2.83Å; T44-H58 VanDerWaalsContact OG1-O 3.08Å; V45-H58 HydrophobicContact CB-CB 3.85Å; V45-H58 HydrophobicContact CG2-CB 4.12Å; V45-H58 PolarHBondContact N-O 2.77Å; V45-H58 VanDerWaalsContact N-O 3.08Å; V45-H58 PolarHBondContact O-N 2.9Å; H58-C102 WeakPolarHBondContact CA-O 3.44Å
59	F	95.6	Very high	92.5	Very high	1 Å²	1	56.8 Å²	56.8	0%	0.004	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.2	160	-175.6	62.3	-79.3	0	0	0	110.2	V23 L27 N42 I43 I57 A61 C102 L104 L115	V23-F59 HydrophobicContact CG1-CD1 4.05Å; V23-F59 HydrophobicContact CG1-CD2 3.8Å; V23-F59 HydrophobicContact CG1-CE1 3.76Å; V23-F59 HydrophobicContact CG1-CE2 3.47Å; V23-F59 VanDerWaalsContact CG1-CE2 3.47Å; V23-F59 HydrophobicContact CG1-CG 4.08Å; V23-F59 HydrophobicContact CG1-CZ 3.44Å; V23-F59 VanDerWaalsContact CG1-CZ 3.44Å; V23-F59 HydrophobicContact CG2-CD1 4.19Å; V23-F59 HydrophobicContact CG2-CE1 4.24Å; L27-F59 HydrophobicContact CD1-CE2 4.05Å; L27-F59 HydrophobicContact CD2-CE2 4.28Å; L27-F59 HydrophobicContact CD2-CZ 4.1Å; N42-F59 CarbonylContact O-C 3.57Å; N42-F59 WeakPolarHBondContact O-CA 3.07Å; N42-F59 WeakPolarHBondContact O-CB 3.4Å; I43-F59 HydrophobicContact CD1-CB 3.63Å; I43-F59 HydrophobicContact CD1-CG 4.4Å; I57-F59 HydrophobicContact CG2-CD1 4.17Å; F59-A61 HydrophobicContact CD2-CB 4.17Å; F59-A61 HydrophobicContact CE2-CB 3.92Å; F59-C102 HydrophobicContact CD1-CB 4.16Å; F59-C102 HydrophobicContact CD2-CB 4Å; F59-C102 HydrophobicContact CE1-CB 3.71Å; F59-C102 HydrophobicContact CE2-CB 3.55Å; F59-C102 HydrophobicContact CG-CB 4.29Å; F59-C102 HydrophobicContact CZ-CB 3.4Å; F59-C102 PolarHBondContact N-O 2.84Å; F59-C102 WeakPolarHBondContact O-CA 3.14Å; F59-C102 PolarHBondContact O-N 3.42Å; F59-C102 VanDerWaalsContact O-O 3.11Å; F59-L104 HydrophobicContact CE1-CB 3.88Å; F59-L115 HydrophobicContact CE1-CD1 4.29Å; F59-L115 HydrophobicContact CZ-CD1 3.77Å
60	D	96.4	Very high	92.3	Very high	36 Å²	36	54.6 Å²	54.6	19%	0.193	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.3	147.2	168.7	-60.7	-49.5	0	0	0	109	S40 T41 N42 E99	S40-D60 CarbonylContact C-O 3.55Å; T41-D60 PolarHBondContact N-O 3.05Å; T41-D60 WeakPolarHBondContact OG1-CB 3.23Å; T41-D60 PolarHBondContact OG1-O 3.38Å; T41-D60 VanDerWaalsContact OG1-O 3.09Å; N42-D60 HydrophobicContact CB-CB 4.44Å; N42-D60 PolarHBondContact O-N 3.43Å; D60-E99 HydrophobicContact CB-CB 4.22Å
61	A	95.5	Very high	92.3	Very high	0 Å²	0	45.9 Å²	45.9	0%	0	23%	0.23	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-138.5	148.6	179.6	0	0	0	0	0	112	L38 K39 F59 H100	L38-A61 HydrophobicContact CB-CB 4.42Å; K39-A61 CarbonylContact O-C 3.55Å; K39-A61 VanDerWaalsContact O-CA 3.25Å; K39-A61 WeakPolarHBondContact O-CA 3.46Å; K39-A61 WeakPolarHBondContact O-CB 3.25Å; F59-A61 HydrophobicContact CD2-CB 4.17Å; F59-A61 HydrophobicContact CE2-CB 3.92Å; A61-H100 PolarHBondContact N-O 2.7Å; A61-H100 PolarHBondContact O-N 2.64Å
62	K	95	Very high	92.3	Very high	84 Å²	84	41 Å²	41	37%	0.365	20%	0.202	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	154.9	171.2	-71.1	-175.8	-178.4	175.3	0	110.7	L38 K39 T41 R64 E99	L38-K62 CarbonylContact C-O 3.44Å; L38-K62 WeakPolarHBondContact CA-O 3.43Å; K39-K62 PolarHBondContact N-O 3.33Å; K39-K62 PolarHBondContact O-N 3.27Å; T41-K62 HydrophobicContact CG2-CB 4.38Å; T41-K62 HydrophobicContact CG2-CD 3.99Å; T41-K62 HydrophobicContact CG2-CG 3.81Å; K62-R64 PolarHBondContact O-N 3.06Å; K62-E99 HydrophobicContact CD-CG 4.26Å; K62-E99 WeakPolarHBondContact CE-OE1 3.49Å; K62-E99 HydrophobicContact CG-CG 3.94Å; K62-E99 IonicContact NZ-OE1 2.64Å; K62-E99 PolarHBondContact NZ-OE1 2.88Å; K62-E99 VanDerWaalsContact NZ-OE1 3.1Å
63	I	93.6	Very high	92.1	Very high	14 Å²	14	45.4 Å²	45.4	7%	0.072	21%	0.213	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-75	110.7	168.7	-61.2	168.5	0	0	0	107.8	W36 L38 E65 C66 I94 M96 H100 M119	W36-I63 HydrophobicContact CB-CD1 4.32Å; W36-I63 HydrophobicContact CB-CG1 4.02Å; W36-I63 HydrophobicContact CB-CG2 4.03Å; W36-I63 HydrophobicContact CG-CD1 3.93Å; W36-I63 HydrophobicContact CG-CG1 4.19Å; W36-I63 HydrophobicContact CG-CG2 4.42Å; L38-I63 HydrophobicContact CD2-CG1 3.82Å; I63-E65 WeakPolarHBondContact CG2-O 3.3Å; I63-C66 HydrophobicContact CG2-CB 4.11Å; I63-I94 HydrophobicContact CD1-CD1 4.38Å; I63-I94 HydrophobicContact CD1-CG1 3.49Å; I63-I94 VanDerWaalsContact CD1-CG1 3.49Å; I63-I94 HydrophobicContact CD1-CG2 4.41Å; I63-M96 HydrophobicContact CB-CE 4.15Å; I63-M96 HydrophobicContact CB-SD 4.21Å; I63-M96 HydrophobicContact CD1-SD 3.75Å; I63-M96 HydrophobicContact CG2-CE 3.44Å; I63-M96 VanDerWaalsContact CG2-CE 3.44Å; I63-M96 HydrophobicContact CG2-SD 3.79Å; I63-H100 WeakPolarHBondContact CD1-NE2 3.49Å; I63-M119 HydrophobicContact CD1-CE 3.94Å; I63-M119 HydrophobicContact CG1-CE 4.17Å
64	R	91.5	Very high	91.8	Very high	142 Å²	142	48.6 Å²	48.6	54%	0.536	23%	0.227	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-72.6	-41.7	172.2	-171.6	-170.8	79.2	-170.9	-0.4	110.3	A37 K39 K62	A37-R64 PolarHBondContact O-N 3.45Å; K39-R64 HydrophobicContact CB-CB 4.42Å; K62-R64 PolarHBondContact O-N 3.06Å
65	E	92.1	Very high	91.5	Very high	60 Å²	60	46.6 Å²	46.6	28%	0.28	22%	0.22	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-151.5	139.6	-174.3	-168.7	172.6	-173.5	0	0	111.4	A37 I63 K72	A37-E65 HydrophobicContact CB-CB 4.02Å; A37-E65 PolarHBondContact N-O 3.07Å; A37-E65 PolarHBondContact O-N 3.17Å; I63-E65 WeakPolarHBondContact CG2-O 3.3Å; E65-K72 IonicContact OE1-NZ 2.7Å; E65-K72 PolarHBondContact OE1-NZ 2.04Å
66	C	90.9	Very high	91.3	Very high	26 Å²	26	52.5 Å²	52.5	18%	0.176	24%	0.244	C	C	.	.	S	Bend	trans	-140.6	130.2	171	-168	0	0	0	0	110.4	W36 I63 C89 M96	W36-C66 PolarHBondContact NE1-SG 2.96Å; W36-C66 VanDerWaalsContact NE1-SG 3.38Å; I63-C66 HydrophobicContact CG2-CB 4.11Å; C66-C89 HydrophobicContact CB-CB 3.71Å; C66-C89 WeakPolarHBondContact CB-SG 3.46Å; C66-C89 WeakPolarHBondContact SG-CA 3.21Å; C66-C89 WeakPolarHBondContact SG-CB 3.47Å; C66-C89 CovalentContact SG-SG 2.02Å; C66-C89 PolarHBondContact SG-SG 3.41Å; C66-M96 HydrophobicContact CB-CE 3.58Å; C66-M96 HydrophobicContact CB-SD 3.84Å
67	P	91.2	Very high	91	Very high	8 Å²	8	57.1 Å²	57.1	5%	0.052	27%	0.266	C	S	.	.	S	Bend	cis	-73	159.4	-5.8	30.8	-35.4	0	0	0	111.6	Q71 K72 P85 K86	P67-Q71 HydrophobicContact CB-CB 4Å; P67-K72 HydrophobicContact CB-CG 4.43Å; P67-K72 HydrophobicContact CG-CD 4.42Å; P67-K72 HydrophobicContact CG-CG 3.67Å; P67-K72 WeakPolarHBondContact O-CE 3.22Å; P67-P85 HydrophobicContact CB-CB 3.68Å; P67-P85 HydrophobicContact CB-CG 4Å; P67-P85 HydrophobicContact CG-CB 4.21Å; P67-P85 HydrophobicContact CG-CG 4Å; P67-K86 HydrophobicContact CG-CG 4.48Å
68	S	91.1	Very high	90.6	Very high	0 Å²	0	60.4 Å²	60.4	0%	0	28%	0.283	C	S	.	.			trans	-60.7	158.5	173.5	75.1	0	0	0	0	111.8	E31 V34 T35 T70 Q71 K72	E31-S68 WeakPolarHBondContact OE1-CB 3.42Å; V34-S68 PolarHBondContact O-OG 2.96Å; V34-S68 VanDerWaalsContact O-OG 3.07Å; T35-S68 PolarHBondContact O-N 2.79Å; S68-T70 PolarHBondContact O-N 2.8Å; S68-Q71 PolarHBondContact O-N 3.43Å; S68-Q71 VanDerWaalsContact O-N 3.1Å; S68-Q71 WeakPolarHBondContact OG-CG 3.18Å; S68-Q71 PolarHBondContact OG-N 3.24Å; S68-K72 WeakPolarHBondContact O-CG 3.41Å; S68-K72 PolarHBondContact O-N 3.31Å
69	E	88.3	Confident	90	Very high	76 Å²	76	63.4 Å²	63.4	36%	0.355	30%	0.297	S	S	.	.	H	α-helix	trans	-63.2	-35.6	-179.5	-80.4	-60.1	127.2	0	0	111.4	E31 K72 K73	E31-E69 PolarHBondContact OE1-N 3.19Å; E69-K72 PolarHBondContact O-N 3.06Å; E69-K72 WeakPolarHBondContact OE1-CD 3.47Å; E69-K72 WeakPolarHBondContact OE1-CE 3.04Å; E69-K72 IonicContact OE1-NZ 2.65Å; E69-K72 PolarHBondContact OE1-NZ 3.36Å; E69-K73 WeakPolarHBondContact O-CG 3.3Å; E69-K73 PolarHBondContact O-N 3.27Å
70	T	86	Confident	89.6	Confident	34 Å²	34	71 Å²	71	21%	0.209	33%	0.331	C	S	.	.	H	α-helix	trans	-61.9	-45.4	172.8	-59.5	0	0	0	0	111.6	S68 K72 K73 M74	S68-T70 PolarHBondContact O-N 2.8Å; T70-K72 PolarHBondContact O-N 3.47Å; T70-K73 PolarHBondContact O-N 2.86Å; T70-M74 HydrophobicContact CG2-CG 4.17Å; T70-M74 HydrophobicContact CG2-SD 3.96Å; T70-M74 WeakPolarHBondContact O-CG 3.4Å; T70-M74 PolarHBondContact O-N 3.28Å
71	Q	86.4	Confident	89.1	Confident	27 Å²	27	72.8 Å²	72.8	13%	0.126	35%	0.351	C	S	.	.	H	α-helix	trans	-63.2	-40	177.7	-75.3	-57.6	-47.7	0	0	112.7	T35 P67 S68 K73 M74 S75 P85	T35-Q71 HydrophobicContact CG2-CG 4.34Å; P67-Q71 HydrophobicContact CB-CB 4Å; S68-Q71 PolarHBondContact O-N 3.43Å; S68-Q71 VanDerWaalsContact O-N 3.1Å; S68-Q71 WeakPolarHBondContact OG-CG 3.18Å; S68-Q71 PolarHBondContact OG-N 3.24Å; Q71-K73 VanDerWaalsContact C-N 3.3Å; Q71-K73 PolarHBondContact O-N 3.32Å; Q71-M74 PolarHBondContact O-N 3.02Å; Q71-S75 VanDerWaalsContact O-CB 3.23Å; Q71-S75 WeakPolarHBondContact O-CB 3.42Å; Q71-S75 PolarHBondContact O-N 3.04Å; Q71-P85 HydrophobicContact CB-CB 4.01Å; Q71-P85 HydrophobicContact CB-CG 4.48Å
72	K	88.7	Confident	88.4	Confident	60 Å²	60	74.9 Å²	74.9	26%	0.261	36%	0.363	S	S	.	.	H	α-helix	trans	-59.6	-43.3	175	-66.8	178.2	-163.4	164.8	0	111.1	E65 P67 S68 E69 T70 K76	E65-K72 IonicContact OE1-NZ 2.7Å; E65-K72 PolarHBondContact OE1-NZ 2.04Å; P67-K72 HydrophobicContact CB-CG 4.43Å; P67-K72 HydrophobicContact CG-CD 4.42Å; P67-K72 HydrophobicContact CG-CG 3.67Å; P67-K72 WeakPolarHBondContact O-CE 3.22Å; S68-K72 WeakPolarHBondContact O-CG 3.41Å; S68-K72 PolarHBondContact O-N 3.31Å; E69-K72 PolarHBondContact O-N 3.06Å; E69-K72 WeakPolarHBondContact OE1-CD 3.47Å; E69-K72 WeakPolarHBondContact OE1-CE 3.04Å; E69-K72 IonicContact OE1-NZ 2.65Å; E69-K72 PolarHBondContact OE1-NZ 3.36Å; T70-K72 PolarHBondContact O-N 3.47Å; K72-K76 WeakPolarHBondContact O-CG 3.3Å; K72-K76 PolarHBondContact O-N 3.3Å; K72-K76 VanDerWaalsContact O-N 3.16Å
73	K	87.8	Confident	87.8	Confident	132 Å²	132	79.3 Å²	79.3	57%	0.574	38%	0.382	S	S	*	.	H	α-helix	trans	-65.6	-48	177.7	-72	173.4	-176.8	174.6	0	111.7	E69 T70 Q71 S75 K76 M77	E69-K73 WeakPolarHBondContact O-CG 3.3Å; E69-K73 PolarHBondContact O-N 3.27Å; T70-K73 PolarHBondContact O-N 2.86Å; Q71-K73 VanDerWaalsContact C-N 3.3Å; Q71-K73 PolarHBondContact O-N 3.32Å; K73-S75 PolarHBondContact O-N 3.26Å; K73-K76 PolarHBondContact O-N 3.13Å; K73-M77 WeakPolarHBondContact O-CG 3.48Å; K73-M77 PolarHBondContact O-N 2.86Å
74	M	85.7	Confident	87.5	Confident	75 Å²	75	82.4 Å²	82.4	37%	0.369	40%	0.399	S	S	.	.	H	α-helix	trans	-61.9	-43.3	178.3	-72.9	-175.7	68.9	0	0	112.1	T70 Q71 K76 M77 L78	T70-M74 HydrophobicContact CG2-CG 4.17Å; T70-M74 HydrophobicContact CG2-SD 3.96Å; T70-M74 WeakPolarHBondContact O-CG 3.4Å; T70-M74 PolarHBondContact O-N 3.28Å; Q71-M74 PolarHBondContact O-N 3.02Å; M74-K76 VanDerWaalsContact C-N 3.3Å; M74-K76 PolarHBondContact O-N 2.78Å; M74-M77 PolarHBondContact O-N 2.92Å; M74-L78 WeakPolarHBondContact O-CB 3.37Å; M74-L78 PolarHBondContact O-N 3.24Å
75	S	87.2	Confident	87.3	Confident	23 Å²	23	75.9 Å²	75.9	16%	0.161	38%	0.375	C	S	.	.	H	α-helix	trans	-61.6	-36.8	177	176.1	0	0	0	0	112.2	Q71 K73 H79 P85	Q71-S75 VanDerWaalsContact O-CB 3.23Å; Q71-S75 WeakPolarHBondContact O-CB 3.42Å; Q71-S75 PolarHBondContact O-N 3.04Å; K73-S75 PolarHBondContact O-N 3.26Å; S75-H79 WeakPolarHBondContact O-CA 3.45Å; S75-H79 WeakPolarHBondContact O-CB 3.36Å; S75-H79 PolarHBondContact O-N 3.13Å; S75-P85 VanDerWaalsContact OG-CD 3.23Å; S75-P85 WeakPolarHBondContact OG-CD 3.37Å
76	K	88	Confident	87.2	Confident	171 Å²	171	79.7 Å²	79.7	74%	0.743	39%	0.391	S	S	*	.	H	α-helix	trans	-67.7	-45.1	173.6	-73	175.4	-178.7	-178.5	0	112.4	K72 K73 M74	K72-K76 WeakPolarHBondContact O-CG 3.3Å; K72-K76 PolarHBondContact O-N 3.3Å; K72-K76 VanDerWaalsContact O-N 3.16Å; K73-K76 PolarHBondContact O-N 3.13Å; M74-K76 VanDerWaalsContact C-N 3.3Å; M74-K76 PolarHBondContact O-N 2.78Å
77	M	88.2	Confident	87.2	Confident	151 Å²	151	81.6 Å²	81.6	74%	0.744	40%	0.399	S	S	*	.	H	α-helix	trans	-71.1	-33.8	-177.4	-69.9	179.2	68.9	0	0	112.9	K73 M74	K73-M77 WeakPolarHBondContact O-CG 3.48Å; K73-M77 PolarHBondContact O-N 2.86Å; M74-M77 PolarHBondContact O-N 2.92Å
78	L	87.7	Confident	87.1	Confident	71 Å²	71	84.1 Å²	84.1	37%	0.372	41%	0.412	S	S	.	.	T	Hydrogen-bonded Turn	trans	-124.9	34.2	-171.1	-58.6	174.5	0	0	0	111.5	M74 F80 A81 V82	M74-L78 WeakPolarHBondContact O-CB 3.37Å; M74-L78 PolarHBondContact O-N 3.24Å; L78-F80 HydrophobicContact CD2-CE1 4.44Å; L78-F80 HydrophobicContact CD2-CZ 4.11Å; L78-F80 PolarHBondContact O-N 3.24Å; L78-A81 PolarHBondContact O-N 3.38Å; L78-V82 HydrophobicContact CB-CG2 3.74Å; L78-V82 HydrophobicContact CD1-CG2 4.41Å; L78-V82 PolarHBondContact O-N 3.38Å
79	H	84.1	Confident	87.1	Confident	141 Å²	141	85.4 Å²	85.4	65%	0.653	42%	0.421	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.2	-24.1	-173.6	79.3	71.1	0	0	0	113.6	S75	S75-H79 WeakPolarHBondContact O-CA 3.45Å; S75-H79 WeakPolarHBondContact O-CB 3.36Å; S75-H79 PolarHBondContact O-N 3.13Å
80	F	86.7	Confident	87.3	Confident	160 Å²	160	86.6 Å²	86.6	70%	0.702	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.4	-18.2	179.5	58.7	-92.3	0	0	0	113.1	L78	L78-F80 HydrophobicContact CD2-CE1 4.44Å; L78-F80 HydrophobicContact CD2-CZ 4.11Å; L78-F80 PolarHBondContact O-N 3.24Å
81	A	86	Confident	87.5	Confident	74 Å²	74	93.1 Å²	93.1	61%	0.612	45%	0.45	S	S	*	.	T	Hydrogen-bonded Turn	trans	-116.8	-19	-176.2	0	0	0	0	0	113.3	L78	L78-A81 PolarHBondContact O-N 3.38Å
82	V	81.2	Confident	87.8	Confident	44 Å²	44	96.5 Å²	96.5	27%	0.267	47%	0.469	S	S	.	.	S	Bend	trans	-114.7	130.8	-176.2	-172.7	0	0	0	0	109.5	L78	L78-V82 HydrophobicContact CB-CG2 3.74Å; L78-V82 HydrophobicContact CD1-CG2 4.41Å; L78-V82 PolarHBondContact O-N 3.38Å
83	K	81.6	Confident	87.9	Confident	177 Å²	177	95.3 Å²	95.3	77%	0.77	47%	0.467	S	S	*	.			trans	-59.5	158.5	173.6	-67	-174.8	177.9	-177.7	0	111.1	P85	K83-P85 VanDerWaalsContact O-CD 3.25Å; K83-P85 WeakPolarHBondContact O-CD 3.12Å
84	D	87	Confident	88.2	Confident	79 Å²	79	89.2 Å²	89.2	42%	0.422	44%	0.441	S	S	.	.			trans	-58.7	116	172.7	-174.6	-15	0	0	0	109	K86 D87	D84-K86 PolarHBondContact O-N 3.02Å; D84-K86 VanDerWaalsContact O-N 3.12Å; D84-K86 VanDerWaalsContact OD1-CB 3.24Å; D84-K86 WeakPolarHBondContact OD1-CB 3.5Å; D84-K86 WeakPolarHBondContact OD1-CG 3.29Å; D84-K86 PolarHBondContact OD1-N 2.92Å; D84-D87 WeakPolarHBondContact O-CB 3.22Å; D84-D87 PolarHBondContact O-N 3.42Å
85	P	88.3	Confident	88.6	Confident	5 Å²	5	88.2 Å²	88.2	3%	0.032	44%	0.437	C	S	.	.	G	3₁₀ helix	trans	-65.8	-17.5	-176.6	30.2	-38.6	0	0	0	112.1	P67 Q71 S75 K83 D87 N88 C89	P67-P85 HydrophobicContact CB-CB 3.68Å; P67-P85 HydrophobicContact CB-CG 4Å; P67-P85 HydrophobicContact CG-CB 4.21Å; P67-P85 HydrophobicContact CG-CG 4Å; Q71-P85 HydrophobicContact CB-CB 4.01Å; Q71-P85 HydrophobicContact CB-CG 4.48Å; S75-P85 VanDerWaalsContact OG-CD 3.23Å; S75-P85 WeakPolarHBondContact OG-CD 3.37Å; K83-P85 VanDerWaalsContact O-CD 3.25Å; K83-P85 WeakPolarHBondContact O-CD 3.12Å; P85-D87 PolarHBondContact O-N 3.05Å; P85-N88 PolarHBondContact O-N 3.36Å; P85-N88 VanDerWaalsContact O-N 3.17Å; P85-C89 PolarHBondContact O-SG 3.22Å; P85-C89 VanDerWaalsContact O-SG 3.42Å
86	K	89.9	Confident	88.7	Confident	139 Å²	139	90.1 Å²	90.1	60%	0.604	44%	0.444	S	S	*	.	G	3₁₀ helix	trans	-62.9	-24.1	171.6	-66.5	-179.9	176.4	-179.8	0	113.1	P67 D84 N88 C89	P67-K86 HydrophobicContact CG-CG 4.48Å; D84-K86 PolarHBondContact O-N 3.02Å; D84-K86 VanDerWaalsContact O-N 3.12Å; D84-K86 VanDerWaalsContact OD1-CB 3.24Å; D84-K86 WeakPolarHBondContact OD1-CB 3.5Å; D84-K86 WeakPolarHBondContact OD1-CG 3.29Å; D84-K86 PolarHBondContact OD1-N 2.92Å; K86-N88 PolarHBondContact O-N 2.82Å; K86-C89 WeakPolarHBondContact O-CB 3.24Å; K86-C89 PolarHBondContact O-N 3.29Å
87	D	90.4	Very high	88.9	Confident	66 Å²	66	89.7 Å²	89.7	35%	0.353	45%	0.445	S	S	.	.	G	3₁₀ helix	trans	-62	-30.9	175.5	-75.2	-29.3	0	0	0	112	D84 P85 C89 K90	D84-D87 WeakPolarHBondContact O-CB 3.22Å; D84-D87 PolarHBondContact O-N 3.42Å; P85-D87 PolarHBondContact O-N 3.05Å; D87-C89 PolarHBondContact O-N 2.92Å; D87-K90 WeakPolarHBondContact OD1-CE 3.36Å; D87-K90 IonicContact OD1-NZ 3.1Å; D87-K90 PolarHBondContact OD1-NZ 2.99Å
88	N	89	Confident	89.2	Confident	62 Å²	62	83.3 Å²	83.3	33%	0.332	42%	0.416	S	S	.	.	G	3₁₀ helix	trans	-79.6	-5	176.1	-61.4	-47.8	0	0	0	113.6	T35 W36 P85 K86 I94	T35-N88 HydrophobicContact CG2-CB 3.58Å; W36-N88 HydrophobicContact CZ2-CB 4.48Å; W36-N88 PolarHBondContact NE1-O 3.35Å; P85-N88 PolarHBondContact O-N 3.36Å; P85-N88 VanDerWaalsContact O-N 3.17Å; K86-N88 PolarHBondContact O-N 2.82Å; N88-I94 VanDerWaalsContact O-CG2 3.29Å; N88-I94 WeakPolarHBondContact O-CG2 3.22Å
89	C	91	Very high	89.6	Confident	27 Å²	27	83.8 Å²	83.8	18%	0.182	42%	0.416	C	S	.	.	G	3₁₀ helix	trans	-103.5	2.7	-179	-50.2	0	0	0	0	112.8	C66 P85 K86 D87	C66-C89 HydrophobicContact CB-CB 3.71Å; C66-C89 WeakPolarHBondContact CB-SG 3.46Å; C66-C89 WeakPolarHBondContact SG-CA 3.21Å; C66-C89 WeakPolarHBondContact SG-CB 3.47Å; C66-C89 CovalentContact SG-SG 2.02Å; C66-C89 PolarHBondContact SG-SG 3.41Å; P85-C89 PolarHBondContact O-SG 3.22Å; P85-C89 VanDerWaalsContact O-SG 3.42Å; K86-C89 WeakPolarHBondContact O-CB 3.24Å; K86-C89 PolarHBondContact O-N 3.29Å; D87-C89 PolarHBondContact O-N 2.92Å
90	K	91.7	Very high	90	Very high	101 Å²	101	77 Å²	77	44%	0.439	39%	0.385	S	S	.	.	S	Bend	trans	-70.6	143.8	179.4	-64.5	176.5	179.6	164.5	0	110.2	D87 N92 V93 I94	D87-K90 WeakPolarHBondContact OD1-CE 3.36Å; D87-K90 IonicContact OD1-NZ 3.1Å; D87-K90 PolarHBondContact OD1-NZ 2.99Å; K90-N92 VanDerWaalsContact CB-OD1 3.24Å; K90-N92 WeakPolarHBondContact CB-OD1 3Å; K90-N92 PolarHBondContact O-N 3.17Å; K90-N92 VanDerWaalsContact O-N 3.13Å; K90-V93 HydrophobicContact CB-CB 4.5Å; K90-V93 HydrophobicContact CB-CG2 4.11Å; K90-V93 WeakPolarHBondContact O-CA 3.4Å; K90-V93 WeakPolarHBondContact O-CB 3.42Å; K90-V93 PolarHBondContact O-N 3.29Å; K90-I94 PolarHBondContact O-N 2.88Å; K90-I94 VanDerWaalsContact O-N 3.13Å
91	K	90.7	Very high	90.5	Very high	170 Å²	170	72.3 Å²	72.3	74%	0.739	37%	0.37	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.6	-28.5	-178	-68.1	-171.1	175.8	-170.8	0	114.1	V93 G122	K91-V93 VanDerWaalsContact C-N 3.34Å; K91-G122 CarbonylContact O-C 3.41Å; K91-G122 WeakPolarHBondContact O-CA 3.08Å
92	N	92.4	Very high	90.9	Very high	98 Å²	98	69.1 Å²	69.1	52%	0.524	34%	0.344	S	S	.	.	T	Hydrogen-bonded Turn	trans	-84.6	-8.2	176.7	67.1	-51.3	0	0	0	113.4	K90	K90-N92 VanDerWaalsContact CB-OD1 3.24Å; K90-N92 WeakPolarHBondContact CB-OD1 3Å; K90-N92 PolarHBondContact O-N 3.17Å; K90-N92 VanDerWaalsContact O-N 3.13Å
93	V	92	Very high	91.6	Very high	36 Å²	36	68.7 Å²	68.7	22%	0.218	34%	0.343	C	S	.	.	T	Hydrogen-bonded Turn	trans	-96.6	-46.5	178.6	176.4	0	0	0	0	110.1	K90 K91 R121	K90-V93 HydrophobicContact CB-CB 4.5Å; K90-V93 HydrophobicContact CB-CG2 4.11Å; K90-V93 WeakPolarHBondContact O-CA 3.4Å; K90-V93 WeakPolarHBondContact O-CB 3.42Å; K90-V93 PolarHBondContact O-N 3.29Å; K91-V93 VanDerWaalsContact C-N 3.34Å; V93-R121 WeakPolarHBondContact O-CA 3.37Å
94	I	92.7	Very high	92.2	Very high	3 Å²	3	60.4 Å²	60.4	2%	0.015	31%	0.307	C	S	.	.			trans	-138.5	139.1	-176.1	-166.6	71	0	0	0	110.6	W36 I63 N88 K90 M96 M119 I120 G122	W36-I94 HydrophobicContact CH2-CD1 4.38Å; W36-I94 HydrophobicContact CZ2-CB 4.22Å; W36-I94 HydrophobicContact CZ2-CD1 4.04Å; W36-I94 HydrophobicContact CZ2-CG1 4.11Å; I63-I94 HydrophobicContact CD1-CD1 4.38Å; I63-I94 HydrophobicContact CD1-CG1 3.49Å; I63-I94 VanDerWaalsContact CD1-CG1 3.49Å; I63-I94 HydrophobicContact CD1-CG2 4.41Å; N88-I94 VanDerWaalsContact O-CG2 3.29Å; N88-I94 WeakPolarHBondContact O-CG2 3.22Å; K90-I94 PolarHBondContact O-N 2.88Å; K90-I94 VanDerWaalsContact O-N 3.13Å; I94-M96 HydrophobicContact CG2-CG 4.08Å; I94-M96 HydrophobicContact CG2-SD 3.74Å; I94-M96 PolarHBondContact O-N 3.07Å; I94-M119 HydrophobicContact CD1-CB 3.74Å; I94-M119 HydrophobicContact CD1-CE 3.81Å; I94-M119 HydrophobicContact CG1-CE 4.38Å; I94-I120 WeakPolarHBondContact CD1-O 3.06Å; I94-G122 VanDerWaalsContact C-N 3.33Å
95	D	94.4	Very high	92.6	Very high	54 Å²	54	60.9 Å²	60.9	29%	0.289	31%	0.306	S	S	.	.			trans	-81.7	101.5	171.3	-169.3	-25.4	0	0	0	108.6	E97 A98 H100 I120 G122	D95-E97 PolarHBondContact O-N 3.24Å; D95-E97 PolarHBondContact OD1-N 3.33Å; D95-A98 HydrophobicContact CB-CB 3.76Å; D95-A98 VanDerWaalsContact CG-CB 3.42Å; D95-A98 PolarHBondContact OD1-N 2.02Å; D95-H100 PolarHBondContact O-CE1 2.65Å; D95-H100 PolarHBondContact O-NE2 3.3Å; D95-I120 HydrophobicContact CB-CG2 4.15Å; D95-I120 PolarHBondContact N-O 3.03Å; D95-G122 VanDerWaalsContact N-N 3.16Å
96	M	90.4	Very high	92.8	Very high	63 Å²	63	63 Å²	63	31%	0.31	31%	0.314	S	S	.	.	S	Bend	trans	-70.5	-17.5	-177.4	-68.2	-70.4	-64.4	0	0	113.4	I63 C66 I94	I63-M96 HydrophobicContact CB-CE 4.15Å; I63-M96 HydrophobicContact CB-SD 4.21Å; I63-M96 HydrophobicContact CD1-SD 3.75Å; I63-M96 HydrophobicContact CG2-CE 3.44Å; I63-M96 VanDerWaalsContact CG2-CE 3.44Å; I63-M96 HydrophobicContact CG2-SD 3.79Å; C66-M96 HydrophobicContact CB-CE 3.58Å; C66-M96 HydrophobicContact CB-SD 3.84Å; I94-M96 HydrophobicContact CG2-CG 4.08Å; I94-M96 HydrophobicContact CG2-SD 3.74Å; I94-M96 PolarHBondContact O-N 3.07Å
97	E	91.8	Very high	93	Very high	163 Å²	163	57.4 Å²	57.4	76%	0.762	29%	0.292	S	S	*	.	S	Bend	trans	-101.2	-19.1	-175.8	-64.5	-178.7	-175.5	0	0	112.3	D95	D95-E97 PolarHBondContact O-N 3.24Å; D95-E97 PolarHBondContact OD1-N 3.33Å
98	A	94.1	Very high	93	Very high	17 Å²	17	61.7 Å²	61.7	14%	0.14	31%	0.308	C	S	.	.	S	Bend	trans	-66	153.3	179.5	0	0	0	0	0	113.6	D95 I120	D95-A98 HydrophobicContact CB-CB 3.76Å; D95-A98 VanDerWaalsContact CG-CB 3.42Å; D95-A98 PolarHBondContact OD1-N 2.02Å; A98-I120 HydrophobicContact CB-CB 4.22Å; A98-I120 HydrophobicContact CB-CD1 3.91Å; A98-I120 HydrophobicContact CB-CG2 4.33Å
99	E	95.5	Very high	93.1	Very high	80 Å²	80	66 Å²	66	37%	0.374	32%	0.324	S	S	.	.			trans	-88.8	113.7	166.1	-68.4	-163.7	-166.9	0	0	109.2	T41 D60 K62 P101 I120	T41-E99 PolarHBondContact OG1-OE2 2.99Å; D60-E99 HydrophobicContact CB-CB 4.22Å; K62-E99 HydrophobicContact CD-CG 4.26Å; K62-E99 WeakPolarHBondContact CE-OE1 3.49Å; K62-E99 HydrophobicContact CG-CG 3.94Å; K62-E99 IonicContact NZ-OE1 2.64Å; K62-E99 PolarHBondContact NZ-OE1 2.88Å; K62-E99 VanDerWaalsContact NZ-OE1 3.1Å; E99-P101 WeakPolarHBondContact O-CD 3.42Å; E99-I120 VanDerWaalsContact O-CD1 3.23Å; E99-I120 WeakPolarHBondContact O-CD1 3.44Å
100	H	94.1	Very high	93.2	Very high	0 Å²	0	67.9 Å²	67.9	0%	0	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.8	120.1	-179.6	-55.5	-55.4	0	0	0	110.2	A61 I63 D95 C102 M119 I120	A61-H100 PolarHBondContact N-O 2.7Å; A61-H100 PolarHBondContact O-N 2.64Å; I63-H100 WeakPolarHBondContact CD1-NE2 3.49Å; D95-H100 PolarHBondContact O-CE1 2.65Å; D95-H100 PolarHBondContact O-NE2 3.3Å; H100-C102 PolarHBondContact O-N 3.12Å; H100-C102 PolarHBondContact O-SG 3.4Å; H100-M119 HydrophobicContact CB-SD 4.28Å; H100-M119 VanDerWaalsContact CD2-CE 3.45Å; H100-M119 WeakPolarHBondContact CD2-CE 3.35Å; H100-I120 PolarHBondContact CE1-N 2.88Å; H100-I120 PolarHBondContact ND1-N 3.16Å
101	P	96.2	Very high	92.9	Very high	60 Å²	60	64.6 Å²	64.6	39%	0.39	33%	0.332	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.7	130.2	175	-20.6	33.2	0	0	0	110.6	E99 K118	E99-P101 WeakPolarHBondContact O-CD 3.42Å; P101-K118 PolarHBondContact O-N 3Å
102	C	95.2	Very high	92.9	Very high	8 Å²	8	61.6 Å²	61.6	5%	0.054	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130	158	-177.2	-63.4	0	0	0	0	111.8	H58 F59 H100 F116 C117	H58-C102 WeakPolarHBondContact CA-O 3.44Å; F59-C102 HydrophobicContact CD1-CB 4.16Å; F59-C102 HydrophobicContact CD2-CB 4Å; F59-C102 HydrophobicContact CE1-CB 3.71Å; F59-C102 HydrophobicContact CE2-CB 3.55Å; F59-C102 HydrophobicContact CG-CB 4.29Å; F59-C102 HydrophobicContact CZ-CB 3.4Å; F59-C102 PolarHBondContact N-O 2.84Å; F59-C102 WeakPolarHBondContact O-CA 3.14Å; F59-C102 PolarHBondContact O-N 3.42Å; F59-C102 VanDerWaalsContact O-O 3.11Å; H100-C102 PolarHBondContact O-N 3.12Å; H100-C102 PolarHBondContact O-SG 3.4Å; C102-F116 CarbonylContact C-O 3.58Å; C102-F116 WeakPolarHBondContact CA-O 3.35Å; C102-C117 HydrophobicContact CB-CB 4.13Å; C102-C117 WeakPolarHBondContact CB-SG 3.25Å; C102-C117 WeakPolarHBondContact SG-CB 3.14Å; C102-C117 CovalentContact SG-SG 2.04Å; C102-C117 PolarHBondContact SG-SG 3.38Å
103	S	95.1	Very high	92.7	Very high	35 Å²	35	57.9 Å²	57.9	25%	0.245	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134	131.5	171.1	60.8	0	0	0	0	109.8	I57 F116	I57-S103 CarbonylContact O-C 3.58Å; I57-S103 WeakPolarHBondContact O-CA 3.45Å; S103-F116 PolarHBondContact N-O 3.24Å; S103-F116 PolarHBondContact O-N 3.43Å
104	L	94.3	Very high	92.7	Very high	3 Å²	3	61.7 Å²	61.7	2%	0.016	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	119.2	171.1	-179.3	72.4	0	0	0	108.2	F22 V23 K26 I56 I57 F59 L115	F22-L104 HydrophobicContact CD1-CD2 4.01Å; F22-L104 HydrophobicContact CE1-CD2 3.68Å; V23-L104 HydrophobicContact CG2-CD2 3.91Å; K26-L104 HydrophobicContact CB-CD1 4.32Å; K26-L104 HydrophobicContact CB-CD2 4.04Å; K26-L104 HydrophobicContact CG-CD2 4.11Å; I56-L104 WeakPolarHBondContact CA-O 3.25Å; I57-L104 PolarHBondContact N-O 2.91Å; I57-L104 PolarHBondContact O-N 2.83Å; F59-L104 HydrophobicContact CE1-CB 3.88Å; L104-L115 HydrophobicContact CD1-CB 4.26Å; L104-L115 HydrophobicContact CD1-CD1 4.37Å
105	Q	94.4	Very high	92.6	Very high	88 Å²	88	63.6 Å²	63.6	41%	0.411	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	119.9	171.2	-173.3	172	17.4	0	0	109	L55 I56 S113 N114	L55-Q105 CarbonylContact O-C 3.54Å; L55-Q105 WeakPolarHBondContact O-CA 3.36Å; I56-Q105 HydrophobicContact CG1-CG 4.03Å; Q105-S113 CarbonylContact O-C 3.58Å; Q105-S113 VanDerWaalsContact O-CA 3.27Å; Q105-S113 WeakPolarHBondContact O-CA 3.23Å; Q105-N114 PolarHBondContact N-O 3.1Å; Q105-N114 PolarHBondContact O-N 2.87Å
106	Y	93.7	Very high	92.5	Very high	51 Å²	51	67.5 Å²	67.5	20%	0.2	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	135.1	-176.9	173.2	-103	0	0	0	110.8	F22 Q54 L55 K108 G111 N112	F22-Y106 HydrophobicContact CE1-CG 4.22Å; F22-Y106 AromaticContact CZ-CD1 3.92Å; F22-Y106 HydrophobicContact CZ-CD1 3.92Å; F22-Y106 AromaticContact CZ-CD2 3.84Å; F22-Y106 HydrophobicContact CZ-CD2 3.84Å; F22-Y106 HydrophobicContact CZ-CE1 4.29Å; F22-Y106 HydrophobicContact CZ-CE2 4.2Å; F22-Y106 AromaticContact CZ-CG 3.67Å; F22-Y106 HydrophobicContact CZ-CG 3.67Å; Q54-Y106 CarbonylContact C-O 3.47Å; Q54-Y106 WeakPolarHBondContact CA-O 3.27Å; L55-Y106 HydrophobicContact CB-CD1 4.32Å; L55-Y106 PolarHBondContact N-O 3.41Å; L55-Y106 PolarHBondContact O-N 2.58Å; Y106-K108 HydrophobicContact CE1-CB 4.15Å; Y106-G111 WeakPolarHBondContact CE2-O 3.41Å; Y106-N112 VanDerWaalsContact CD2-O 3.3Å; Y106-N112 WeakPolarHBondContact CD2-O 3.37Å
107	S	93.8	Very high	92.6	Very high	21 Å²	21	65.5 Å²	65.5	15%	0.147	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	115.2	173.7	171.7	0	0	0	0	109.5	G53 F109 S110 G111 N112	G53-S107 CarbonylContact O-C 3.53Å; G53-S107 WeakPolarHBondContact O-CA 3.43Å; S107-F109 VanDerWaalsContact C-N 3.26Å; S107-F109 PolarHBondContact O-N 2.92Å; S107-S110 VanDerWaalsContact CB-OG 3.25Å; S107-S110 WeakPolarHBondContact CB-OG 3.23Å; S107-S110 PolarHBondContact O-N 3.44Å; S107-S110 PolarHBondContact OG-N 3.07Å; S107-S110 PolarHBondContact OG-OG 3.4Å; S107-G111 WeakPolarHBondContact O-CA 3.37Å; S107-G111 PolarHBondContact O-N 2.89Å; S107-N112 PolarHBondContact N-O 3.21Å
108	K	91	Very high	92.7	Very high	155 Å²	155	64.9 Å²	64.9	67%	0.674	34%	0.336	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.9	-35.3	175.6	-176.9	-178.9	176.2	-176.4	0	112.2	G53 Y106	G53-K108 WeakPolarHBondContact O-CB 3.17Å; G53-K108 PolarHBondContact O-N 3.47Å; Y106-K108 HydrophobicContact CE1-CB 4.15Å
109	F	91.2	Very high	92.6	Very high	154 Å²	154	66.2 Å²	66.2	68%	0.675	34%	0.341	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.1	-35.8	-176.8	-62.3	-47.6	0	0	0	113.2	L51 A52 S107	L51-F109 WeakPolarHBondContact O-CZ 3.24Å; A52-F109 WeakPolarHBondContact O-CD2 3.41Å; A52-F109 WeakPolarHBondContact O-CE2 3.26Å; S107-F109 VanDerWaalsContact C-N 3.26Å; S107-F109 PolarHBondContact O-N 2.92Å
110	S	91.6	Very high	92.5	Very high	65 Å²	65	65.6 Å²	65.6	46%	0.455	34%	0.339	S	S	.	.	T	Hydrogen-bonded Turn	trans	-96.6	-17.8	177.2	59.6	0	0	0	0	113.5	S107 N112	S107-S110 VanDerWaalsContact CB-OG 3.25Å; S107-S110 WeakPolarHBondContact CB-OG 3.23Å; S107-S110 PolarHBondContact O-N 3.44Å; S107-S110 PolarHBondContact OG-N 3.07Å; S107-S110 PolarHBondContact OG-OG 3.4Å; S110-N112 PolarHBondContact O-N 3.01Å; S110-N112 PolarHBondContact OG-N 3.48Å
111	G	87.3	Confident	92.4	Very high	33 Å²	33	74.3 Å²	74.3	34%	0.34	37%	0.372	S	S	.	.			trans	72.8	0.5	-170.6	0	0	0	0	0	113.9	Y106 S107	Y106-G111 WeakPolarHBondContact CE2-O 3.41Å; S107-G111 WeakPolarHBondContact O-CA 3.37Å; S107-G111 PolarHBondContact O-N 2.89Å
112	N	88.8	Confident	92.1	Very high	107 Å²	107	72.1 Å²	72.1	57%	0.572	36%	0.36	S	S	*	.			trans	-86.6	149.5	-175.5	-66.3	-26.2	0	0	0	111.8	Y106 S107 S110	Y106-N112 VanDerWaalsContact CD2-O 3.3Å; Y106-N112 WeakPolarHBondContact CD2-O 3.37Å; S107-N112 PolarHBondContact N-O 3.21Å; S110-N112 PolarHBondContact O-N 3.01Å; S110-N112 PolarHBondContact OG-N 3.48Å
113	S	89.8	Confident	91.5	Very high	20 Å²	20	83.7 Å²	83.7	14%	0.14	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.7	141.8	172.4	37.1	0	0	0	0	110.6	K26 Q105	K26-S113 PolarHBondContact NZ-OG 2.83Å; Q105-S113 CarbonylContact O-C 3.58Å; Q105-S113 VanDerWaalsContact O-CA 3.27Å; Q105-S113 WeakPolarHBondContact O-CA 3.23Å
114	N	90.9	Very high	91.3	Very high	115 Å²	115	86.1 Å²	86.1	62%	0.615	42%	0.417	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-111.3	113.7	167.5	-67.5	-30.6	0	0	0	107.8	Q105	Q105-N114 PolarHBondContact N-O 3.1Å; Q105-N114 PolarHBondContact O-N 2.87Å
115	L	91.4	Very high	91.2	Very high	43 Å²	43	90.5 Å²	90.5	23%	0.225	44%	0.439	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	129.6	174.6	177.6	68	0	0	0	109.4	L27 D30 F59 L104	L27-L115 HydrophobicContact CD2-CD1 3.81Å; L27-L115 HydrophobicContact CD2-CD2 3.51Å; L27-L115 HydrophobicContact CD2-CG 4.32Å; D30-L115 HydrophobicContact CB-CD2 4.15Å; D30-L115 WeakPolarHBondContact OD2-CB 3.42Å; F59-L115 HydrophobicContact CE1-CD1 4.29Å; F59-L115 HydrophobicContact CZ-CD1 3.77Å; L104-L115 HydrophobicContact CD1-CB 4.26Å; L104-L115 HydrophobicContact CD1-CD1 4.37Å
116	F	92.2	Very high	91	Very high	136 Å²	136	90.6 Å²	90.6	60%	0.596	44%	0.44	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-131.3	131.9	170.7	175.2	-96.5	0	0	0	109.4	C102 S103	C102-F116 CarbonylContact C-O 3.58Å; C102-F116 WeakPolarHBondContact CA-O 3.35Å; S103-F116 PolarHBondContact N-O 3.24Å; S103-F116 PolarHBondContact O-N 3.43Å
117	C	92.1	Very high	90.8	Very high	22 Å²	22	92.9 Å²	92.9	15%	0.149	45%	0.454	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	130.9	175.6	-69.2	0	0	0	0	109.8	L38 C102 M119	L38-C117 HydrophobicContact CD1-CB 4.38Å; L38-C117 VanDerWaalsContact CD1-SG 3.54Å; C102-C117 HydrophobicContact CB-CB 4.13Å; C102-C117 WeakPolarHBondContact CB-SG 3.25Å; C102-C117 WeakPolarHBondContact SG-CB 3.14Å; C102-C117 CovalentContact SG-SG 2.04Å; C102-C117 PolarHBondContact SG-SG 3.38Å; C117-M119 VanDerWaalsContact C-N 3.32Å; C117-M119 HydrophobicContact CB-SD 3.64Å; C117-M119 PolarHBondContact O-N 3.24Å
118	K	93.7	Very high	90.7	Very high	149 Å²	149	97.4 Å²	97.4	65%	0.648	47%	0.473	S	S	*	.			trans	-81.3	86	170.5	-172.1	-179.8	179.6	-179.3	0	108.6	P101 I120	P101-K118 PolarHBondContact O-N 3Å; K118-I120 PolarHBondContact O-N 2.97Å
119	M	92.1	Very high	90.6	Very high	46 Å²	46	93.6 Å²	93.6	23%	0.227	46%	0.46	C	S	.	.	P	Polyproline II helix	trans	-63.4	125.5	179.7	-57.4	-52	-62.4	0	0	110.6	W36 L38 I63 I94 H100 C117	W36-M119 HydrophobicContact CD2-CE 3.94Å; W36-M119 HydrophobicContact CE3-CE 3.66Å; W36-M119 HydrophobicContact CE3-CG 4.21Å; W36-M119 HydrophobicContact CE3-SD 4.27Å; W36-M119 HydrophobicContact CG-CE 4.41Å; W36-M119 HydrophobicContact CH2-CG 4.32Å; W36-M119 HydrophobicContact CZ3-CB 4.47Å; W36-M119 HydrophobicContact CZ3-CE 4.06Å; W36-M119 HydrophobicContact CZ3-CG 3.72Å; W36-M119 HydrophobicContact CZ3-SD 4.38Å; L38-M119 HydrophobicContact CD2-CE 4.27Å; I63-M119 HydrophobicContact CD1-CE 3.94Å; I63-M119 HydrophobicContact CG1-CE 4.17Å; I94-M119 HydrophobicContact CD1-CB 3.74Å; I94-M119 HydrophobicContact CD1-CE 3.81Å; I94-M119 HydrophobicContact CG1-CE 4.38Å; H100-M119 HydrophobicContact CB-SD 4.28Å; H100-M119 VanDerWaalsContact CD2-CE 3.45Å; H100-M119 WeakPolarHBondContact CD2-CE 3.35Å; C117-M119 VanDerWaalsContact C-N 3.32Å; C117-M119 HydrophobicContact CB-SD 3.64Å; C117-M119 PolarHBondContact O-N 3.24Å
120	I	93.7	Very high	90.6	Very high	66 Å²	66	89.3 Å²	89.3	34%	0.338	45%	0.445	S	S	.	.	P	Polyproline II helix	trans	-86.4	120	-179.5	-62.5	166.8	0	0	0	107.3	I94 D95 A98 E99 H100 K118	I94-I120 WeakPolarHBondContact CD1-O 3.06Å; D95-I120 HydrophobicContact CB-CG2 4.15Å; D95-I120 PolarHBondContact N-O 3.03Å; A98-I120 HydrophobicContact CB-CB 4.22Å; A98-I120 HydrophobicContact CB-CD1 3.91Å; A98-I120 HydrophobicContact CB-CG2 4.33Å; E99-I120 VanDerWaalsContact O-CD1 3.23Å; E99-I120 WeakPolarHBondContact O-CD1 3.44Å; H100-I120 PolarHBondContact CE1-N 2.88Å; H100-I120 PolarHBondContact ND1-N 3.16Å; K118-I120 PolarHBondContact O-N 2.97Å
121	R	92.4	Very high	90.5	Very high	184 Å²	184	91.2 Å²	91.2	69%	0.694	44%	0.444	S	S	*	.	P	Polyproline II helix	trans	-70.4	141.4	177.4	-59	-169	75	130.4	2.4	109.6	V93	V93-R121 WeakPolarHBondContact O-CA 3.37Å
122	G	89.2	Confident	90.8	Very high	13 Å²	13	96 Å²	96	13%	0.134	45%	0.452	C	S	.	.	P	Polyproline II helix	trans	-78	171.1	175.2	0	0	0	0	0	112	K91 I94 D95	K91-G122 CarbonylContact O-C 3.41Å; K91-G122 WeakPolarHBondContact O-CA 3.08Å; I94-G122 VanDerWaalsContact C-N 3.33Å; D95-G122 VanDerWaalsContact N-N 3.16Å
123	K	83.2	Confident	91	Very high	251 Å²	251	95 Å²	95	100%	1.091	44%	0.442	S	S	*	.			trans	-103	0	-174	-66.7	-179.3	-179	174.9	0	111.5

Retrieved 123 of 123 residues in 89.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).