A0A077Z0E3_TRITR Loading...

BBIP10 domain containing protein

AlphaFold DB , UniProt , Accession A0A077Z0E3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 82 aa.

						>A0A077Z0E3_TRITR|A0A077Z0E3
MNLETILPKNGMLFDEIELDPIFCKPKIMPLKSMTLVKLEKLQRQMEEKLEKTKDKGSEVGDLLNDASRETKVDVWKADVGL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.4	Very low	79	Confident	229 Å²	229	155.3 Å²	155.3	100%	1.128	84%	0.837	S	S	*	*				0	109.4	0	-68.4	178.2	-164.8	0	0	106.4
2	N	59.1	Low	79.9	Confident	167 Å²	167	157.2 Å²	157.2	89%	0.893	84%	0.841	S	S	*	*			trans	-85.3	114.5	176.7	-73	-20.9	0	0	0	107.4
3	L	73.4	Confident	80.7	Confident	162 Å²	162	158.1 Å²	158.1	85%	0.848	84%	0.844	S	S	*	*			trans	-92.6	103.6	173.3	-65.9	172.4	0	0	0	107.2	T5	L3-T5 PolarHBondContact O-N 3.22Å
4	E	80.4	Confident	81.4	Confident	185 Å²	185	160.4 Å²	160.4	86%	0.864	84%	0.843	S	S	*	*			trans	-73	121.5	165.9	-80.2	-176.7	162.4	0	0	108.8	I6	E4-I6 PolarHBondContact O-N 3.19Å
5	T	82.5	Confident	82.1	Confident	130 Å²	130	160.5 Å²	160.5	80%	0.798	85%	0.845	S	S	*	*			trans	-77.7	111.8	173.1	36.9	0	0	0	0	109.4	L3 L7	L3-T5 PolarHBondContact O-N 3.22Å; T5-L7 PolarHBondContact O-N 2.95Å
6	I	84.4	Confident	82.7	Confident	168 Å²	168	159.9 Å²	159.9	86%	0.862	84%	0.836	S	S	*	*	P	Polyproline II helix	trans	-82.5	116.4	174.1	-13.4	171.4	0	0	0	108.5	E4	E4-I6 PolarHBondContact O-N 3.19Å
7	L	87.8	Confident	83	Confident	140 Å²	140	160.4 Å²	160.4	73%	0.733	84%	0.838	S	S	*	*	P	Polyproline II helix	trans	-91.6	150.4	174.7	-69.5	168.9	0	0	0	110.5	T5 K9	T5-L7 PolarHBondContact O-N 2.95Å; L7-K9 PolarHBondContact O-N 3.02Å
8	P	88.3	Confident	83.2	Confident	110 Å²	110	159.6 Å²	159.6	71%	0.714	83%	0.829	S	S	*	*	P	Polyproline II helix	trans	-59.9	134.5	172.2	25.4	-32.7	0	0	0	109.9	N10	P8-N10 VanDerWaalsContact C-N 3.26Å; P8-N10 PolarHBondContact O-N 2.78Å
9	K	87.9	Confident	83.5	Confident	206 Å²	206	160.4 Å²	160.4	90%	0.896	83%	0.834	S	S	*	*	S	Bend	trans	-74	-20.8	-179.9	-63	-175.4	-179.9	-178.7	0	112.8	L7	L7-K9 PolarHBondContact O-N 3.02Å
10	N	88.7	Confident	83.8	Confident	141 Å²	141	158.2 Å²	158.2	75%	0.754	82%	0.823	S	S	*	*	S	Bend	trans	-109	140	-174.7	-57.6	-9.2	0	0	0	109.8	P8	P8-N10 VanDerWaalsContact C-N 3.26Å; P8-N10 PolarHBondContact O-N 2.78Å
11	G	89.7	Confident	84.2	Confident	70 Å²	70	155.8 Å²	155.8	72%	0.722	82%	0.817	S	S	*	*			trans	-90.1	-177.3	178	0	0	0	0	0	113.8
12	M	90	Very high	86.4	Confident	178 Å²	178	152.2 Å²	152.2	88%	0.877	80%	0.801	S	S	*	*			trans	-76.6	139	171.9	-65.7	175.5	-167.6	0	0	110.4
13	L	91.1	Very high	88.1	Confident	169 Å²	169	152.7 Å²	152.7	89%	0.885	80%	0.796	S	S	*	*			trans	-112.7	133.6	175.8	-61.7	175.2	0	0	0	108.8
14	F	90	Very high	89.1	Confident	190 Å²	190	151.1 Å²	151.1	83%	0.833	80%	0.797	S	S	*	*			trans	-98.4	118.5	170	-61.6	-87.5	0	0	0	107.5
15	D	92.1	Very high	89.8	Confident	162 Å²	162	150.7 Å²	150.7	87%	0.866	79%	0.792	S	S	*	*			trans	-85.8	-28	-179.8	-160	17	0	0	0	111.6
16	E	91.7	Very high	90.5	Very high	152 Å²	152	150.4 Å²	150.4	71%	0.71	79%	0.792	S	S	*	*	S	Bend	trans	-130.7	157.8	-176.4	-61.1	-175.6	178.2	0	0	111.4
17	I	87	Confident	91	Very high	167 Å²	167	151.1 Å²	151.1	86%	0.856	79%	0.789	S	S	*	*			trans	-99.8	106.8	176.1	-58.1	170.6	0	0	0	108.3
18	E	87.9	Confident	91.4	Very high	147 Å²	147	151.8 Å²	151.8	69%	0.687	79%	0.792	S	S	*	*			trans	-84.2	139.8	172.2	-65.6	-177.2	177.9	0	0	110.8	D20	E18-D20 PolarHBondContact O-N 3.45Å; E18-D20 VanDerWaalsContact O-N 3.15Å
19	L	88.4	Confident	91.8	Very high	174 Å²	174	153.6 Å²	153.6	91%	0.911	79%	0.793	S	S	*	*			trans	-85.2	83.1	178	-72	172.5	0	0	0	110.4
20	D	89.6	Confident	92.2	Very high	116 Å²	116	148.9 Å²	148.9	62%	0.62	78%	0.783	S	S	*	*	P	Polyproline II helix	trans	-83	147.7	175.3	-75.2	-29	0	0	0	112.9	E18 I22	E18-D20 PolarHBondContact O-N 3.45Å; E18-D20 VanDerWaalsContact O-N 3.15Å; D20-I22 PolarHBondContact O-N 2.9Å
21	P	92	Very high	92.5	Very high	108 Å²	108	150.4 Å²	150.4	70%	0.701	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-62.8	125.2	172.9	26.7	-33.2	0	0	0	110.6
22	I	92.3	Very high	92.8	Very high	154 Å²	154	152.2 Å²	152.2	79%	0.79	78%	0.778	S	S	*	*	P	Polyproline II helix	trans	-84.5	122.2	-177.5	-58.7	172.5	0	0	0	110.1	D20	D20-I22 PolarHBondContact O-N 2.9Å
23	F	93.9	Very high	93.1	Very high	178 Å²	178	146.9 Å²	146.9	78%	0.781	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-74.3	148.7	171.3	-63.2	-79.4	0	0	0	112.2	K25	F23-K25 PolarHBondContact O-N 3.06Å
24	C	95.1	Very high	93.4	Very high	129 Å²	129	145.4 Å²	145.4	87%	0.872	75%	0.749	S	S	*	*	P	Polyproline II helix	trans	-56.9	131.8	171.3	-59.7	0	0	0	0	110.1
25	K	95.1	Very high	93.7	Very high	175 Å²	175	140.9 Å²	140.9	76%	0.761	74%	0.737	S	S	*	*	P	Polyproline II helix	trans	-63.2	146.4	174.1	-57.8	-57.8	-176.6	-173.7	0	109.8	F23 K27	F23-K25 PolarHBondContact O-N 3.06Å; K25-K27 PolarHBondContact O-N 3.28Å
26	P	96.9	Very high	94	Very high	125 Å²	125	136.9 Å²	136.9	81%	0.812	72%	0.715	S	S	*	*	P	Polyproline II helix	trans	-60.7	133.9	-178.4	24.9	-34.4	0	0	0	111.1
27	K	96.2	Very high	94.2	Very high	183 Å²	183	132.8 Å²	132.8	80%	0.796	70%	0.7	S	S	*	*	P	Polyproline II helix	trans	-89	123.2	-179.8	-173.8	178.5	-179.9	178.1	0	110.7	K25	K25-K27 PolarHBondContact O-N 3.28Å
28	I	96.5	Very high	94.7	Very high	154 Å²	154	131.7 Å²	131.7	79%	0.79	69%	0.689	S	S	*	*	P	Polyproline II helix	trans	-78.9	128.1	169.9	-59.2	172.4	0	0	0	108.6
29	M	95.4	Very high	95.1	Very high	148 Å²	148	129.7 Å²	129.7	73%	0.729	68%	0.683	S	S	*	*	P	Polyproline II helix	trans	-73.9	130.1	176.6	-70	-70.3	-76.5	0	0	110.1
30	P	95.9	Very high	95.5	Very high	106 Å²	106	124.1 Å²	124.1	69%	0.688	65%	0.652	S	S	*	*	P	Polyproline II helix	trans	-67.7	148.4	177.9	28.7	-34.4	0	0	0	111.1
31	L	95.6	Very high	95.9	Very high	173 Å²	173	124.9 Å²	124.9	91%	0.906	65%	0.65	S	S	*	*	P	Polyproline II helix	trans	-73.2	134.3	174.6	-61.6	177.3	0	0	0	110.2
32	K	96.1	Very high	96.1	Very high	109 Å²	109	123.9 Å²	123.9	47%	0.474	64%	0.638	S	S	.	*	P	Polyproline II helix	trans	-72.1	138.4	174.8	-64.4	-178.2	-177.1	-171.1	0	110.2	L36 V37 E40	K32-L36 HydrophobicContact CB-CD2 4.27Å; K32-L36 HydrophobicContact CD-CD2 3.92Å; K32-L36 HydrophobicContact CG-CD2 4.13Å; K32-V37 HydrophobicContact CB-CG2 3.8Å; K32-V37 HydrophobicContact CD-CG2 4.48Å; K32-E40 WeakPolarHBondContact CE-OE1 3.36Å; K32-E40 IonicContact NZ-OE1 2.77Å; K32-E40 PolarHBondContact NZ-OE1 2.73Å; K32-E40 IonicContact NZ-OE2 2.73Å; K32-E40 PolarHBondContact NZ-OE2 3.26Å
33	S	97.3	Very high	96.2	Very high	66 Å²	66	122 Å²	122	46%	0.462	63%	0.626	S	S	.	*	P	Polyproline II helix	trans	-68	153.9	173.3	72.9	0	0	0	0	111	T35 L36 V37	S33-T35 PolarHBondContact O-N 3.29Å; S33-L36 PolarHBondContact O-N 3.38Å; S33-L36 WeakPolarHBondContact OG-CB 3.36Å; S33-L36 PolarHBondContact OG-N 3.08Å; S33-V37 WeakPolarHBondContact O-CG2 3.29Å; S33-V37 PolarHBondContact O-N 3.29Å
34	M	96.6	Very high	96.3	Very high	138 Å²	138	120.6 Å²	120.6	68%	0.68	62%	0.615	S	S	*	*	H	α-helix	trans	-56.4	-35.8	177.9	-70.1	-67.9	104.7	0	0	112.5	K38	M34-K38 WeakPolarHBondContact O-CG 3.44Å; M34-K38 PolarHBondContact O-N 2.72Å
35	T	97	Very high	96.3	Very high	95 Å²	95	118.3 Å²	118.3	58%	0.583	59%	0.592	S	S	*	*	H	α-helix	trans	-66.5	-44.4	176.3	-51	0	0	0	0	111.4	S33 V37 K38 L39	S33-T35 PolarHBondContact O-N 3.29Å; T35-V37 VanDerWaalsContact C-N 3.34Å; T35-V37 PolarHBondContact O-N 2.99Å; T35-K38 PolarHBondContact O-N 3.01Å; T35-L39 HydrophobicContact CG2-CD1 4.26Å; T35-L39 WeakPolarHBondContact O-CG 3.45Å; T35-L39 PolarHBondContact O-N 3.43Å
36	L	96.6	Very high	96.2	Very high	77 Å²	77	116 Å²	116	40%	0.403	59%	0.586	S	S	.	*	H	α-helix	trans	-64.1	-41.1	-179.8	-162.6	156.5	0	0	0	110.9	K32 S33 K38 L39 E40	K32-L36 HydrophobicContact CB-CD2 4.27Å; K32-L36 HydrophobicContact CD-CD2 3.92Å; K32-L36 HydrophobicContact CG-CD2 4.13Å; S33-L36 PolarHBondContact O-N 3.38Å; S33-L36 WeakPolarHBondContact OG-CB 3.36Å; S33-L36 PolarHBondContact OG-N 3.08Å; L36-K38 VanDerWaalsContact C-N 3.34Å; L36-K38 PolarHBondContact O-N 3.28Å; L36-L39 PolarHBondContact O-N 3.45Å; L36-E40 HydrophobicContact CD2-CG 3.9Å; L36-E40 WeakPolarHBondContact CD2-OE1 3.4Å; L36-E40 WeakPolarHBondContact O-CG 3.42Å; L36-E40 PolarHBondContact O-N 3.39Å
37	V	96.7	Very high	96.1	Very high	66 Å²	66	114.3 Å²	114.3	40%	0.4	57%	0.566	S	S	.	*	H	α-helix	trans	-60.8	-41.7	174.8	175.9	0	0	0	0	111.9	K32 S33 T35 K41	K32-V37 HydrophobicContact CB-CG2 3.8Å; K32-V37 HydrophobicContact CD-CG2 4.48Å; S33-V37 WeakPolarHBondContact O-CG2 3.29Å; S33-V37 PolarHBondContact O-N 3.29Å; T35-V37 VanDerWaalsContact C-N 3.34Å; T35-V37 PolarHBondContact O-N 2.99Å; V37-K41 WeakPolarHBondContact O-CB 3.42Å; V37-K41 PolarHBondContact O-N 3.11Å
38	K	97.5	Very high	96	Very high	144 Å²	144	110.3 Å²	110.3	63%	0.626	55%	0.551	S	S	*	*	H	α-helix	trans	-66.1	-42.9	177.4	-72.5	174.4	-174.3	178.1	0	112	M34 T35 L36 K41 L42	M34-K38 WeakPolarHBondContact O-CG 3.44Å; M34-K38 PolarHBondContact O-N 2.72Å; T35-K38 PolarHBondContact O-N 3.01Å; L36-K38 VanDerWaalsContact C-N 3.34Å; L36-K38 PolarHBondContact O-N 3.28Å; K38-K41 PolarHBondContact O-N 2.91Å; K38-L42 WeakPolarHBondContact O-CG 3.35Å; K38-L42 PolarHBondContact O-N 3.37Å
39	L	97.3	Very high	95.7	Very high	106 Å²	106	110 Å²	110	56%	0.555	54%	0.543	S	S	*	.	H	α-helix	trans	-64	-45.3	177.7	-72.1	174.4	0	0	0	111.7	T35 L36 K41 L42 Q43	T35-L39 HydrophobicContact CG2-CD1 4.26Å; T35-L39 WeakPolarHBondContact O-CG 3.45Å; T35-L39 PolarHBondContact O-N 3.43Å; L36-L39 PolarHBondContact O-N 3.45Å; L39-K41 VanDerWaalsContact C-N 3.27Å; L39-K41 PolarHBondContact O-N 3.36Å; L39-L42 PolarHBondContact O-N 3.2Å; L39-Q43 WeakPolarHBondContact O-CB 3.46Å; L39-Q43 PolarHBondContact O-N 2.97Å
40	E	96.5	Very high	95.5	Very high	57 Å²	57	107.5 Å²	107.5	27%	0.266	53%	0.533	S	S	.	.	H	α-helix	trans	-58.6	-40.5	174.4	-75.5	-177.9	171.4	0	0	111.7	K32 L36 Q43 R44	K32-E40 WeakPolarHBondContact CE-OE1 3.36Å; K32-E40 IonicContact NZ-OE1 2.77Å; K32-E40 PolarHBondContact NZ-OE1 2.73Å; K32-E40 IonicContact NZ-OE2 2.73Å; K32-E40 PolarHBondContact NZ-OE2 3.26Å; L36-E40 HydrophobicContact CD2-CG 3.9Å; L36-E40 WeakPolarHBondContact CD2-OE1 3.4Å; L36-E40 WeakPolarHBondContact O-CG 3.42Å; L36-E40 PolarHBondContact O-N 3.39Å; E40-Q43 PolarHBondContact O-N 3.21Å; E40-R44 WeakPolarHBondContact O-CG 3.37Å; E40-R44 PolarHBondContact O-N 3.06Å
41	K	96.9	Very high	95.2	Very high	132 Å²	132	108.2 Å²	108.2	57%	0.574	53%	0.527	S	S	*	.	H	α-helix	trans	-65	-44.2	176.4	-174.9	179	179.5	179.6	0	112	V37 K38 L39 Q43 R44 Q45	V37-K41 WeakPolarHBondContact O-CB 3.42Å; V37-K41 PolarHBondContact O-N 3.11Å; K38-K41 PolarHBondContact O-N 2.91Å; L39-K41 VanDerWaalsContact C-N 3.27Å; L39-K41 PolarHBondContact O-N 3.36Å; K41-Q43 VanDerWaalsContact C-N 3.34Å; K41-R44 PolarHBondContact O-N 3.01Å; K41-Q45 VanDerWaalsContact O-CG 3.28Å; K41-Q45 WeakPolarHBondContact O-CG 3.45Å; K41-Q45 PolarHBondContact O-N 3.07Å
42	L	96.1	Very high	94.8	Very high	87 Å²	87	105.9 Å²	105.9	46%	0.455	51%	0.51	S	S	.	.	H	α-helix	trans	-62.4	-43.5	177.1	-73.4	174.6	0	0	0	111.2	K38 L39 Q45 M46	K38-L42 WeakPolarHBondContact O-CG 3.35Å; K38-L42 PolarHBondContact O-N 3.37Å; L39-L42 PolarHBondContact O-N 3.2Å; L42-Q45 PolarHBondContact O-N 3.29Å; L42-M46 WeakPolarHBondContact O-CG 3.39Å; L42-M46 PolarHBondContact O-N 3.24Å
43	Q	95.5	Very high	94.1	Very high	113 Å²	113	103.2 Å²	103.2	53%	0.528	50%	0.503	S	S	.	.	H	α-helix	trans	-60.4	-49.1	177.2	-177.5	177.9	-17.1	0	0	111.3	L39 E40 K41 Q45 M46 E47	L39-Q43 WeakPolarHBondContact O-CB 3.46Å; L39-Q43 PolarHBondContact O-N 2.97Å; E40-Q43 PolarHBondContact O-N 3.21Å; K41-Q43 VanDerWaalsContact C-N 3.34Å; Q43-Q45 VanDerWaalsContact C-N 3.3Å; Q43-Q45 PolarHBondContact O-N 3.46Å; Q43-M46 WeakPolarHBondContact O-CB 3.42Å; Q43-M46 PolarHBondContact O-N 3.33Å; Q43-E47 WeakPolarHBondContact CG-OE1 3.37Å; Q43-E47 PolarHBondContact NE2-OE1 3.45Å; Q43-E47 WeakPolarHBondContact O-CG 3.43Å; Q43-E47 PolarHBondContact O-N 3.35Å
44	R	96.1	Very high	93.2	Very high	150 Å²	150	107 Å²	107	57%	0.566	51%	0.51	S	S	*	.	H	α-helix	trans	-58.2	-41.5	176.4	-72.6	175.1	-172.8	177.2	1.8	112.5	E40 K41 M46 E47 E48	E40-R44 WeakPolarHBondContact O-CG 3.37Å; E40-R44 PolarHBondContact O-N 3.06Å; K41-R44 PolarHBondContact O-N 3.01Å; R44-M46 VanDerWaalsContact C-N 3.32Å; R44-M46 PolarHBondContact O-N 2.99Å; R44-E47 PolarHBondContact O-N 2.87Å; R44-E48 WeakPolarHBondContact O-CB 3.21Å; R44-E48 WeakPolarHBondContact O-CG 3.42Å; R44-E48 PolarHBondContact O-N 3Å
45	Q	95.1	Very high	92	Very high	80 Å²	80	107.2 Å²	107.2	37%	0.374	51%	0.514	S	S	.	.	H	α-helix	trans	-64.9	-34.8	176.6	-73.4	178.1	-22.5	0	0	112.9	K41 L42 Q43 K49	K41-Q45 VanDerWaalsContact O-CG 3.28Å; K41-Q45 WeakPolarHBondContact O-CG 3.45Å; K41-Q45 PolarHBondContact O-N 3.07Å; L42-Q45 PolarHBondContact O-N 3.29Å; Q43-Q45 VanDerWaalsContact C-N 3.3Å; Q43-Q45 PolarHBondContact O-N 3.46Å; Q45-K49 WeakPolarHBondContact O-CB 3.46Å; Q45-K49 WeakPolarHBondContact O-CG 3.44Å; Q45-K49 PolarHBondContact O-N 3.44Å; Q45-K49 VanDerWaalsContact O-N 3.17Å
46	M	93	Very high	90.2	Very high	128 Å²	128	109.7 Å²	109.7	63%	0.631	52%	0.517	S	S	*	.	H	α-helix	trans	-69.3	-43.1	174.3	-68.8	178.6	-167.5	0	0	111.3	L42 Q43 R44 K49 L50	L42-M46 WeakPolarHBondContact O-CG 3.39Å; L42-M46 PolarHBondContact O-N 3.24Å; Q43-M46 WeakPolarHBondContact O-CB 3.42Å; Q43-M46 PolarHBondContact O-N 3.33Å; R44-M46 VanDerWaalsContact C-N 3.32Å; R44-M46 PolarHBondContact O-N 2.99Å; M46-K49 PolarHBondContact O-N 3.18Å; M46-L50 WeakPolarHBondContact O-CB 3.28Å; M46-L50 PolarHBondContact O-N 3.32Å
47	E	94.1	Very high	88.1	Confident	88 Å²	88	109.2 Å²	109.2	41%	0.411	53%	0.531	S	S	.	.	H	α-helix	trans	-62.1	-48.2	177	-71.7	168.4	-176.4	0	0	111.3	Q43 R44 K49 L50 E51	Q43-E47 WeakPolarHBondContact CG-OE1 3.37Å; Q43-E47 PolarHBondContact NE2-OE1 3.45Å; Q43-E47 WeakPolarHBondContact O-CG 3.43Å; Q43-E47 PolarHBondContact O-N 3.35Å; R44-E47 PolarHBondContact O-N 2.87Å; E47-K49 VanDerWaalsContact C-N 3.32Å; E47-K49 PolarHBondContact O-N 3.1Å; E47-L50 WeakPolarHBondContact O-CB 3.36Å; E47-L50 PolarHBondContact O-N 2.93Å; E47-L50 VanDerWaalsContact O-N 3.11Å; E47-E51 WeakPolarHBondContact O-CG 3.47Å; E47-E51 PolarHBondContact O-N 2.86Å
48	E	94	Very high	86	Confident	100 Å²	100	111.1 Å²	111.1	47%	0.467	55%	0.547	S	S	.	.	H	α-helix	trans	-61.5	-37.6	176.5	-74.2	174.4	-159.6	0	0	113	R44 K52	R44-E48 WeakPolarHBondContact O-CB 3.21Å; R44-E48 WeakPolarHBondContact O-CG 3.42Å; R44-E48 PolarHBondContact O-N 3Å; E48-K52 VanDerWaalsContact O-CG 3.28Å; E48-K52 WeakPolarHBondContact O-CG 3.34Å; E48-K52 PolarHBondContact O-N 3.44Å; E48-K52 VanDerWaalsContact O-N 3.1Å
49	K	91.1	Very high	83.9	Confident	146 Å²	146	111.7 Å²	111.7	64%	0.635	55%	0.552	S	S	*	*	H	α-helix	trans	-66.4	-43.1	174.5	-77.6	175.5	-177.8	-175.7	0	110.5	Q45 M46 E47 K52 T53	Q45-K49 WeakPolarHBondContact O-CB 3.46Å; Q45-K49 WeakPolarHBondContact O-CG 3.44Å; Q45-K49 PolarHBondContact O-N 3.44Å; Q45-K49 VanDerWaalsContact O-N 3.17Å; M46-K49 PolarHBondContact O-N 3.18Å; E47-K49 VanDerWaalsContact C-N 3.32Å; E47-K49 PolarHBondContact O-N 3.1Å; K49-K52 PolarHBondContact O-N 2.9Å; K49-T53 WeakPolarHBondContact O-CG2 3.47Å; K49-T53 PolarHBondContact O-N 3.07Å; K49-T53 PolarHBondContact O-OG1 3.17Å
50	L	89.9	Confident	81.9	Confident	96 Å²	96	108.6 Å²	108.6	50%	0.503	54%	0.537	S	S	.	.	H	α-helix	trans	-62.6	-42.7	178.6	-173.9	67.1	0	0	0	111.4	M46 E47 T53 K54	M46-L50 WeakPolarHBondContact O-CB 3.28Å; M46-L50 PolarHBondContact O-N 3.32Å; E47-L50 WeakPolarHBondContact O-CB 3.36Å; E47-L50 PolarHBondContact O-N 2.93Å; E47-L50 VanDerWaalsContact O-N 3.11Å; L50-T53 WeakPolarHBondContact CA-OG1 3.42Å; L50-T53 PolarHBondContact O-N 2.99Å; L50-T53 PolarHBondContact O-OG1 3.47Å; L50-K54 WeakPolarHBondContact O-CG 3.33Å; L50-K54 PolarHBondContact O-N 2.9Å
51	E	90.3	Very high	79.9	Confident	121 Å²	121	108 Å²	108	57%	0.565	55%	0.547	S	S	*	.	H	α-helix	trans	-60.3	-49.8	174.2	-72.5	178.8	168.6	0	0	111.6	E47 T53 K54 D55	E47-E51 WeakPolarHBondContact O-CG 3.47Å; E47-E51 PolarHBondContact O-N 2.86Å; E51-T53 VanDerWaalsContact C-N 3.26Å; E51-T53 PolarHBondContact O-N 3.33Å; E51-K54 WeakPolarHBondContact O-CB 3.5Å; E51-K54 PolarHBondContact O-N 3.35Å; E51-D55 PolarHBondContact O-N 3.06Å
52	K	87.7	Confident	77.8	Confident	125 Å²	125	107.4 Å²	107.4	54%	0.543	55%	0.55	S	S	.	*	H	α-helix	trans	-59.9	-34.4	177.1	-71.2	170.4	-172.1	171.5	0	113.2	E48 K49 K56	E48-K52 VanDerWaalsContact O-CG 3.28Å; E48-K52 WeakPolarHBondContact O-CG 3.34Å; E48-K52 PolarHBondContact O-N 3.44Å; E48-K52 VanDerWaalsContact O-N 3.1Å; K49-K52 PolarHBondContact O-N 2.9Å; K52-K56 WeakPolarHBondContact O-CB 3.28Å; K52-K56 WeakPolarHBondContact O-CG 3.37Å; K52-K56 PolarHBondContact O-N 2.93Å
53	T	81.4	Confident	76	Confident	53 Å²	53	108.9 Å²	108.9	33%	0.325	56%	0.558	S	S	.	*	H	α-helix	trans	-72.5	-30	175.6	53.3	0	0	0	0	113.1	K49 L50 E51 G57 V60	K49-T53 WeakPolarHBondContact O-CG2 3.47Å; K49-T53 PolarHBondContact O-N 3.07Å; K49-T53 PolarHBondContact O-OG1 3.17Å; L50-T53 WeakPolarHBondContact CA-OG1 3.42Å; L50-T53 PolarHBondContact O-N 2.99Å; L50-T53 PolarHBondContact O-OG1 3.47Å; E51-T53 VanDerWaalsContact C-N 3.26Å; E51-T53 PolarHBondContact O-N 3.33Å; T53-G57 PolarHBondContact O-N 3.2Å; T53-V60 HydrophobicContact CG2-CB 4.4Å; T53-V60 HydrophobicContact CG2-CG1 3.92Å; T53-V60 HydrophobicContact CG2-CG2 4.45Å
54	K	77.7	Confident	74.3	Confident	144 Å²	144	109 Å²	109	63%	0.626	56%	0.561	S	S	*	*	H	α-helix	trans	-69.2	-43.1	174.2	-72.2	175.1	-178.9	177.4	0	111	L50 E51 K56 G57	L50-K54 WeakPolarHBondContact O-CG 3.33Å; L50-K54 PolarHBondContact O-N 2.9Å; E51-K54 WeakPolarHBondContact O-CB 3.5Å; E51-K54 PolarHBondContact O-N 3.35Å; K54-K56 VanDerWaalsContact C-N 3.32Å; K54-K56 PolarHBondContact O-N 3.3Å; K54-G57 PolarHBondContact O-N 3.02Å
55	D	70.7	Confident	72.3	Confident	143 Å²	143	106.5 Å²	106.5	77%	0.765	56%	0.559	S	S	*	*	H	α-helix	trans	-70.9	-28.1	-179.7	-64.3	-24.6	0	0	0	112.8	E51 G57	E51-D55 PolarHBondContact O-N 3.06Å; D55-G57 VanDerWaalsContact C-N 3.29Å
56	K	60.8	Low	70.3	Confident	147 Å²	147	107 Å²	107	64%	0.639	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.9	22	173.4	-63.6	-177.2	177.8	-169.8	0	113.3	K52 K54 S58 E59 V60	K52-K56 WeakPolarHBondContact O-CB 3.28Å; K52-K56 WeakPolarHBondContact O-CG 3.37Å; K52-K56 PolarHBondContact O-N 2.93Å; K54-K56 VanDerWaalsContact C-N 3.32Å; K54-K56 PolarHBondContact O-N 3.3Å; K56-S58 PolarHBondContact O-N 2.94Å; K56-E59 PolarHBondContact O-N 3.03Å; K56-V60 HydrophobicContact CB-CG2 4.46Å
57	G	52.7	Low	68.5	Low	67 Å²	67	103.9 Å²	103.9	69%	0.691	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63	35.9	-163.4	0	0	0	0	0	118.9	T53 K54 D55	T53-G57 PolarHBondContact O-N 3.2Å; K54-G57 PolarHBondContact O-N 3.02Å; D55-G57 VanDerWaalsContact C-N 3.29Å
58	S	51.2	Low	66.7	Low	106 Å²	106	104.1 Å²	104.1	74%	0.741	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-127.8	-12.9	162.2	-164.6	0	0	0	0	114.6	K56	K56-S58 PolarHBondContact O-N 2.94Å
59	E	53.8	Low	64.7	Low	156 Å²	156	109 Å²	109	73%	0.729	59%	0.585	S	S	*	*	T	Hydrogen-bonded Turn	trans	-114.9	-22.9	-169	-59.3	179.4	-165.3	0	0	114.3	K56	K56-E59 PolarHBondContact O-N 3.03Å
60	V	55.4	Low	63	Low	41 Å²	41	109.7 Å²	109.7	25%	0.248	59%	0.59	C	S	.	*	H	α-helix	trans	-88.5	-19	-173	-169.4	0	0	0	0	113.1	T53 K56 D62 L63 L64	T53-V60 HydrophobicContact CG2-CB 4.4Å; T53-V60 HydrophobicContact CG2-CG1 3.92Å; T53-V60 HydrophobicContact CG2-CG2 4.45Å; K56-V60 HydrophobicContact CB-CG2 4.46Å; V60-D62 PolarHBondContact O-N 3.42Å; V60-L63 PolarHBondContact O-N 3.18Å; V60-L64 HydrophobicContact CG1-CD1 4.44Å; V60-L64 PolarHBondContact O-N 3.31Å
61	G	53.6	Low	61.3	Low	46 Å²	46	110.1 Å²	110.1	47%	0.474	60%	0.597	S	S	.	*	H	α-helix	trans	-61.7	-27.9	175.5	0	0	0	0	0	113.2	N65	G61-N65 PolarHBondContact O-ND2 3.21Å
62	D	53.8	Low	59.8	Low	119 Å²	119	112.5 Å²	112.5	64%	0.636	61%	0.605	S	S	*	*	H	α-helix	trans	-81.7	-34.2	-178.7	-66.2	-27.7	0	0	0	112.3	V60 N65 D66	V60-D62 PolarHBondContact O-N 3.42Å; D62-N65 PolarHBondContact O-N 3.24Å; D62-D66 WeakPolarHBondContact O-CB 3.46Å; D62-D66 PolarHBondContact O-N 2.77Å
63	L	58.3	Low	58.7	Low	118 Å²	118	111.9 Å²	111.9	62%	0.618	61%	0.612	S	S	*	*	H	α-helix	trans	-72.2	-32.3	179.3	-68.3	168.5	0	0	0	113.6	V60 A67	V60-L63 PolarHBondContact O-N 3.18Å; L63-A67 WeakPolarHBondContact O-CB 3.46Å; L63-A67 PolarHBondContact O-N 2.73Å; L63-A67 VanDerWaalsContact O-N 3.08Å
64	L	59	Low	58.2	Low	115 Å²	115	112.7 Å²	112.7	60%	0.602	61%	0.614	S	S	*	*	H	α-helix	trans	-76	-29	176.9	-65.3	173.5	0	0	0	112.2	V60 S68	V60-L64 HydrophobicContact CG1-CD1 4.44Å; V60-L64 PolarHBondContact O-N 3.31Å; L64-S68 WeakPolarHBondContact O-CB 3.38Å; L64-S68 PolarHBondContact O-N 3.4Å; L64-S68 PolarHBondContact O-OG 3.27Å
65	N	55.7	Low	57.6	Low	98 Å²	98	111.4 Å²	111.4	52%	0.524	62%	0.618	S	S	.	*	H	α-helix	trans	-76.1	-32	172.9	-80.6	-37.6	0	0	0	112.1	G61 D62 R69	G61-N65 PolarHBondContact O-ND2 3.21Å; D62-N65 PolarHBondContact O-N 3.24Å; N65-R69 WeakPolarHBondContact O-CG 3.45Å; N65-R69 PolarHBondContact O-N 3.06Å
66	D	51.8	Low	57.4	Low	91 Å²	91	116.1 Å²	116.1	49%	0.487	63%	0.625	S	S	.	*	H	α-helix	trans	-73.3	-44.3	176.9	-146.9	24.8	0	0	0	111.5	D62 S68 R69	D62-D66 WeakPolarHBondContact O-CB 3.46Å; D62-D66 PolarHBondContact O-N 2.77Å; D66-S68 VanDerWaalsContact C-N 3.27Å; D66-S68 PolarHBondContact O-N 3.34Å; D66-R69 PolarHBondContact O-N 3.15Å
67	A	55.6	Low	57.5	Low	62 Å²	62	117.2 Å²	117.2	51%	0.512	63%	0.63	S	S	.	*	H	α-helix	trans	-64	-29.7	175.1	0	0	0	0	0	113.4	L63 R69	L63-A67 WeakPolarHBondContact O-CB 3.46Å; L63-A67 PolarHBondContact O-N 2.73Å; L63-A67 VanDerWaalsContact O-N 3.08Å; A67-R69 VanDerWaalsContact C-N 3.3Å
68	S	56.1	Low	57.7	Low	93 Å²	93	118.4 Å²	118.4	65%	0.65	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.8	-16	175.9	-66.3	0	0	0	0	113.5	L64 D66	L64-S68 WeakPolarHBondContact O-CB 3.38Å; L64-S68 PolarHBondContact O-N 3.4Å; L64-S68 PolarHBondContact O-OG 3.27Å; D66-S68 VanDerWaalsContact C-N 3.27Å; D66-S68 PolarHBondContact O-N 3.34Å
69	R	51.9	Low	58.1	Low	203 Å²	203	120.3 Å²	120.3	77%	0.766	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.5	-25.3	179.8	-76.2	174.3	178.5	178.6	1.4	113.2	N65 D66 A67	N65-R69 WeakPolarHBondContact O-CG 3.45Å; N65-R69 PolarHBondContact O-N 3.06Å; D66-R69 PolarHBondContact O-N 3.15Å; A67-R69 VanDerWaalsContact C-N 3.3Å
70	E	56.8	Low	58.3	Low	160 Å²	160	119 Å²	119	75%	0.748	64%	0.637	S	S	*	*	S	Bend	trans	-92.1	-7.3	-171.3	-65.5	-164	150.4	0	0	115.9
71	T	52.5	Low	58.3	Low	105 Å²	105	120.6 Å²	120.6	64%	0.644	66%	0.663	S	S	*	*			trans	-137.6	38.5	-175.7	58.3	0	0	0	0	115.6	V73	T71-V73 PolarHBondContact O-N 3.47Å
72	K	59.9	Low	58	Low	170 Å²	170	130 Å²	130	74%	0.739	70%	0.701	S	S	*	*			trans	-71	70.6	156.9	-165.7	178.8	179.5	-176.9	0	109.6	D74	K72-D74 PolarHBondContact O-N 3.49Å
73	V	63.4	Low	58.2	Low	112 Å²	112	130.6 Å²	130.6	68%	0.679	70%	0.704	S	S	*	*			trans	-73.7	99.3	166.4	-179.5	0	0	0	0	106	T71 V75	T71-V73 PolarHBondContact O-N 3.47Å; V73-V75 PolarHBondContact O-N 3.4Å
74	D	71.1	Confident	58.2	Low	70 Å²	70	131.2 Å²	131.2	37%	0.374	71%	0.709	S	S	.	*			trans	-68	94.3	172.1	-91.4	-22.2	0	0	0	108.7	K72 W76 K77	K72-D74 PolarHBondContact O-N 3.49Å; D74-W76 PolarHBondContact O-N 3.35Å; D74-K77 HydrophobicContact CB-CB 4.22Å; D74-K77 HydrophobicContact CB-CD 3.98Å; D74-K77 HydrophobicContact CB-CG 3.89Å; D74-K77 PolarHBondContact O-N 3.47Å; D74-K77 VanDerWaalsContact OD2-CE 3.29Å; D74-K77 WeakPolarHBondContact OD2-CE 3.18Å; D74-K77 IonicContact OD2-NZ 3.7Å
75	V	65.5	Low	58.2	Low	117 Å²	117	132.1 Å²	132.1	71%	0.709	72%	0.715	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.1	-19	175.3	175.2	0	0	0	0	112.8	V73	V73-V75 PolarHBondContact O-N 3.4Å
76	W	65.7	Low	58.3	Low	242 Å²	242	134.1 Å²	134.1	92%	0.917	73%	0.726	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.6	7.4	-174.8	-60.4	96.5	0	0	0	114.8	D74	D74-W76 PolarHBondContact O-N 3.35Å
77	K	64.6	Low	58.8	Low	170 Å²	170	136.8 Å²	136.8	74%	0.739	74%	0.741	S	S	*	*			trans	-91.6	9.2	178.7	-83.8	-169.6	179.1	-178.2	0	115.2	D74	D74-K77 HydrophobicContact CB-CB 4.22Å; D74-K77 HydrophobicContact CB-CD 3.98Å; D74-K77 HydrophobicContact CB-CG 3.89Å; D74-K77 PolarHBondContact O-N 3.47Å; D74-K77 VanDerWaalsContact OD2-CE 3.29Å; D74-K77 WeakPolarHBondContact OD2-CE 3.18Å; D74-K77 IonicContact OD2-NZ 3.7Å
78	A	56.6	Low	59	Low	93 Å²	93	141.8 Å²	141.8	77%	0.769	76%	0.756	S	S	*	*			trans	-108.8	84	175.5	0	0	0	0	0	110.5
79	D	58.1	Low	59.2	Low	145 Å²	145	145.3 Å²	145.3	78%	0.775	76%	0.764	S	S	*	*			trans	-176.3	123.4	134.1	-138.8	-9.4	0	0	0	109.1
80	V	59.8	Low	59.7	Low	128 Å²	128	140.8 Å²	140.8	78%	0.776	76%	0.763	S	S	*	*				177.4	112.2	105.1	-80.5	0	0	0	0	107.6
81	G	55.5	Low	60	Low	76 Å²	76	139.3 Å²	139.3	78%	0.784	77%	0.765	S	S	*	*			trans	-65.1	138	166.3	0	0	0	0	0	110.9
82	L	46.9	Very low	60.7	Low	243 Å²	243	142.4 Å²	142.4	100%	1.272	78%	0.776	S	S	*	*			trans	-144.3	0	159.8	-119.3	151.9	0	0	0	107.1

Retrieved 82 of 82 residues in 17.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).