A0A077Z0Y8_TRITR Loading...

Putative parathyroid hormone 2 receptor

AlphaFold DB , UniProt , Accession A0A077Z0Y8, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 116 aa.

						>A0A077Z0Y8_TRITR|A0A077Z0Y8
MLGEKEKLLKHEEWLLPSSKTDDGLASMRAIRKKQEKLMNLHLTLAQEEMTESILEDKLRKKIQENSKLLMDEFAELVEMIDEFNSRRRNSEASRQLGLDDLVQPGYDQNPDATSF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.8	Low	58.3	Low	213 Å²	213	139.5 Å²	139.5	100%	1.049	69%	0.686	S	S	*	*				0	33.2	0	-59.8	-149.8	-69.5	0	0	113.1	G3	M1-G3 PolarHBondContact O-N 3.41Å
2	L	54.3	Low	57.7	Low	159 Å²	159	139.8 Å²	139.8	83%	0.832	69%	0.685	S	S	*	*	H	α-helix	trans	-70	-17.7	177.6	-96.8	128	0	0	0	113.8	E4	L2-E4 PolarHBondContact O-N 3.47Å
3	G	65.6	Low	57.1	Low	44 Å²	44	141.2 Å²	141.2	45%	0.454	69%	0.689	S	S	.	*	H	α-helix	trans	-72.6	-21	-175.4	0	0	0	0	0	116.1	M1 K7	M1-G3 PolarHBondContact O-N 3.41Å; G3-K7 WeakPolarHBondContact O-CG 3.49Å; G3-K7 PolarHBondContact O-N 3.24Å
4	E	64.4	Low	56.7	Low	139 Å²	139	146.9 Å²	146.9	65%	0.65	70%	0.699	S	S	*	*	H	α-helix	trans	-78.6	-39	178	-74	-173.7	158.5	0	0	112.3	L2 E6 K7 L8	L2-E4 PolarHBondContact O-N 3.47Å; E4-E6 VanDerWaalsContact C-N 3.3Å; E4-E6 PolarHBondContact O-N 3.43Å; E4-K7 PolarHBondContact O-N 2.89Å; E4-L8 PolarHBondContact O-N 3.35Å; E4-L8 VanDerWaalsContact O-N 3.12Å
5	K	55.8	Low	56.4	Low	171 Å²	171	146.3 Å²	146.3	74%	0.743	70%	0.701	S	S	*	*	H	α-helix	trans	-63.5	-36.4	175.3	-87.4	-171.4	172.2	-177.1	0	112.4	K7 L8 L9	K5-K7 VanDerWaalsContact C-N 3.34Å; K5-L8 PolarHBondContact O-N 3.16Å; K5-L9 PolarHBondContact O-N 3.01Å; K5-L9 VanDerWaalsContact O-N 3.08Å
6	E	62.8	Low	55.9	Low	121 Å²	121	146.2 Å²	146.2	57%	0.565	70%	0.704	S	S	*	*	H	α-helix	trans	-70.1	-31.8	178	-159.5	-179.3	170.9	0	0	112.3	E4 K10	E4-E6 VanDerWaalsContact C-N 3.3Å; E4-E6 PolarHBondContact O-N 3.43Å; E6-K10 WeakPolarHBondContact O-CG 3.34Å; E6-K10 PolarHBondContact O-N 3.17Å
7	K	61.3	Low	55.4	Low	163 Å²	163	143.2 Å²	143.2	71%	0.709	70%	0.699	S	S	*	*	H	α-helix	trans	-68.6	-38.1	172.3	-74.8	-177.8	-179.3	-176.4	0	112.4	G3 E4 K5 K10 H11	G3-K7 WeakPolarHBondContact O-CG 3.49Å; G3-K7 PolarHBondContact O-N 3.24Å; E4-K7 PolarHBondContact O-N 2.89Å; K5-K7 VanDerWaalsContact C-N 3.34Å; K7-K10 PolarHBondContact O-N 3.44Å; K7-H11 PolarHBondContact O-N 2.91Å
8	L	59.6	Low	55.2	Low	128 Å²	128	142.4 Å²	142.4	67%	0.67	71%	0.711	S	S	*	*	H	α-helix	trans	-64.9	-43.2	175.5	-100	128.9	0	0	0	111.9	E4 K5 K10 H11 E12	E4-L8 PolarHBondContact O-N 3.35Å; E4-L8 VanDerWaalsContact O-N 3.12Å; K5-L8 PolarHBondContact O-N 3.16Å; L8-K10 VanDerWaalsContact C-N 3.32Å; L8-K10 PolarHBondContact O-N 3.32Å; L8-H11 PolarHBondContact O-N 3.3Å; L8-H11 VanDerWaalsContact O-N 3.1Å; L8-E12 PolarHBondContact O-N 3.39Å
9	L	57	Low	54.8	Low	126 Å²	126	138 Å²	138	66%	0.66	70%	0.695	S	S	*	*	H	α-helix	trans	-62.9	-38	177	-116.8	89.1	0	0	0	112.4	K5 H11 E12	K5-L9 PolarHBondContact O-N 3.01Å; K5-L9 VanDerWaalsContact O-N 3.08Å; L9-H11 PolarHBondContact O-N 2.97Å; L9-E12 PolarHBondContact O-N 3.4Å
10	K	56.4	Low	54.8	Low	131 Å²	131	141.8 Å²	141.8	57%	0.57	71%	0.707	S	S	*	*	H	α-helix	trans	-68	-20.9	176	-74.1	-176.7	-179.8	-179.9	0	113.5	E6 K7 L8	E6-K10 WeakPolarHBondContact O-CG 3.34Å; E6-K10 PolarHBondContact O-N 3.17Å; K7-K10 PolarHBondContact O-N 3.44Å; L8-K10 VanDerWaalsContact C-N 3.32Å; L8-K10 PolarHBondContact O-N 3.32Å
11	H	50.7	Low	55.3	Low	139 Å²	139	138.7 Å²	138.7	64%	0.644	70%	0.695	S	S	*	*	H	α-helix	trans	-82.6	-25.3	177.3	-151.7	-61.8	0	0	0	112.4	K7 L8 L9 E13	K7-H11 PolarHBondContact O-N 2.91Å; L8-H11 PolarHBondContact O-N 3.3Å; L8-H11 VanDerWaalsContact O-N 3.1Å; L9-H11 PolarHBondContact O-N 2.97Å; H11-E13 VanDerWaalsContact C-N 3.33Å
12	E	50.5	Low	56.3	Low	144 Å²	144	134.3 Å²	134.3	67%	0.673	68%	0.676	S	S	*	*	H	α-helix	trans	-71.4	-27.2	176.1	-108.9	179.3	163.7	0	0	112.9	L8 L9 W14 L15	L8-E12 PolarHBondContact O-N 3.39Å; L9-E12 PolarHBondContact O-N 3.4Å; E12-W14 PolarHBondContact O-N 2.86Å; E12-L15 PolarHBondContact O-N 3.33Å
13	E	50.5	Low	57.6	Low	157 Å²	157	133 Å²	133	73%	0.734	67%	0.67	S	S	*	*	G	3₁₀ helix	trans	-66.5	-19.5	-178.9	-154.4	170	-161.8	0	0	113.2	H11	H11-E13 VanDerWaalsContact C-N 3.33Å
14	W	50.8	Low	58.5	Low	221 Å²	221	131.7 Å²	131.7	84%	0.837	66%	0.656	S	S	*	*	G	3₁₀ helix	trans	-86.4	-10.2	-179.9	-76.5	88.6	0	0	0	115.1	E12	E12-W14 PolarHBondContact O-N 2.86Å
15	L	52.2	Low	59.6	Low	139 Å²	139	129 Å²	129	73%	0.728	65%	0.646	S	S	*	*	G	3₁₀ helix	trans	-104.2	8.9	-173	-81.5	169.6	0	0	0	115	E12 P17	E12-L15 PolarHBondContact O-N 3.33Å; L15-P17 WeakPolarHBondContact O-CD 3.37Å
16	L	48.1	Very low	61.2	Low	144 Å²	144	123.4 Å²	123.4	75%	0.754	63%	0.631	S	S	*	*			trans	-87.8	97.2	167.9	-79.5	155.9	0	0	0	109	S18	L16-S18 PolarHBondContact O-N 3.36Å
17	P	47.3	Very low	62.5	Low	95 Å²	95	120.6 Å²	120.6	62%	0.617	63%	0.625	S	S	*	*			trans	-58.4	118.6	169.1	23.1	-31.3	0	0	0	108.2	L15 S19	L15-P17 WeakPolarHBondContact O-CD 3.37Å; P17-S19 PolarHBondContact O-N 3.5Å
18	S	51.7	Low	63.8	Low	129 Å²	129	117.7 Å²	117.7	90%	0.902	62%	0.615	S	S	*	*	S	Bend	trans	-67.8	41.2	177.6	-179.8	0	0	0	0	112.9	L16	L16-S18 PolarHBondContact O-N 3.36Å
19	S	48.9	Very low	65.4	Low	59 Å²	59	118.9 Å²	118.9	41%	0.413	61%	0.611	S	S	.	*			trans	-122.2	83	174.6	59.5	0	0	0	0	109	P17 T21	P17-S19 PolarHBondContact O-N 3.5Å; S19-T21 PolarHBondContact O-N 3.4Å
20	K	53.8	Low	67.1	Low	214 Å²	214	115.2 Å²	115.2	93%	0.93	60%	0.599	S	S	*	*			trans	-69.6	42.5	166.4	-64.1	-179.4	178.2	176.3	0	111.6
21	T	64.8	Low	68.9	Low	76 Å²	76	112.9 Å²	112.9	47%	0.466	59%	0.592	S	S	.	*			trans	-83.6	148.5	167	51.6	0	0	0	0	108.3	S19 D23 G24 L25	S19-T21 PolarHBondContact O-N 3.4Å; T21-D23 PolarHBondContact O-N 3.37Å; T21-D23 VanDerWaalsContact O-N 3.14Å; T21-G24 WeakPolarHBondContact O-CA 3.3Å; T21-G24 PolarHBondContact O-N 3.1Å; T21-L25 PolarHBondContact O-N 3.4Å
22	D	74.8	Confident	71	Confident	122 Å²	122	115.2 Å²	115.2	65%	0.652	60%	0.595	S	S	*	*	H	α-helix	trans	-55.6	-31.2	178.4	-147.6	4.7	0	0	0	111	G24 L25 A26	D22-G24 VanDerWaalsContact C-N 3.35Å; D22-G24 PolarHBondContact O-N 3.43Å; D22-L25 PolarHBondContact O-N 2.91Å; D22-A26 WeakPolarHBondContact O-CB 3.47Å; D22-A26 PolarHBondContact O-N 3.06Å
23	D	82.5	Confident	73.2	Confident	131 Å²	131	115.5 Å²	115.5	70%	0.701	59%	0.594	S	S	*	*	H	α-helix	trans	-58.7	-39.9	170.7	-65.2	-22.5	0	0	0	113.3	T21 A26 S27	T21-D23 PolarHBondContact O-N 3.37Å; T21-D23 VanDerWaalsContact O-N 3.14Å; D23-A26 PolarHBondContact O-N 3.46Å; D23-S27 VanDerWaalsContact O-CB 3.25Å; D23-S27 WeakPolarHBondContact O-CB 3.31Å; D23-S27 PolarHBondContact O-N 3.37Å
24	G	85.2	Confident	75.3	Confident	16 Å²	16	115.6 Å²	115.6	17%	0.165	59%	0.592	C	S	.	*	H	α-helix	trans	-65.6	-42.3	176.4	0	0	0	0	0	112	T21 D22 S27 M28	T21-G24 WeakPolarHBondContact O-CA 3.3Å; T21-G24 PolarHBondContact O-N 3.1Å; D22-G24 VanDerWaalsContact C-N 3.35Å; D22-G24 PolarHBondContact O-N 3.43Å; G24-S27 PolarHBondContact O-N 3.26Å; G24-M28 WeakPolarHBondContact O-CG 3.47Å; G24-M28 PolarHBondContact O-N 3.29Å
25	L	87	Confident	77.5	Confident	84 Å²	84	110.9 Å²	110.9	44%	0.44	58%	0.579	S	S	.	*	H	α-helix	trans	-66.1	-42.6	174.7	-71.1	173.1	0	0	0	111.7	T21 D22 M28 R29	T21-L25 PolarHBondContact O-N 3.4Å; D22-L25 PolarHBondContact O-N 2.91Å; L25-M28 HydrophobicContact CD2-CE 3.84Å; L25-M28 PolarHBondContact O-N 3.14Å; L25-R29 WeakPolarHBondContact O-CG 3.31Å; L25-R29 PolarHBondContact O-N 3.41Å
26	A	89	Confident	79.6	Confident	52 Å²	52	109.5 Å²	109.5	43%	0.43	57%	0.569	S	S	.	*	H	α-helix	trans	-62.8	-43.9	176.6	0	0	0	0	0	111.5	D22 D23 R29 A30	D22-A26 WeakPolarHBondContact O-CB 3.47Å; D22-A26 PolarHBondContact O-N 3.06Å; D23-A26 PolarHBondContact O-N 3.46Å; A26-R29 PolarHBondContact O-N 3.44Å; A26-A30 WeakPolarHBondContact O-CB 3.37Å; A26-A30 PolarHBondContact O-N 2.97Å
27	S	89.7	Confident	81.9	Confident	63 Å²	63	110.5 Å²	110.5	44%	0.441	57%	0.567	S	S	.	*	H	α-helix	trans	-61.1	-47.1	175.3	-175.5	0	0	0	0	111.8	D23 G24 R29 A30 I31	D23-S27 VanDerWaalsContact O-CB 3.25Å; D23-S27 WeakPolarHBondContact O-CB 3.31Å; D23-S27 PolarHBondContact O-N 3.37Å; G24-S27 PolarHBondContact O-N 3.26Å; S27-R29 VanDerWaalsContact C-N 3.35Å; S27-R29 PolarHBondContact O-N 3.48Å; S27-A30 WeakPolarHBondContact O-CB 3.38Å; S27-A30 PolarHBondContact O-N 2.97Å; S27-A30 VanDerWaalsContact O-N 3.11Å; S27-I31 VanDerWaalsContact O-CG1 3.32Å; S27-I31 WeakPolarHBondContact O-CG1 3.27Å; S27-I31 PolarHBondContact O-N 2.96Å
28	M	90	Very high	84.2	Confident	101 Å²	101	110.4 Å²	110.4	50%	0.498	56%	0.561	S	S	.	*	H	α-helix	trans	-61.1	-40.7	176.1	-76.8	-172	-73.7	0	0	112.5	G24 L25 A30 I31 R32	G24-M28 WeakPolarHBondContact O-CG 3.47Å; G24-M28 PolarHBondContact O-N 3.29Å; L25-M28 HydrophobicContact CD2-CE 3.84Å; L25-M28 PolarHBondContact O-N 3.14Å; M28-A30 VanDerWaalsContact C-N 3.34Å; M28-A30 PolarHBondContact O-N 2.94Å; M28-I31 PolarHBondContact O-N 2.76Å; M28-R32 WeakPolarHBondContact O-CB 3.37Å; M28-R32 PolarHBondContact O-N 3.36Å
29	R	92.4	Very high	86.4	Confident	154 Å²	154	109.2 Å²	109.2	58%	0.581	54%	0.542	S	S	*	.	H	α-helix	trans	-63	-40.7	173.9	-72.3	-177.4	-132	161.5	6.7	111.6	L25 A26 S27 R32 K33	L25-R29 WeakPolarHBondContact O-CG 3.31Å; L25-R29 PolarHBondContact O-N 3.41Å; A26-R29 PolarHBondContact O-N 3.44Å; S27-R29 VanDerWaalsContact C-N 3.35Å; S27-R29 PolarHBondContact O-N 3.48Å; R29-R32 PolarHBondContact O-N 3.28Å; R29-K33 WeakPolarHBondContact O-CG 3.46Å; R29-K33 PolarHBondContact O-N 3.47Å
30	A	93.6	Very high	88.7	Confident	48 Å²	48	110.1 Å²	110.1	40%	0.397	54%	0.543	S	S	.	.	H	α-helix	trans	-66.6	-42.4	177.6	0	0	0	0	0	112	A26 S27 M28 K33 K34	A26-A30 WeakPolarHBondContact O-CB 3.37Å; A26-A30 PolarHBondContact O-N 2.97Å; S27-A30 WeakPolarHBondContact O-CB 3.38Å; S27-A30 PolarHBondContact O-N 2.97Å; S27-A30 VanDerWaalsContact O-N 3.11Å; M28-A30 VanDerWaalsContact C-N 3.34Å; M28-A30 PolarHBondContact O-N 2.94Å; A30-K33 PolarHBondContact O-N 2.73Å; A30-K34 WeakPolarHBondContact O-CG 3.41Å; A30-K34 PolarHBondContact O-N 2.9Å
31	I	93.8	Very high	90.7	Very high	83 Å²	83	104.4 Å²	104.4	43%	0.426	52%	0.522	S	S	.	.	H	α-helix	trans	-61.1	-47.7	174.1	-68.6	165.8	0	0	0	110	S27 M28 K33 K34 Q35	S27-I31 VanDerWaalsContact O-CG1 3.32Å; S27-I31 WeakPolarHBondContact O-CG1 3.27Å; S27-I31 PolarHBondContact O-N 2.96Å; M28-I31 PolarHBondContact O-N 2.76Å; I31-K33 VanDerWaalsContact C-N 3.34Å; I31-K33 PolarHBondContact O-N 3.18Å; I31-K34 WeakPolarHBondContact O-CB 3.42Å; I31-K34 PolarHBondContact O-N 3.44Å; I31-Q35 HydrophobicContact CG2-CG 4.29Å; I31-Q35 WeakPolarHBondContact O-CG 3.45Å; I31-Q35 PolarHBondContact O-N 2.86Å
32	R	94.2	Very high	92.2	Very high	187 Å²	187	106.2 Å²	106.2	71%	0.706	53%	0.525	S	S	*	.	H	α-helix	trans	-58.8	-43.6	178.4	-166.9	177.9	-159.8	160.4	6.3	112.2	M28 R29 K34 Q35 E36	M28-R32 WeakPolarHBondContact O-CB 3.37Å; M28-R32 PolarHBondContact O-N 3.36Å; R29-R32 PolarHBondContact O-N 3.28Å; R32-K34 VanDerWaalsContact C-N 3.34Å; R32-K34 PolarHBondContact O-N 2.91Å; R32-Q35 PolarHBondContact O-N 3.42Å; R32-E36 WeakPolarHBondContact O-CB 3.49Å; R32-E36 PolarHBondContact O-N 2.9Å
33	K	95.9	Very high	93.2	Very high	151 Å²	151	104.7 Å²	104.7	66%	0.657	52%	0.516	S	S	*	.	H	α-helix	trans	-61.8	-39.6	174.4	-75.5	179.5	177.3	-174.5	0	112.5	R29 A30 I31 K37	R29-K33 WeakPolarHBondContact O-CG 3.46Å; R29-K33 PolarHBondContact O-N 3.47Å; A30-K33 PolarHBondContact O-N 2.73Å; I31-K33 VanDerWaalsContact C-N 3.34Å; I31-K33 PolarHBondContact O-N 3.18Å; K33-K37 WeakPolarHBondContact O-CB 3.34Å; K33-K37 PolarHBondContact O-N 2.89Å
34	K	96.1	Very high	93.9	Very high	158 Å²	158	101.4 Å²	101.4	69%	0.687	50%	0.501	S	S	*	.	H	α-helix	trans	-66.7	-42.2	175.4	-73.9	-179.5	178.6	-176.6	0	111.7	A30 I31 R32 K37 L38	A30-K34 WeakPolarHBondContact O-CG 3.41Å; A30-K34 PolarHBondContact O-N 2.9Å; I31-K34 WeakPolarHBondContact O-CB 3.42Å; I31-K34 PolarHBondContact O-N 3.44Å; R32-K34 VanDerWaalsContact C-N 3.34Å; R32-K34 PolarHBondContact O-N 2.91Å; K34-K37 PolarHBondContact O-N 2.87Å; K34-L38 WeakPolarHBondContact O-CB 3.43Å; K34-L38 PolarHBondContact O-N 3.16Å
35	Q	95.8	Very high	94.4	Very high	122 Å²	122	104.6 Å²	104.6	57%	0.57	51%	0.514	S	S	*	.	H	α-helix	trans	-63.3	-43.7	175.8	-73.4	174.8	-30.3	0	0	111.7	I31 R32 L38 M39	I31-Q35 HydrophobicContact CG2-CG 4.29Å; I31-Q35 WeakPolarHBondContact O-CG 3.45Å; I31-Q35 PolarHBondContact O-N 2.86Å; R32-Q35 PolarHBondContact O-N 3.42Å; Q35-L38 PolarHBondContact O-N 2.86Å; Q35-M39 WeakPolarHBondContact O-CB 3.46Å; Q35-M39 PolarHBondContact O-N 2.64Å
36	E	96	Very high	94.7	Very high	111 Å²	111	103.2 Å²	103.2	52%	0.519	52%	0.515	S	S	.	.	H	α-helix	trans	-62.8	-44.6	175.6	-177.5	174.9	-159.4	0	0	111.7	R32 L38 M39 N40	R32-E36 WeakPolarHBondContact O-CB 3.49Å; R32-E36 PolarHBondContact O-N 2.9Å; E36-L38 VanDerWaalsContact C-N 3.33Å; E36-L38 PolarHBondContact O-N 3.36Å; E36-M39 PolarHBondContact O-N 2.97Å; E36-N40 WeakPolarHBondContact O-CB 3.23Å; E36-N40 VanDerWaalsContact O-CG 3.3Å; E36-N40 PolarHBondContact O-N 3.45Å; E36-N40 PolarHBondContact O-ND2 3.2Å
37	K	96.6	Very high	94.9	Very high	164 Å²	164	106.6 Å²	106.6	71%	0.713	52%	0.521	S	S	*	.	H	α-helix	trans	-60.8	-42.1	174.7	-172.4	177.6	-178.7	-179.1	0	112	K33 K34 L41	K33-K37 WeakPolarHBondContact O-CB 3.34Å; K33-K37 PolarHBondContact O-N 2.89Å; K34-K37 PolarHBondContact O-N 2.87Å; K37-L41 WeakPolarHBondContact O-CB 3.3Å; K37-L41 PolarHBondContact O-N 2.99Å
38	L	97	Very high	95.1	Very high	93 Å²	93	108.9 Å²	108.9	49%	0.487	53%	0.525	S	S	.	.	H	α-helix	trans	-66.7	-42.5	177.9	-177	62.2	0	0	0	111.5	K34 Q35 E36 L41 H42	K34-L38 WeakPolarHBondContact O-CB 3.43Å; K34-L38 PolarHBondContact O-N 3.16Å; Q35-L38 PolarHBondContact O-N 2.86Å; E36-L38 VanDerWaalsContact C-N 3.33Å; E36-L38 PolarHBondContact O-N 3.36Å; L38-L41 WeakPolarHBondContact O-CB 3.31Å; L38-L41 PolarHBondContact O-N 3.42Å; L38-H42 PolarHBondContact O-CD2 3Å; L38-H42 PolarHBondContact O-N 2.98Å
39	M	97.3	Very high	95.2	Very high	104 Å²	104	110.8 Å²	110.8	51%	0.512	53%	0.533	S	S	.	.	H	α-helix	trans	-59.8	-47.2	175	-176.8	-173.3	72.1	0	0	111.2	Q35 E36 L41 H42 L43	Q35-M39 WeakPolarHBondContact O-CB 3.46Å; Q35-M39 PolarHBondContact O-N 2.64Å; E36-M39 PolarHBondContact O-N 2.97Å; M39-L41 VanDerWaalsContact C-N 3.31Å; M39-L41 PolarHBondContact O-N 3.41Å; M39-H42 PolarHBondContact O-N 3.38Å; M39-L43 HydrophobicContact CG-CD1 3.97Å; M39-L43 WeakPolarHBondContact O-CD1 3.46Å; M39-L43 PolarHBondContact O-N 3.43Å
40	N	97	Very high	95.3	Very high	79 Å²	79	109.5 Å²	109.5	42%	0.422	54%	0.535	S	S	.	.	H	α-helix	trans	-61.4	-39.8	176.8	-71.3	-19.6	0	0	0	111.9	E36 L43 T44	E36-N40 WeakPolarHBondContact O-CB 3.23Å; E36-N40 VanDerWaalsContact O-CG 3.3Å; E36-N40 PolarHBondContact O-N 3.45Å; E36-N40 PolarHBondContact O-ND2 3.2Å; N40-L43 PolarHBondContact O-N 2.98Å; N40-T44 PolarHBondContact O-N 3.41Å; N40-T44 PolarHBondContact O-OG1 3.19Å; N40-T44 VanDerWaalsContact O-OG1 3.13Å
41	L	96.6	Very high	95.2	Very high	93 Å²	93	111 Å²	111	49%	0.487	54%	0.539	S	S	.	.	H	α-helix	trans	-61.8	-44.1	174.3	-178.9	64.6	0	0	0	111.7	K37 L38 M39 L43 T44 L45	K37-L41 WeakPolarHBondContact O-CB 3.3Å; K37-L41 PolarHBondContact O-N 2.99Å; L38-L41 WeakPolarHBondContact O-CB 3.31Å; L38-L41 PolarHBondContact O-N 3.42Å; M39-L41 VanDerWaalsContact C-N 3.31Å; M39-L41 PolarHBondContact O-N 3.41Å; L41-L43 VanDerWaalsContact C-N 3.35Å; L41-L43 PolarHBondContact O-N 3.06Å; L41-T44 PolarHBondContact O-N 3.4Å; L41-L45 HydrophobicContact CD1-CD1 4.36Å; L41-L45 HydrophobicContact CD1-CG 4.39Å; L41-L45 HydrophobicContact CG-CD1 4.1Å; L41-L45 WeakPolarHBondContact O-CG 3.03Å; L41-L45 PolarHBondContact O-N 3.5Å
42	H	95.8	Very high	95.1	Very high	114 Å²	114	112.9 Å²	112.9	53%	0.528	55%	0.546	S	S	.	.	H	α-helix	trans	-63.5	-39.3	176.1	-74.8	-60.7	0	0	0	112.6	L38 M39 L45 A46	L38-H42 PolarHBondContact O-CD2 3Å; L38-H42 PolarHBondContact O-N 2.98Å; M39-H42 PolarHBondContact O-N 3.38Å; H42-L45 PolarHBondContact O-N 2.97Å; H42-A46 WeakPolarHBondContact O-CB 3.49Å; H42-A46 PolarHBondContact O-N 3.18Å
43	L	96.6	Very high	94.9	Very high	90 Å²	90	106.7 Å²	106.7	47%	0.471	53%	0.532	S	S	.	.	H	α-helix	trans	-60.9	-45.4	173.8	-83.5	145.8	0	0	0	111.6	M39 N40 L41 Q47	M39-L43 HydrophobicContact CG-CD1 3.97Å; M39-L43 WeakPolarHBondContact O-CD1 3.46Å; M39-L43 PolarHBondContact O-N 3.43Å; N40-L43 PolarHBondContact O-N 2.98Å; L41-L43 VanDerWaalsContact C-N 3.35Å; L41-L43 PolarHBondContact O-N 3.06Å; L43-Q47 VanDerWaalsContact O-CG 3.3Å; L43-Q47 WeakPolarHBondContact O-CG 3.42Å; L43-Q47 PolarHBondContact O-N 3.06Å; L43-Q47 VanDerWaalsContact O-N 3.1Å
44	T	95.9	Very high	94.8	Very high	63 Å²	63	104 Å²	104	39%	0.387	52%	0.523	S	S	.	.	H	α-helix	trans	-62.6	-48.5	176.6	-60.6	0	0	0	0	111.6	N40 L41 A46 Q47 E48	N40-T44 PolarHBondContact O-N 3.41Å; N40-T44 PolarHBondContact O-OG1 3.19Å; N40-T44 VanDerWaalsContact O-OG1 3.13Å; L41-T44 PolarHBondContact O-N 3.4Å; T44-A46 VanDerWaalsContact C-N 3.34Å; T44-A46 PolarHBondContact O-N 3.39Å; T44-Q47 WeakPolarHBondContact O-CB 3.4Å; T44-Q47 PolarHBondContact O-N 2.89Å; T44-Q47 VanDerWaalsContact O-N 3.14Å; T44-E48 HydrophobicContact CG2-CG 4.48Å; T44-E48 WeakPolarHBondContact O-CG 3.48Å; T44-E48 PolarHBondContact O-N 3.08Å
45	L	95.1	Very high	94.5	Very high	83 Å²	83	101.6 Å²	101.6	44%	0.435	52%	0.518	S	S	.	.	H	α-helix	trans	-61.8	-40.7	180	-71.3	172	0	0	0	112.1	L41 H42 Q47 E48 E49	L41-L45 HydrophobicContact CD1-CD1 4.36Å; L41-L45 HydrophobicContact CD1-CG 4.39Å; L41-L45 HydrophobicContact CG-CD1 4.1Å; L41-L45 WeakPolarHBondContact O-CG 3.03Å; L41-L45 PolarHBondContact O-N 3.5Å; H42-L45 PolarHBondContact O-N 2.97Å; L45-Q47 VanDerWaalsContact C-N 3.31Å; L45-Q47 PolarHBondContact O-N 2.93Å; L45-E48 PolarHBondContact O-N 3.36Å; L45-E49 WeakPolarHBondContact O-CB 3.28Å; L45-E49 PolarHBondContact O-N 2.92Å
46	A	93.6	Very high	94.4	Very high	55 Å²	55	99.8 Å²	99.8	46%	0.455	51%	0.509	S	S	.	.	H	α-helix	trans	-65	-35.2	176.2	0	0	0	0	0	112.5	H42 T44 M50	H42-A46 WeakPolarHBondContact O-CB 3.49Å; H42-A46 PolarHBondContact O-N 3.18Å; T44-A46 VanDerWaalsContact C-N 3.34Å; T44-A46 PolarHBondContact O-N 3.39Å; A46-M50 WeakPolarHBondContact O-CB 3.37Å; A46-M50 PolarHBondContact O-N 3.45Å; A46-M50 VanDerWaalsContact O-N 3.07Å
47	Q	94	Very high	94.3	Very high	122 Å²	122	98 Å²	98	57%	0.57	50%	0.503	S	S	*	.	H	α-helix	trans	-69.2	-39.4	174.1	-73.6	173.5	-15.4	0	0	112.1	L43 T44 L45 T51	L43-Q47 VanDerWaalsContact O-CG 3.3Å; L43-Q47 WeakPolarHBondContact O-CG 3.42Å; L43-Q47 PolarHBondContact O-N 3.06Å; L43-Q47 VanDerWaalsContact O-N 3.1Å; T44-Q47 WeakPolarHBondContact O-CB 3.4Å; T44-Q47 PolarHBondContact O-N 2.89Å; T44-Q47 VanDerWaalsContact O-N 3.14Å; L45-Q47 VanDerWaalsContact C-N 3.31Å; L45-Q47 PolarHBondContact O-N 2.93Å; Q47-T51 WeakPolarHBondContact O-CB 3.4Å; Q47-T51 PolarHBondContact O-N 3.05Å; Q47-T51 PolarHBondContact O-OG1 3.27Å
48	E	93.9	Very high	94.1	Very high	112 Å²	112	96.2 Å²	96.2	52%	0.523	50%	0.495	S	S	.	.	H	α-helix	trans	-63.1	-49.2	175.4	-73.4	174.9	180	0	0	111	T44 L45 M50 T51 E52	T44-E48 HydrophobicContact CG2-CG 4.48Å; T44-E48 WeakPolarHBondContact O-CG 3.48Å; T44-E48 PolarHBondContact O-N 3.08Å; L45-E48 PolarHBondContact O-N 3.36Å; E48-M50 PolarHBondContact O-N 3.44Å; E48-T51 PolarHBondContact O-N 3.5Å; E48-T51 VanDerWaalsContact O-N 3.11Å; E48-E52 WeakPolarHBondContact O-CB 3.47Å; E48-E52 PolarHBondContact O-N 3.32Å
49	E	92.9	Very high	94	Very high	141 Å²	141	96.9 Å²	96.9	66%	0.659	50%	0.499	S	S	*	.	H	α-helix	trans	-59.7	-43.6	177.3	-174.9	179.7	-175.6	0	0	112	L45 T51 E52 S53	L45-E49 WeakPolarHBondContact O-CB 3.28Å; L45-E49 PolarHBondContact O-N 2.92Å; E49-T51 VanDerWaalsContact C-N 3.32Å; E49-T51 PolarHBondContact O-N 2.98Å; E49-E52 PolarHBondContact O-N 3.42Å; E49-S53 WeakPolarHBondContact O-CB 3.41Å; E49-S53 PolarHBondContact O-N 3.42Å
50	M	93	Very high	93.9	Very high	127 Å²	127	97.6 Å²	97.6	63%	0.626	50%	0.496	S	S	*	.	H	α-helix	trans	-62.2	-40.6	175.2	-177.7	179.1	179.4	0	0	111.8	A46 E48 I54	A46-M50 WeakPolarHBondContact O-CB 3.37Å; A46-M50 PolarHBondContact O-N 3.45Å; A46-M50 VanDerWaalsContact O-N 3.07Å; E48-M50 PolarHBondContact O-N 3.44Å; M50-I54 HydrophobicContact CE-CD1 4.2Å; M50-I54 HydrophobicContact CG-CD1 4.1Å; M50-I54 WeakPolarHBondContact O-CD1 3.38Å; M50-I54 VanDerWaalsContact O-CG1 3.24Å; M50-I54 WeakPolarHBondContact O-CG1 3.32Å; M50-I54 PolarHBondContact O-N 3.08Å; M50-I54 VanDerWaalsContact O-N 3.1Å
51	T	92.2	Very high	93.8	Very high	79 Å²	79	100 Å²	100	49%	0.485	50%	0.503	S	S	.	.	H	α-helix	trans	-68.8	-42.8	179.6	-57.7	0	0	0	0	111.2	Q47 E48 E49 I54 L55	Q47-T51 WeakPolarHBondContact O-CB 3.4Å; Q47-T51 PolarHBondContact O-N 3.05Å; Q47-T51 PolarHBondContact O-OG1 3.27Å; E48-T51 PolarHBondContact O-N 3.5Å; E48-T51 VanDerWaalsContact O-N 3.11Å; E49-T51 VanDerWaalsContact C-N 3.32Å; E49-T51 PolarHBondContact O-N 2.98Å; T51-I54 PolarHBondContact O-N 3.42Å; T51-L55 HydrophobicContact CG2-CD1 4.29Å; T51-L55 WeakPolarHBondContact O-CG 3.48Å; T51-L55 PolarHBondContact O-N 2.89Å
52	E	91.8	Very high	93.8	Very high	122 Å²	122	100.9 Å²	100.9	57%	0.57	50%	0.502	S	S	*	.	H	α-helix	trans	-60.2	-47.7	175.3	-174.6	170.7	-158.5	0	0	110.9	E48 E49 I54 L55 E56	E48-E52 WeakPolarHBondContact O-CB 3.47Å; E48-E52 PolarHBondContact O-N 3.32Å; E49-E52 PolarHBondContact O-N 3.42Å; E52-I54 VanDerWaalsContact C-N 3.33Å; E52-I54 PolarHBondContact O-N 3.02Å; E52-L55 PolarHBondContact O-N 2.96Å; E52-L55 VanDerWaalsContact O-N 3.08Å; E52-E56 WeakPolarHBondContact O-CG 3.43Å; E52-E56 PolarHBondContact O-N 3.19Å
53	S	90.8	Very high	93.9	Very high	58 Å²	58	99.9 Å²	99.9	41%	0.406	50%	0.5	S	S	.	.	H	α-helix	trans	-56.3	-43.8	175.6	172.2	0	0	0	0	112.7	E49 L55 E56 D57	E49-S53 WeakPolarHBondContact O-CB 3.41Å; E49-S53 PolarHBondContact O-N 3.42Å; S53-L55 PolarHBondContact O-N 3.24Å; S53-E56 PolarHBondContact O-N 3.04Å; S53-D57 PolarHBondContact O-N 2.85Å
54	I	92	Very high	93.9	Very high	94 Å²	94	102 Å²	102	48%	0.482	51%	0.508	S	S	.	.	H	α-helix	trans	-64.2	-40.4	177.1	-69.6	164.6	0	0	0	111.4	M50 T51 E52 D57 K58	M50-I54 HydrophobicContact CE-CD1 4.2Å; M50-I54 HydrophobicContact CG-CD1 4.1Å; M50-I54 WeakPolarHBondContact O-CD1 3.38Å; M50-I54 VanDerWaalsContact O-CG1 3.24Å; M50-I54 WeakPolarHBondContact O-CG1 3.32Å; M50-I54 PolarHBondContact O-N 3.08Å; M50-I54 VanDerWaalsContact O-N 3.1Å; T51-I54 PolarHBondContact O-N 3.42Å; E52-I54 VanDerWaalsContact C-N 3.33Å; E52-I54 PolarHBondContact O-N 3.02Å; I54-D57 PolarHBondContact O-N 2.86Å; I54-K58 WeakPolarHBondContact O-CB 3.38Å; I54-K58 PolarHBondContact O-N 3.45Å
55	L	91	Very high	93.9	Very high	108 Å²	108	104.7 Å²	104.7	57%	0.565	52%	0.516	S	S	*	.	H	α-helix	trans	-67.3	-42.6	178.7	-72.8	173	0	0	0	111.7	T51 E52 S53 K58 L59	T51-L55 HydrophobicContact CG2-CD1 4.29Å; T51-L55 WeakPolarHBondContact O-CG 3.48Å; T51-L55 PolarHBondContact O-N 2.89Å; E52-L55 PolarHBondContact O-N 2.96Å; E52-L55 VanDerWaalsContact O-N 3.08Å; S53-L55 PolarHBondContact O-N 3.24Å; L55-K58 PolarHBondContact O-N 3.3Å; L55-L59 PolarHBondContact O-N 3.42Å
56	E	93	Very high	94	Very high	84 Å²	84	105.3 Å²	105.3	39%	0.393	52%	0.52	S	S	.	.	H	α-helix	trans	-60.9	-45.1	174.7	-70.3	-167.7	168.1	0	0	111.9	E52 S53 K58 L59 R60	E52-E56 WeakPolarHBondContact O-CG 3.43Å; E52-E56 PolarHBondContact O-N 3.19Å; S53-E56 PolarHBondContact O-N 3.04Å; E56-K58 VanDerWaalsContact C-N 3.31Å; E56-K58 PolarHBondContact O-N 3.46Å; E56-L59 PolarHBondContact O-N 3.39Å; E56-L59 VanDerWaalsContact O-N 3.16Å; E56-R60 VanDerWaalsContact CB-NH2 3.28Å; E56-R60 WeakPolarHBondContact O-CG 3.44Å; E56-R60 PolarHBondContact O-N 2.94Å; E56-R60 IonicContact OE2-CZ 3.66Å; E56-R60 IonicContact OE2-NH1 3.21Å; E56-R60 PolarHBondContact OE2-NH1 3.14Å; E56-R60 IonicContact OE2-NH2 2.73Å; E56-R60 PolarHBondContact OE2-NH2 3.19Å
57	D	93.7	Very high	94.2	Very high	72 Å²	72	105.7 Å²	105.7	39%	0.385	52%	0.519	S	S	.	.	H	α-helix	trans	-64.8	-36.8	179.3	-79.3	-3.7	0	0	0	112.2	S53 I54 L59 R60 K61	S53-D57 PolarHBondContact O-N 2.85Å; I54-D57 PolarHBondContact O-N 2.86Å; D57-L59 VanDerWaalsContact C-N 3.34Å; D57-R60 PolarHBondContact O-N 3.19Å; D57-R60 IonicContact OD1-CZ 3.33Å; D57-R60 IonicContact OD1-NE 2.94Å; D57-R60 PolarHBondContact OD1-NE 2.98Å; D57-R60 IonicContact OD1-NH2 2.83Å; D57-R60 PolarHBondContact OD1-NH2 3.41Å; D57-K61 VanDerWaalsContact O-CG 3.32Å; D57-K61 WeakPolarHBondContact O-CG 3.39Å; D57-K61 PolarHBondContact O-N 2.83Å
58	K	93.8	Very high	94.4	Very high	128 Å²	128	106.4 Å²	106.4	56%	0.557	52%	0.52	S	S	*	.	H	α-helix	trans	-63.7	-41.1	173.3	-173.3	178	-177.4	177.5	0	111.6	I54 L55 E56 K62	I54-K58 WeakPolarHBondContact O-CB 3.38Å; I54-K58 PolarHBondContact O-N 3.45Å; L55-K58 PolarHBondContact O-N 3.3Å; E56-K58 VanDerWaalsContact C-N 3.31Å; E56-K58 PolarHBondContact O-N 3.46Å; K58-K62 PolarHBondContact O-N 3.16Å; K58-K62 VanDerWaalsContact O-N 3.14Å
59	L	93.8	Very high	94.5	Very high	107 Å²	107	105.8 Å²	105.8	56%	0.56	52%	0.52	S	S	*	.	H	α-helix	trans	-67.9	-43.9	177	-174.9	63.8	0	0	0	111.3	L55 E56 D57 K61 K62 I63	L55-L59 PolarHBondContact O-N 3.42Å; E56-L59 PolarHBondContact O-N 3.39Å; E56-L59 VanDerWaalsContact O-N 3.16Å; D57-L59 VanDerWaalsContact C-N 3.34Å; L59-K61 VanDerWaalsContact C-N 3.33Å; L59-K61 PolarHBondContact O-N 2.94Å; L59-K62 PolarHBondContact O-N 2.83Å; L59-I63 HydrophobicContact CG-CD1 4.18Å; L59-I63 WeakPolarHBondContact O-CG1 3.41Å; L59-I63 PolarHBondContact O-N 3.5Å
60	R	95.4	Very high	94.7	Very high	118 Å²	118	103.3 Å²	103.3	45%	0.445	51%	0.511	S	S	.	.	H	α-helix	trans	-56.5	-45.4	175.1	-77.3	-172.3	-88.3	-97.7	3.9	111.7	E56 D57 I63 Q64	E56-R60 VanDerWaalsContact CB-NH2 3.28Å; E56-R60 WeakPolarHBondContact O-CG 3.44Å; E56-R60 PolarHBondContact O-N 2.94Å; E56-R60 IonicContact OE2-CZ 3.66Å; E56-R60 IonicContact OE2-NH1 3.21Å; E56-R60 PolarHBondContact OE2-NH1 3.14Å; E56-R60 IonicContact OE2-NH2 2.73Å; E56-R60 PolarHBondContact OE2-NH2 3.19Å; D57-R60 PolarHBondContact O-N 3.19Å; D57-R60 IonicContact OD1-CZ 3.33Å; D57-R60 IonicContact OD1-NE 2.94Å; D57-R60 PolarHBondContact OD1-NE 2.98Å; D57-R60 IonicContact OD1-NH2 2.83Å; D57-R60 PolarHBondContact OD1-NH2 3.41Å; R60-I63 PolarHBondContact O-N 2.96Å; R60-Q64 WeakPolarHBondContact O-CG 3.46Å; R60-Q64 PolarHBondContact O-N 3.42Å
61	K	95.7	Very high	94.9	Very high	131 Å²	131	103.3 Å²	103.3	57%	0.57	51%	0.51	S	S	*	.	H	α-helix	trans	-60	-45.8	175.3	-74.5	175.3	-176.7	179.5	0	112.4	D57 L59 I63 Q64 E65	D57-K61 VanDerWaalsContact O-CG 3.32Å; D57-K61 WeakPolarHBondContact O-CG 3.39Å; D57-K61 PolarHBondContact O-N 2.83Å; L59-K61 VanDerWaalsContact C-N 3.33Å; L59-K61 PolarHBondContact O-N 2.94Å; K61-I63 VanDerWaalsContact C-N 3.33Å; K61-I63 PolarHBondContact O-N 3.03Å; K61-Q64 PolarHBondContact O-N 2.94Å; K61-E65 WeakPolarHBondContact O-CG 3.43Å; K61-E65 PolarHBondContact O-N 3.02Å
62	K	96.7	Very high	95.2	Very high	111 Å²	111	103.1 Å²	103.1	48%	0.483	51%	0.506	S	S	.	.	H	α-helix	trans	-61	-40.3	176.4	-77	-175.3	171.9	-167.3	0	113	K58 L59 Q64 E65 N66	K58-K62 PolarHBondContact O-N 3.16Å; K58-K62 VanDerWaalsContact O-N 3.14Å; L59-K62 PolarHBondContact O-N 2.83Å; K62-Q64 VanDerWaalsContact C-N 3.33Å; K62-E65 PolarHBondContact O-N 3.43Å; K62-N66 WeakPolarHBondContact O-CB 3.24Å; K62-N66 VanDerWaalsContact O-CG 3.23Å; K62-N66 PolarHBondContact O-N 2.88Å
63	I	96.2	Very high	95.4	Very high	93 Å²	93	102.6 Å²	102.6	48%	0.477	50%	0.504	S	S	.	.	H	α-helix	trans	-61.8	-45.7	176.1	-69.3	166.9	0	0	0	109.7	L59 R60 K61 N66 S67	L59-I63 HydrophobicContact CG-CD1 4.18Å; L59-I63 WeakPolarHBondContact O-CG1 3.41Å; L59-I63 PolarHBondContact O-N 3.5Å; R60-I63 PolarHBondContact O-N 2.96Å; K61-I63 VanDerWaalsContact C-N 3.33Å; K61-I63 PolarHBondContact O-N 3.03Å; I63-N66 PolarHBondContact O-N 3.36Å; I63-S67 WeakPolarHBondContact O-CB 3.49Å; I63-S67 PolarHBondContact O-N 3.48Å; I63-S67 PolarHBondContact O-OG 3.33Å; I63-S67 VanDerWaalsContact O-OG 3.08Å
64	Q	96.7	Very high	95.7	Very high	135 Å²	135	105.7 Å²	105.7	63%	0.631	51%	0.51	S	S	*	.	H	α-helix	trans	-63.1	-43.1	177.9	-71.2	175.5	-19.2	0	0	112.7	R60 K61 K62 S67 K68	R60-Q64 WeakPolarHBondContact O-CG 3.46Å; R60-Q64 PolarHBondContact O-N 3.42Å; K61-Q64 PolarHBondContact O-N 2.94Å; K62-Q64 VanDerWaalsContact C-N 3.33Å; Q64-S67 PolarHBondContact O-N 3.08Å; Q64-K68 PolarHBondContact O-N 3.02Å
65	E	97	Very high	95.9	Very high	118 Å²	118	103.6 Å²	103.6	55%	0.551	51%	0.507	S	S	*	.	H	α-helix	trans	-60.4	-47.9	175.2	-73.5	168	-174.3	0	0	111.4	K61 K62 K68 L69	K61-E65 WeakPolarHBondContact O-CG 3.43Å; K61-E65 PolarHBondContact O-N 3.02Å; K62-E65 PolarHBondContact O-N 3.43Å; E65-K68 WeakPolarHBondContact O-CB 3.37Å; E65-K68 PolarHBondContact O-N 3.44Å; E65-L69 WeakPolarHBondContact O-CG 3.49Å; E65-L69 PolarHBondContact O-N 3.42Å
66	N	97.2	Very high	96.2	Very high	97 Å²	97	104.7 Å²	104.7	52%	0.519	51%	0.509	S	S	.	.	H	α-helix	trans	-63.7	-42.5	177.4	-71.8	-7.9	0	0	0	112.1	K62 I63 K68 L69 L70	K62-N66 WeakPolarHBondContact O-CB 3.24Å; K62-N66 VanDerWaalsContact O-CG 3.23Å; K62-N66 PolarHBondContact O-N 2.88Å; I63-N66 PolarHBondContact O-N 3.36Å; N66-K68 VanDerWaalsContact C-N 3.28Å; N66-K68 PolarHBondContact O-N 2.99Å; N66-L69 PolarHBondContact O-N 3.07Å; N66-L70 WeakPolarHBondContact O-CG 3.47Å; N66-L70 PolarHBondContact O-N 3.01Å
67	S	97.7	Very high	96.4	Very high	62 Å²	62	105.1 Å²	105.1	43%	0.434	51%	0.514	S	S	.	.	H	α-helix	trans	-60.9	-39.1	175.6	-68.1	0	0	0	0	111.6	I63 Q64 L70 M71	I63-S67 WeakPolarHBondContact O-CB 3.49Å; I63-S67 PolarHBondContact O-N 3.48Å; I63-S67 PolarHBondContact O-OG 3.33Å; I63-S67 VanDerWaalsContact O-OG 3.08Å; Q64-S67 PolarHBondContact O-N 3.08Å; S67-L70 PolarHBondContact O-N 3.32Å; S67-M71 VanDerWaalsContact O-CG 3.28Å; S67-M71 WeakPolarHBondContact O-CG 3.35Å; S67-M71 PolarHBondContact O-N 2.85Å
68	K	97.5	Very high	96.5	Very high	137 Å²	137	105.5 Å²	105.5	60%	0.596	52%	0.518	S	S	*	.	H	α-helix	trans	-63.1	-49.6	175.5	-175.6	-176.3	173.6	-171.1	0	111.4	Q64 E65 N66 L70 M71 D72	Q64-K68 PolarHBondContact O-N 3.02Å; E65-K68 WeakPolarHBondContact O-CB 3.37Å; E65-K68 PolarHBondContact O-N 3.44Å; N66-K68 VanDerWaalsContact C-N 3.28Å; N66-K68 PolarHBondContact O-N 2.99Å; K68-L70 VanDerWaalsContact C-N 3.3Å; K68-L70 PolarHBondContact O-N 3.11Å; K68-M71 PolarHBondContact O-N 3.1Å; K68-M71 VanDerWaalsContact O-N 3.08Å; K68-D72 PolarHBondContact O-N 3.33Å
69	L	97	Very high	96.7	Very high	100 Å²	100	106 Å²	106	52%	0.524	52%	0.523	S	S	.	.	H	α-helix	trans	-56.9	-44	178	-70.1	172	0	0	0	111.9	E65 N66 M71 D72 E73	E65-L69 WeakPolarHBondContact O-CG 3.49Å; E65-L69 PolarHBondContact O-N 3.42Å; N66-L69 PolarHBondContact O-N 3.07Å; L69-M71 VanDerWaalsContact C-N 3.34Å; L69-M71 PolarHBondContact O-N 3.42Å; L69-D72 PolarHBondContact O-N 3.25Å; L69-E73 WeakPolarHBondContact O-CG 3.35Å; L69-E73 PolarHBondContact O-N 3.12Å
70	L	97.4	Very high	96.8	Very high	89 Å²	89	106.6 Å²	106.6	47%	0.466	52%	0.524	S	S	.	.	H	α-helix	trans	-61.3	-41.6	175.8	-72.9	171.3	0	0	0	112.3	N66 S67 K68 D72 E73 F74	N66-L70 WeakPolarHBondContact O-CG 3.47Å; N66-L70 PolarHBondContact O-N 3.01Å; S67-L70 PolarHBondContact O-N 3.32Å; K68-L70 VanDerWaalsContact C-N 3.3Å; K68-L70 PolarHBondContact O-N 3.11Å; L70-D72 VanDerWaalsContact C-N 3.35Å; L70-E73 PolarHBondContact O-N 3.42Å; L70-F74 WeakPolarHBondContact O-CB 3.45Å; L70-F74 WeakPolarHBondContact O-CD2 3.36Å; L70-F74 PolarHBondContact O-N 3.1Å
71	M	97.3	Very high	96.8	Very high	126 Å²	126	105.7 Å²	105.7	62%	0.621	53%	0.527	S	S	*	.	H	α-helix	trans	-66.6	-37.5	177.6	-70.5	-59.8	-60.6	0	0	112.2	S67 K68 L69 F74 A75	S67-M71 VanDerWaalsContact O-CG 3.28Å; S67-M71 WeakPolarHBondContact O-CG 3.35Å; S67-M71 PolarHBondContact O-N 2.85Å; K68-M71 PolarHBondContact O-N 3.1Å; K68-M71 VanDerWaalsContact O-N 3.08Å; L69-M71 VanDerWaalsContact C-N 3.34Å; L69-M71 PolarHBondContact O-N 3.42Å; M71-F74 PolarHBondContact O-N 2.93Å; M71-A75 PolarHBondContact O-N 3.44Å
72	D	97.2	Very high	96.8	Very high	75 Å²	75	103.8 Å²	103.8	40%	0.401	52%	0.523	S	S	.	.	H	α-helix	trans	-64.9	-45.3	175	-65.1	-19.9	0	0	0	110.1	K68 L69 L70 F74 A75 E76	K68-D72 PolarHBondContact O-N 3.33Å; L69-D72 PolarHBondContact O-N 3.25Å; L70-D72 VanDerWaalsContact C-N 3.35Å; D72-F74 PolarHBondContact O-N 3.42Å; D72-A75 WeakPolarHBondContact O-CB 3.45Å; D72-A75 PolarHBondContact O-N 3.14Å; D72-E76 PolarHBondContact O-N 2.75Å
73	E	96.6	Very high	96.8	Very high	112 Å²	112	103.3 Å²	103.3	52%	0.523	52%	0.523	S	S	.	.	H	α-helix	trans	-61.5	-40.9	174.3	-72.6	175.9	-177.9	0	0	112.6	L69 L70 A75 E76 L77	L69-E73 WeakPolarHBondContact O-CG 3.35Å; L69-E73 PolarHBondContact O-N 3.12Å; L70-E73 PolarHBondContact O-N 3.42Å; E73-A75 VanDerWaalsContact C-N 3.33Å; E73-A75 PolarHBondContact O-N 3.28Å; E73-E76 PolarHBondContact O-N 3.1Å; E73-L77 WeakPolarHBondContact O-CG 3.39Å; E73-L77 PolarHBondContact O-N 2.98Å
74	F	97.1	Very high	96.8	Very high	122 Å²	122	105.3 Å²	105.3	54%	0.535	53%	0.528	S	S	.	.	H	α-helix	trans	-64.2	-38.4	175	-82.3	-59.1	0	0	0	112.1	L70 M71 D72 L77 V78	L70-F74 WeakPolarHBondContact O-CB 3.45Å; L70-F74 WeakPolarHBondContact O-CD2 3.36Å; L70-F74 PolarHBondContact O-N 3.1Å; M71-F74 PolarHBondContact O-N 2.93Å; D72-F74 PolarHBondContact O-N 3.42Å; F74-L77 PolarHBondContact O-N 3.44Å; F74-V78 VanDerWaalsContact O-CG2 3.31Å; F74-V78 WeakPolarHBondContact O-CG2 3.35Å; F74-V78 PolarHBondContact O-N 3.48Å
75	A	96.6	Very high	96.7	Very high	50 Å²	50	101.3 Å²	101.3	41%	0.413	51%	0.511	S	S	.	.	H	α-helix	trans	-63	-45.3	176.3	0	0	0	0	0	111.3	M71 D72 E73 L77 V78 E79	M71-A75 PolarHBondContact O-N 3.44Å; D72-A75 WeakPolarHBondContact O-CB 3.45Å; D72-A75 PolarHBondContact O-N 3.14Å; E73-A75 VanDerWaalsContact C-N 3.33Å; E73-A75 PolarHBondContact O-N 3.28Å; A75-L77 VanDerWaalsContact C-N 3.33Å; A75-L77 PolarHBondContact O-N 2.92Å; A75-V78 PolarHBondContact O-N 3.4Å; A75-E79 WeakPolarHBondContact O-CG 3.47Å; A75-E79 PolarHBondContact O-N 2.93Å
76	E	96.5	Very high	96.6	Very high	132 Å²	132	97.7 Å²	97.7	62%	0.617	50%	0.499	S	S	*	.	H	α-helix	trans	-59.8	-41.7	175.8	-70.1	-178.9	-167.4	0	0	112.4	D72 E73 E79 M80	D72-E76 PolarHBondContact O-N 2.75Å; E73-E76 PolarHBondContact O-N 3.1Å; E76-E79 PolarHBondContact O-N 3.19Å; E76-M80 WeakPolarHBondContact O-CB 3.45Å; E76-M80 PolarHBondContact O-N 3.08Å
77	L	96.7	Very high	96.4	Very high	93 Å²	93	101 Å²	101	49%	0.487	50%	0.504	S	S	.	.	H	α-helix	trans	-64.5	-39.7	176.2	-72.7	174.6	0	0	0	112.3	E73 F74 A75 M80 I81	E73-L77 WeakPolarHBondContact O-CG 3.39Å; E73-L77 PolarHBondContact O-N 2.98Å; F74-L77 PolarHBondContact O-N 3.44Å; A75-L77 VanDerWaalsContact C-N 3.33Å; A75-L77 PolarHBondContact O-N 2.92Å; L77-M80 PolarHBondContact O-N 3.35Å; L77-I81 WeakPolarHBondContact O-CD1 3.3Å; L77-I81 VanDerWaalsContact O-CG1 3.23Å; L77-I81 WeakPolarHBondContact O-CG1 3.45Å; L77-I81 PolarHBondContact O-N 3.27Å
78	V	97	Very high	96.1	Very high	79 Å²	79	103.8 Å²	103.8	48%	0.479	51%	0.505	S	S	.	.	H	α-helix	trans	-63.4	-45.6	175.9	169.6	0	0	0	0	110.6	F74 A75 M80 I81 D82	F74-V78 VanDerWaalsContact O-CG2 3.31Å; F74-V78 WeakPolarHBondContact O-CG2 3.35Å; F74-V78 PolarHBondContact O-N 3.48Å; A75-V78 PolarHBondContact O-N 3.4Å; V78-M80 VanDerWaalsContact C-N 3.33Å; V78-M80 PolarHBondContact O-N 3.1Å; V78-I81 PolarHBondContact O-N 3.32Å; V78-D82 PolarHBondContact O-N 3.37Å
79	E	96.7	Very high	95.8	Very high	138 Å²	138	104.1 Å²	104.1	65%	0.645	50%	0.503	S	S	*	.	H	α-helix	trans	-59.4	-43.3	176.4	-71.8	-178.4	-177.1	0	0	111.9	A75 E76 I81 D82 E83	A75-E79 WeakPolarHBondContact O-CG 3.47Å; A75-E79 PolarHBondContact O-N 2.93Å; E76-E79 PolarHBondContact O-N 3.19Å; E79-I81 VanDerWaalsContact C-N 3.34Å; E79-I81 PolarHBondContact O-N 3.41Å; E79-D82 PolarHBondContact O-N 2.83Å; E79-E83 WeakPolarHBondContact O-CB 3.35Å; E79-E83 PolarHBondContact O-N 3.33Å
80	M	96.3	Very high	95.5	Very high	120 Å²	120	104.6 Å²	104.6	59%	0.591	51%	0.506	S	S	*	.	H	α-helix	trans	-63.5	-39.2	177.2	-171.1	-175.5	-58.9	0	0	112.3	E76 L77 V78 F84	E76-M80 WeakPolarHBondContact O-CB 3.45Å; E76-M80 PolarHBondContact O-N 3.08Å; L77-M80 PolarHBondContact O-N 3.35Å; V78-M80 VanDerWaalsContact C-N 3.33Å; V78-M80 PolarHBondContact O-N 3.1Å; M80-F84 VanDerWaalsContact O-CB 3.3Å; M80-F84 WeakPolarHBondContact O-CB 2.91Å; M80-F84 PolarHBondContact O-N 3.42Å
81	I	96.1	Very high	95	Very high	99 Å²	99	103.1 Å²	103.1	51%	0.508	50%	0.503	S	S	.	.	H	α-helix	trans	-66.7	-42.2	176.2	-71.2	165.3	0	0	0	110.7	L77 V78 E79 F84 N85	L77-I81 WeakPolarHBondContact O-CD1 3.3Å; L77-I81 VanDerWaalsContact O-CG1 3.23Å; L77-I81 WeakPolarHBondContact O-CG1 3.45Å; L77-I81 PolarHBondContact O-N 3.27Å; V78-I81 PolarHBondContact O-N 3.32Å; E79-I81 VanDerWaalsContact C-N 3.34Å; E79-I81 PolarHBondContact O-N 3.41Å; I81-F84 PolarHBondContact O-N 3.26Å; I81-N85 WeakPolarHBondContact CG2-ND2 3.38Å; I81-N85 WeakPolarHBondContact O-CB 3.43Å; I81-N85 PolarHBondContact O-N 2.92Å; I81-N85 PolarHBondContact O-ND2 3.44Å; I81-N85 VanDerWaalsContact O-ND2 3.16Å
82	D	96.1	Very high	94.4	Very high	92 Å²	92	100.7 Å²	100.7	49%	0.492	49%	0.49	S	S	.	.	H	α-helix	trans	-66.4	-39	177.8	-79.8	-17	0	0	0	112	V78 E79 S86	V78-D82 PolarHBondContact O-N 3.37Å; E79-D82 PolarHBondContact O-N 2.83Å; D82-S86 VanDerWaalsContact O-CB 3.27Å; D82-S86 WeakPolarHBondContact O-CB 3.48Å; D82-S86 PolarHBondContact O-N 2.96Å; D82-S86 PolarHBondContact O-OG 2.98Å
83	E	96.2	Very high	93.6	Very high	101 Å²	101	99.1 Å²	99.1	47%	0.472	49%	0.488	S	S	.	.	H	α-helix	trans	-63.3	-48.3	172.5	-170.8	-176.2	178.8	0	0	110.9	E79 N85 S86 R87	E79-E83 WeakPolarHBondContact O-CB 3.35Å; E79-E83 PolarHBondContact O-N 3.33Å; E83-N85 PolarHBondContact O-N 2.93Å; E83-S86 PolarHBondContact O-N 3.49Å; E83-R87 WeakPolarHBondContact O-CG 3.49Å; E83-R87 PolarHBondContact O-N 3.32Å; E83-R87 IonicContact OE1-CZ 3.45Å; E83-R87 IonicContact OE1-NE 3.19Å; E83-R87 PolarHBondContact OE1-NE 3.18Å; E83-R87 IonicContact OE1-NH2 2.85Å; E83-R87 PolarHBondContact OE1-NH2 2.96Å
84	F	95.2	Very high	92.9	Very high	135 Å²	135	96.1 Å²	96.1	59%	0.592	48%	0.479	S	S	*	.	H	α-helix	trans	-57.5	-47.7	177.1	176.1	-95.7	0	0	0	111.6	M80 I81 S86 R87 R88	M80-F84 VanDerWaalsContact O-CB 3.3Å; M80-F84 WeakPolarHBondContact O-CB 2.91Å; M80-F84 PolarHBondContact O-N 3.42Å; I81-F84 PolarHBondContact O-N 3.26Å; F84-S86 VanDerWaalsContact C-N 3.31Å; F84-S86 PolarHBondContact O-N 2.92Å; F84-R87 PolarHBondContact O-N 2.86Å; F84-R88 WeakPolarHBondContact O-CB 3.39Å; F84-R88 PolarHBondContact O-N 3.01Å
85	N	94.6	Very high	91.9	Very high	50 Å²	50	98.5 Å²	98.5	27%	0.267	48%	0.484	S	S	.	.	H	α-helix	trans	-64.1	-36.3	177.8	-77.6	-38	0	0	0	112.2	I81 E83 R88 R89	I81-N85 WeakPolarHBondContact CG2-ND2 3.38Å; I81-N85 WeakPolarHBondContact O-CB 3.43Å; I81-N85 PolarHBondContact O-N 2.92Å; I81-N85 PolarHBondContact O-ND2 3.44Å; I81-N85 VanDerWaalsContact O-ND2 3.16Å; E83-N85 PolarHBondContact O-N 2.93Å; N85-R88 PolarHBondContact O-N 3.13Å; N85-R89 WeakPolarHBondContact O-CG 3.4Å; N85-R89 PolarHBondContact O-N 3.31Å
86	S	94.8	Very high	90.9	Very high	43 Å²	43	104.1 Å²	104.1	30%	0.301	50%	0.502	S	S	.	.	H	α-helix	trans	-68.7	-44	176.5	-62.5	0	0	0	0	111.9	D82 E83 F84 R88 R89 N90	D82-S86 VanDerWaalsContact O-CB 3.27Å; D82-S86 WeakPolarHBondContact O-CB 3.48Å; D82-S86 PolarHBondContact O-N 2.96Å; D82-S86 PolarHBondContact O-OG 2.98Å; E83-S86 PolarHBondContact O-N 3.49Å; F84-S86 VanDerWaalsContact C-N 3.31Å; F84-S86 PolarHBondContact O-N 2.92Å; S86-R88 VanDerWaalsContact C-N 3.33Å; S86-R88 PolarHBondContact O-N 3.3Å; S86-R89 PolarHBondContact O-N 3.2Å; S86-R89 PolarHBondContact OG-NH2 3.29Å; S86-N90 WeakPolarHBondContact O-CB 3.32Å; S86-N90 VanDerWaalsContact O-CG 3.25Å; S86-N90 PolarHBondContact O-N 3.32Å; S86-N90 PolarHBondContact O-ND2 3.42Å
87	R	93.1	Very high	89.7	Confident	166 Å²	166	104.1 Å²	104.1	63%	0.626	51%	0.505	S	S	*	.	H	α-helix	trans	-59.9	-43	172.8	-71.2	174.4	179.9	-129.2	6.8	111.4	E83 F84 N90 S91	E83-R87 WeakPolarHBondContact O-CG 3.49Å; E83-R87 PolarHBondContact O-N 3.32Å; E83-R87 IonicContact OE1-CZ 3.45Å; E83-R87 IonicContact OE1-NE 3.19Å; E83-R87 PolarHBondContact OE1-NE 3.18Å; E83-R87 IonicContact OE1-NH2 2.85Å; E83-R87 PolarHBondContact OE1-NH2 2.96Å; F84-R87 PolarHBondContact O-N 2.86Å; R87-N90 PolarHBondContact O-N 3.46Å; R87-S91 WeakPolarHBondContact O-CB 3.46Å; R87-S91 PolarHBondContact O-N 3.38Å
88	R	92.5	Very high	88.1	Confident	121 Å²	121	101.6 Å²	101.6	46%	0.457	50%	0.502	S	S	.	.	H	α-helix	trans	-60.4	-50.2	176.4	-170.2	177.7	73.2	96.3	-7.5	111.8	F84 N85 S86 N90 S91 E92	F84-R88 WeakPolarHBondContact O-CB 3.39Å; F84-R88 PolarHBondContact O-N 3.01Å; N85-R88 PolarHBondContact O-N 3.13Å; S86-R88 VanDerWaalsContact C-N 3.33Å; S86-R88 PolarHBondContact O-N 3.3Å; R88-N90 PolarHBondContact O-N 3.42Å; R88-S91 PolarHBondContact O-N 2.84Å; R88-E92 WeakPolarHBondContact CG-OE1 3.35Å; R88-E92 IonicContact CZ-OE1 3.67Å; R88-E92 IonicContact NH1-OE1 2.97Å; R88-E92 PolarHBondContact NH1-OE1 3.02Å; R88-E92 IonicContact NH1-OE2 2.64Å; R88-E92 WeakPolarHBondContact O-CG 3.43Å; R88-E92 PolarHBondContact O-N 3.07Å
89	R	91.9	Very high	86.4	Confident	144 Å²	144	102.9 Å²	102.9	54%	0.543	51%	0.506	S	S	.	.	H	α-helix	trans	-59.7	-43.2	177.3	-75.2	-175.5	-62.9	-137	-1.1	112.4	N85 S86 E92 A93	N85-R89 WeakPolarHBondContact O-CG 3.4Å; N85-R89 PolarHBondContact O-N 3.31Å; S86-R89 PolarHBondContact O-N 3.2Å; S86-R89 PolarHBondContact OG-NH2 3.29Å; R89-E92 PolarHBondContact O-N 3.3Å; R89-A93 VanDerWaalsContact O-CB 3.31Å; R89-A93 WeakPolarHBondContact O-CB 3.37Å; R89-A93 PolarHBondContact O-N 3.02Å
90	N	89.6	Confident	84.6	Confident	110 Å²	110	101.2 Å²	101.2	59%	0.588	50%	0.501	S	S	*	.	H	α-helix	trans	-65.7	-40.8	178.9	-70	-12.6	0	0	0	111.8	S86 R87 R88 A93 S94	S86-N90 WeakPolarHBondContact O-CB 3.32Å; S86-N90 VanDerWaalsContact O-CG 3.25Å; S86-N90 PolarHBondContact O-N 3.32Å; S86-N90 PolarHBondContact O-ND2 3.42Å; R87-N90 PolarHBondContact O-N 3.46Å; R88-N90 PolarHBondContact O-N 3.42Å; N90-A93 PolarHBondContact O-N 2.78Å; N90-S94 PolarHBondContact O-N 3.44Å; N90-S94 PolarHBondContact O-OG 3.43Å; N90-S94 VanDerWaalsContact O-OG 3.14Å
91	S	87.9	Confident	82.6	Confident	58 Å²	58	102.9 Å²	102.9	41%	0.406	51%	0.512	S	S	.	.	H	α-helix	trans	-64.8	-43.1	175.1	-179.5	0	0	0	0	112.2	R87 R88 A93 S94 R95	R87-S91 WeakPolarHBondContact O-CB 3.46Å; R87-S91 PolarHBondContact O-N 3.38Å; R88-S91 PolarHBondContact O-N 2.84Å; S91-A93 VanDerWaalsContact C-N 3.33Å; S91-A93 PolarHBondContact O-N 2.95Å; S91-S94 PolarHBondContact O-N 2.83Å; S91-R95 WeakPolarHBondContact O-CG 3.48Å; S91-R95 PolarHBondContact O-N 3.39Å; S91-R95 VanDerWaalsContact O-N 3.1Å
92	E	84.9	Confident	80.3	Confident	75 Å²	75	104.6 Å²	104.6	35%	0.35	52%	0.522	S	S	.	.	H	α-helix	trans	-63.4	-39.1	174.8	-72.9	170.8	-172.8	0	0	111.8	R88 R89 R95 Q96	R88-E92 WeakPolarHBondContact CG-OE1 3.35Å; R88-E92 IonicContact CZ-OE1 3.67Å; R88-E92 IonicContact NH1-OE1 2.97Å; R88-E92 PolarHBondContact NH1-OE1 3.02Å; R88-E92 IonicContact NH1-OE2 2.64Å; R88-E92 WeakPolarHBondContact O-CG 3.43Å; R88-E92 PolarHBondContact O-N 3.07Å; R89-E92 PolarHBondContact O-N 3.3Å; E92-R95 PolarHBondContact O-N 3.48Å; E92-Q96 WeakPolarHBondContact O-CG 3.25Å; E92-Q96 PolarHBondContact O-N 3.42Å
93	A	80.2	Confident	78.1	Confident	42 Å²	42	106.2 Å²	106.2	35%	0.347	54%	0.535	S	S	.	.	H	α-helix	trans	-65.9	-43.8	175.3	0	0	0	0	0	112.3	R89 N90 S91 R95 Q96 L97	R89-A93 VanDerWaalsContact O-CB 3.31Å; R89-A93 WeakPolarHBondContact O-CB 3.37Å; R89-A93 PolarHBondContact O-N 3.02Å; N90-A93 PolarHBondContact O-N 2.78Å; S91-A93 VanDerWaalsContact C-N 3.33Å; S91-A93 PolarHBondContact O-N 2.95Å; A93-R95 VanDerWaalsContact C-N 3.28Å; A93-R95 PolarHBondContact O-N 3.47Å; A93-Q96 PolarHBondContact O-N 3.42Å; A93-Q96 VanDerWaalsContact O-N 3.16Å; A93-L97 WeakPolarHBondContact O-CB 3.48Å; A93-L97 WeakPolarHBondContact O-CG 3.43Å; A93-L97 PolarHBondContact O-N 2.94Å
94	S	80.9	Confident	75.7	Confident	49 Å²	49	109.3 Å²	109.3	34%	0.343	55%	0.549	S	S	.	.	H	α-helix	trans	-59.5	-38.9	175.4	-65.2	0	0	0	0	112.4	N90 S91 L97 G98 L99	N90-S94 PolarHBondContact O-N 3.44Å; N90-S94 PolarHBondContact O-OG 3.43Å; N90-S94 VanDerWaalsContact O-OG 3.14Å; S91-S94 PolarHBondContact O-N 2.83Å; S94-L97 PolarHBondContact O-N 3.01Å; S94-G98 PolarHBondContact O-N 2.86Å; S94-L99 PolarHBondContact O-N 3.11Å
95	R	76.1	Confident	73.5	Confident	172 Å²	172	108.5 Å²	108.5	65%	0.649	56%	0.558	S	S	*	*	H	α-helix	trans	-65.3	-43.2	173.7	-74.6	177.3	176.2	-178.7	1.1	112.3	S91 E92 A93 L97 G98 D100	S91-R95 WeakPolarHBondContact O-CG 3.48Å; S91-R95 PolarHBondContact O-N 3.39Å; S91-R95 VanDerWaalsContact O-N 3.1Å; E92-R95 PolarHBondContact O-N 3.48Å; A93-R95 VanDerWaalsContact C-N 3.28Å; A93-R95 PolarHBondContact O-N 3.47Å; R95-L97 VanDerWaalsContact C-N 3.31Å; R95-L97 PolarHBondContact O-N 3.33Å; R95-G98 PolarHBondContact O-N 2.88Å; R95-G98 VanDerWaalsContact O-N 3.17Å; R95-D100 VanDerWaalsContact CG-OD2 3.31Å; R95-D100 WeakPolarHBondContact CG-OD2 3.39Å
96	Q	75.4	Confident	71.2	Confident	168 Å²	168	109.4 Å²	109.4	79%	0.785	58%	0.578	S	S	*	*	H	α-helix	trans	-67.3	-30.8	177.3	-73	176.5	38.8	0	0	112.9	E92 A93 G98	E92-Q96 WeakPolarHBondContact O-CG 3.25Å; E92-Q96 PolarHBondContact O-N 3.42Å; A93-Q96 PolarHBondContact O-N 3.42Å; A93-Q96 VanDerWaalsContact O-N 3.16Å; Q96-G98 PolarHBondContact O-N 3.5Å
97	L	72.7	Confident	69	Low	131 Å²	131	116.7 Å²	116.7	69%	0.686	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.3	-0.8	174.4	-69.9	171	0	0	0	113.4	A93 S94 R95 L99	A93-L97 WeakPolarHBondContact O-CB 3.48Å; A93-L97 WeakPolarHBondContact O-CG 3.43Å; A93-L97 PolarHBondContact O-N 2.94Å; S94-L97 PolarHBondContact O-N 3.01Å; R95-L97 VanDerWaalsContact C-N 3.31Å; R95-L97 PolarHBondContact O-N 3.33Å; L97-L99 HydrophobicContact CB-CD1 4.11Å; L97-L99 HydrophobicContact CB-CG 4.03Å; L97-L99 HydrophobicContact CD1-CD1 4.3Å; L97-L99 PolarHBondContact O-N 2.99Å
98	G	62.9	Low	67.1	Low	40 Å²	40	116.1 Å²	116.1	41%	0.412	61%	0.61	S	S	.	*	T	Hydrogen-bonded Turn	trans	65.7	19.1	179.2	0	0	0	0	0	114	S94 R95 Q96 D100 D101	S94-G98 PolarHBondContact O-N 2.86Å; R95-G98 PolarHBondContact O-N 2.88Å; R95-G98 VanDerWaalsContact O-N 3.17Å; Q96-G98 PolarHBondContact O-N 3.5Å; G98-D100 VanDerWaalsContact C-N 3.26Å; G98-D100 PolarHBondContact O-N 2.9Å; G98-D101 PolarHBondContact O-N 3.32Å
99	L	61	Low	65.1	Low	106 Å²	106	117.6 Å²	117.6	56%	0.555	62%	0.622	S	S	*	*	G	3₁₀ helix	trans	-73.8	-16.9	-177.1	-69.2	171.8	0	0	0	113.1	S94 L97	S94-L99 PolarHBondContact O-N 3.11Å; L97-L99 HydrophobicContact CB-CD1 4.11Å; L97-L99 HydrophobicContact CB-CG 4.03Å; L97-L99 HydrophobicContact CD1-CD1 4.3Å; L97-L99 PolarHBondContact O-N 2.99Å
100	D	57.5	Low	63.1	Low	103 Å²	103	117.2 Å²	117.2	55%	0.551	63%	0.631	S	S	*	*	G	3₁₀ helix	trans	-79.5	-14.7	176.7	-74.8	-22.5	0	0	0	113.1	R95 G98	R95-D100 VanDerWaalsContact CG-OD2 3.31Å; R95-D100 WeakPolarHBondContact CG-OD2 3.39Å; G98-D100 VanDerWaalsContact C-N 3.26Å; G98-D100 PolarHBondContact O-N 2.9Å
101	D	55.2	Low	61.4	Low	155 Å²	155	117.7 Å²	117.7	83%	0.829	64%	0.64	S	S	*	*	G	3₁₀ helix	trans	-92	1.9	-177.2	-126.2	13.1	0	0	0	113.6	G98	G98-D101 PolarHBondContact O-N 3.32Å
102	L	48.5	Very low	59.8	Low	135 Å²	135	120.9 Å²	120.9	71%	0.707	65%	0.652	S	S	*	*	G	3₁₀ helix	trans	-97.3	19.8	178.9	-93.6	156.6	0	0	0	113.8	Q104	L102-Q104 PolarHBondContact O-N 3.25Å
103	V	49	Very low	58.7	Low	126 Å²	126	121.7 Å²	121.7	76%	0.764	67%	0.672	S	S	*	*			trans	-76.3	77.1	154.3	-173.3	0	0	0	0	107	P105	V103-P105 VanDerWaalsContact O-CD 3.3Å; V103-P105 WeakPolarHBondContact O-CD 3.43Å; V103-P105 VanDerWaalsContact O-N 3.15Å
104	Q	46	Very low	57.3	Low	167 Å²	167	125.2 Å²	125.2	78%	0.78	69%	0.69	S	S	*	*	P	Polyproline II helix	trans	-55.1	119.3	162.8	-102.4	-174.7	-22	0	0	107.3	L102 G106	L102-Q104 PolarHBondContact O-N 3.25Å; Q104-G106 PolarHBondContact O-N 2.84Å
105	P	48	Very low	55.5	Low	118 Å²	118	127.2 Å²	127.2	77%	0.766	70%	0.704	S	S	*	*	P	Polyproline II helix	trans	-57.6	134.2	175	22	-30.3	0	0	0	108.7	V103 Y107	V103-P105 VanDerWaalsContact O-CD 3.3Å; V103-P105 WeakPolarHBondContact O-CD 3.43Å; V103-P105 VanDerWaalsContact O-N 3.15Å; P105-Y107 PolarHBondContact O-N 3.14Å
106	G	48.1	Very low	54.4	Low	68 Å²	68	132.2 Å²	132.2	70%	0.701	73%	0.73	S	S	*	*	S	Bend	trans	-46.6	129.6	-174.7	0	0	0	0	0	112.3	Q104 D108	Q104-G106 PolarHBondContact O-N 2.84Å; G106-D108 PolarHBondContact O-N 3.44Å
107	Y	47.8	Very low	53.3	Low	197 Å²	197	130.4 Å²	130.4	77%	0.773	73%	0.728	S	S	*	*			trans	18.7	93.9	150.5	-70.7	-84.4	0	0	0	115.1	P105 Q109	P105-Y107 PolarHBondContact O-N 3.14Å; Y107-Q109 HydrophobicContact CD1-CG 4.36Å; Y107-Q109 PolarHBondContact O-N 2.87Å
108	D	52.8	Low	52.3	Low	154 Å²	154	130.4 Å²	130.4	82%	0.824	73%	0.73	S	S	*	*			trans	-53.8	90.5	143.9	-165.1	6.9	0	0	0	107.7	G106	G106-D108 PolarHBondContact O-N 3.44Å
109	Q	50.7	Low	51.7	Low	151 Å²	151	135.4 Å²	135.4	71%	0.706	75%	0.747	S	S	*	*			trans	-114	94.7	170.8	-88.1	-170.4	16.4	0	0	109.7	Y107	Y107-Q109 HydrophobicContact CD1-CG 4.36Å; Y107-Q109 PolarHBondContact O-N 2.87Å
110	N	49.4	Very low	51.1	Low	137 Å²	137	137.1 Å²	137.1	73%	0.733	76%	0.759	S	S	*	*			trans	70.7	96.6	148.1	-82.3	-9.3	0	0	0	119
111	P	55.3	Low	50.7	Low	119 Å²	119	139.3 Å²	139.3	77%	0.773	77%	0.772	S	S	*	*			trans	-90	91.8	132.2	34.2	-20.1	0	0	0	107.9
112	D	54.4	Low	50.4	Low	125 Å²	125	138.2 Å²	138.2	67%	0.668	77%	0.768	S	S	*	*			trans	-118.9	101.3	160.3	-146	-6.6	0	0	0	110.4	T114	D112-T114 PolarHBondContact O-N 3.42Å
113	A	60.3	Low	50.6	Low	92 Å²	92	138.4 Å²	138.4	76%	0.76	77%	0.772	S	S	*	*			trans	-89.5	74.4	171.9	0	0	0	0	0	108.7
114	T	50.5	Low	50.7	Low	117 Å²	117	139.4 Å²	139.4	72%	0.718	77%	0.773	S	S	*	*			trans	-86.8	95	150	27.9	0	0	0	0	105.9	D112	D112-T114 PolarHBondContact O-N 3.42Å
115	S	44.8	Very low	51.1	Low	91 Å²	91	137.1 Å²	137.1	64%	0.636	77%	0.772	S	S	*	*				43.3	73.6	66.1	-157.8	0	0	0	0	110.5
116	F	51.1	Low	51.4	Low	276 Å²	276	138.8 Å²	138.8	100%	1.211	77%	0.773	S	S	*	*				-179.5	0	118.6	-90.9	-70.8	0	0	0	109.3

Retrieved 116 of 116 residues in 274.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).