A0A077Z1E3_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z1E3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 111 aa.

						>A0A077Z1E3_TRITR|A0A077Z1E3
MVFQGRMFAGDGDKVAVVTLQTSPMSGTRETPMAKRPHQPTPPTDVDQGAAFHTTAHRRHPSQRGSRHWMLKVRDSCQKLQTVDETARQALGSRRKGAGLPRRGSRGPGAD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.7	Very low	52.6	Low	189 Å²	189	131.3 Å²	131.3	93%	0.931	70%	0.702	S	S	*	*				0	112.4	0	-152.5	176.7	-145.6	0	0	106.7	F3 T22	M1-F3 HydrophobicContact CB-CE2 4.26Å; M1-F3 HydrophobicContact CG-CE2 4.01Å; M1-F3 HydrophobicContact CG-CZ 4.27Å; M1-F3 HydrophobicContact SD-CE2 3.91Å; M1-F3 HydrophobicContact SD-CZ 3.8Å; M1-T22 PolarHBondContact O-OG1 3.24Å
2	V	49.2	Very low	52.5	Low	108 Å²	108	127.3 Å²	127.3	66%	0.655	72%	0.715	S	S	*	*			trans	-95.7	120.9	-178.9	179.5	0	0	0	0	107.8
3	F	54.2	Low	52.7	Low	148 Å²	148	129.8 Å²	129.8	65%	0.649	73%	0.726	S	S	*	*			trans	-97.9	109	172.4	-72.2	-88.8	0	0	0	108.1	M1	M1-F3 HydrophobicContact CB-CE2 4.26Å; M1-F3 HydrophobicContact CG-CE2 4.01Å; M1-F3 HydrophobicContact CG-CZ 4.27Å; M1-F3 HydrophobicContact SD-CE2 3.91Å; M1-F3 HydrophobicContact SD-CZ 3.8Å
4	Q	50.3	Low	52.8	Low	147 Å²	147	133.1 Å²	133.1	69%	0.687	73%	0.729	S	S	*	*			trans	-93.1	99.5	172.4	-163.2	176	43.3	0	0	108.3
5	G	59.3	Low	52.7	Low	45 Å²	45	132.2 Å²	132.2	46%	0.464	73%	0.729	S	S	.	*			trans	-93.4	125.6	172.5	0	0	0	0	0	110.5
6	R	58.8	Low	52.9	Low	212 Å²	212	127.9 Å²	127.9	80%	0.8	72%	0.716	S	S	*	*			trans	-85.6	105.7	165.6	-69.3	-178.7	178.2	170.1	-0.7	107.9	F8	R6-F8 HydrophobicContact CB-CE2 4.45Å
7	M	55.9	Low	53.2	Low	130 Å²	130	126.1 Å²	126.1	64%	0.64	71%	0.708	S	S	*	*			trans	-89.9	118.1	167.7	-79.1	-176.4	-79.6	0	0	108.6	A9 V18	M7-A9 PolarHBondContact O-N 2.87Å; M7-V18 HydrophobicContact CE-CG2 4.35Å
8	F	51.3	Low	53.3	Low	180 Å²	180	123 Å²	123	79%	0.789	69%	0.693	S	S	*	*			trans	-80.2	106.2	169.3	-68.3	-88.5	0	0	0	107.7	R6 G10	R6-F8 HydrophobicContact CB-CE2 4.45Å; F8-G10 PolarHBondContact O-N 3.33Å
9	A	54.4	Low	53.3	Low	66 Å²	66	121.3 Å²	121.3	55%	0.545	69%	0.685	S	S	.	*			trans	-70.2	115.7	161.8	0	0	0	0	0	106.6	M7 D11	M7-A9 PolarHBondContact O-N 2.87Å; A9-D11 PolarHBondContact O-N 3.46Å
10	G	46.8	Very low	53.4	Low	78 Å²	78	121.3 Å²	121.3	80%	0.804	68%	0.683	S	S	*	*	S	Bend	trans	-69.4	76.3	172	0	0	0	0	0	110.1	F8	F8-G10 PolarHBondContact O-N 3.33Å
11	D	51.8	Low	53.5	Low	141 Å²	141	123.1 Å²	123.1	75%	0.754	69%	0.686	S	S	*	*	S	Bend	trans	-162.2	112.9	156.5	-90.2	-30	0	0	0	104.4	A9 D13	A9-D11 PolarHBondContact O-N 3.46Å; D11-D13 PolarHBondContact O-N 2.88Å
12	G	51.7	Low	54.1	Low	84 Å²	84	118.7 Å²	118.7	87%	0.866	67%	0.67	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.6	45	-158.1	0	0	0	0	0	118.2
13	D	55.2	Low	54.6	Low	160 Å²	160	117.9 Å²	117.9	86%	0.856	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-153.8	7	174.4	-109	-20.1	0	0	0	116.4	D11	D11-D13 PolarHBondContact O-N 2.88Å
14	K	53.6	Low	54.8	Low	175 Å²	175	116.2 Å²	116.2	76%	0.761	67%	0.673	S	S	*	*			trans	-137.6	95	-177.7	-63.1	179.9	-173.4	166.1	0	112.7	A16	K14-A16 PolarHBondContact O-N 3.22Å
15	V	52	Low	55.2	Low	120 Å²	120	118.8 Å²	118.8	73%	0.727	69%	0.687	S	S	*	*			trans	-82.4	99.9	167.2	-176.6	0	0	0	0	108.6	V17	V15-V17 HydrophobicContact CG1-CG2 4.17Å; V15-V17 PolarHBondContact O-N 3.03Å
16	A	55.8	Low	55	Low	63 Å²	63	121.8 Å²	121.8	52%	0.521	70%	0.701	S	S	.	*			trans	-83.6	105.3	169.6	0	0	0	0	0	109.5	K14 V18	K14-A16 PolarHBondContact O-N 3.22Å; A16-V18 PolarHBondContact O-N 2.88Å
17	V	57.6	Low	54.7	Low	97 Å²	97	114.9 Å²	114.9	59%	0.588	70%	0.696	S	S	*	*			trans	-79.9	97.3	170.7	-178.3	0	0	0	0	108.3	V15 T19	V15-V17 HydrophobicContact CG1-CG2 4.17Å; V15-V17 PolarHBondContact O-N 3.03Å; V17-T19 PolarHBondContact O-N 3.31Å
18	V	55.6	Low	54.6	Low	71 Å²	71	116 Å²	116	43%	0.43	71%	0.711	S	S	.	*			trans	-84.2	108	171.9	-175.4	0	0	0	0	108.3	M7 A16 L20	M7-V18 HydrophobicContact CE-CG2 4.35Å; A16-V18 PolarHBondContact O-N 2.88Å; V18-L20 HydrophobicContact CG1-CG 4.38Å
19	T	52.2	Low	54.8	Low	90 Å²	90	118.3 Å²	118.3	55%	0.552	71%	0.714	S	S	*	*			trans	-91.6	106.5	172.2	-53.8	0	0	0	0	108.7	V17 Q21	V17-T19 PolarHBondContact O-N 3.31Å; T19-Q21 PolarHBondContact O-N 3.29Å
20	L	55.7	Low	54.9	Low	121 Å²	121	124.1 Å²	124.1	63%	0.634	73%	0.73	S	S	*	*			trans	-82	94.9	172.1	-74.3	161.9	0	0	0	108.7	V18 T22	V18-L20 HydrophobicContact CG1-CG 4.38Å; L20-T22 PolarHBondContact O-N 3.44Å
21	Q	55	Low	55.6	Low	161 Å²	161	126.7 Å²	126.7	75%	0.752	73%	0.73	S	S	*	*			trans	-80.6	104.6	171.3	-168.9	170.4	-30.7	0	0	109	T19 S23	T19-Q21 PolarHBondContact O-N 3.29Å; Q21-S23 PolarHBondContact O-N 3.07Å
22	T	59.9	Low	56	Low	96 Å²	96	125.6 Å²	125.6	59%	0.589	73%	0.731	S	S	*	*			trans	-78.5	100.1	167.3	46.1	0	0	0	0	108.1	M1 L20	M1-T22 PolarHBondContact O-OG1 3.24Å; L20-T22 PolarHBondContact O-N 3.44Å
23	S	60.1	Low	56.2	Low	90 Å²	90	130.6 Å²	130.6	63%	0.629	73%	0.734	S	S	*	*			trans	-64.3	129.4	171.5	-64.2	0	0	0	0	109.3	Q21 M25	Q21-S23 PolarHBondContact O-N 3.07Å; S23-M25 PolarHBondContact O-N 3.27Å
24	P	58.7	Low	56.6	Low	113 Å²	113	127.6 Å²	127.6	73%	0.734	73%	0.731	S	S	*	*			trans	-62.9	125.7	170.1	25.5	-30.7	0	0	0	108.6	S26	P24-S26 VanDerWaalsContact C-N 3.27Å; P24-S26 PolarHBondContact O-N 3.46Å
25	M	57.8	Low	56.9	Low	201 Å²	201	128.9 Å²	128.9	99%	0.99	74%	0.737	S	S	*	*			trans	-66.4	90.7	167.9	-73.8	-175.1	72.8	0	0	108.1	S23	S23-M25 PolarHBondContact O-N 3.27Å
26	S	56.2	Low	57.5	Low	108 Å²	108	134.3 Å²	134.3	76%	0.755	74%	0.744	S	S	*	*			trans	-103.4	127.5	170.8	71.8	0	0	0	0	110.2	P24	P24-S26 VanDerWaalsContact C-N 3.27Å; P24-S26 PolarHBondContact O-N 3.46Å
27	G	52.3	Low	57.9	Low	68 Å²	68	137 Å²	137	70%	0.701	76%	0.756	S	S	*	*			trans	93.2	90.1	156.4	0	0	0	0	0	114.4	R29	G27-R29 VanDerWaalsContact C-N 3.28Å; G27-R29 PolarHBondContact O-N 3.34Å
28	T	52.6	Low	58.2	Low	154 Å²	154	141.2 Å²	141.2	95%	0.945	77%	0.769	S	S	*	*			trans	-50.7	94.1	150.4	42.2	0	0	0	0	109.3
29	R	54.9	Low	58.7	Low	227 Å²	227	145.9 Å²	145.9	86%	0.857	79%	0.786	S	S	*	*			trans	-100.7	116.7	166.1	-169.6	176	177.2	-176.3	-0.5	106.8	G27 T31	G27-R29 VanDerWaalsContact C-N 3.28Å; G27-R29 PolarHBondContact O-N 3.34Å; R29-T31 PolarHBondContact O-N 3.33Å
30	E	58	Low	59.3	Low	188 Å²	188	146.9 Å²	146.9	88%	0.879	79%	0.794	S	S	*	*			trans	-51.1	109.3	176.2	-63.4	178.6	155	0	0	110.1	P32	E30-P32 WeakPolarHBondContact O-CD 3.48Å
31	T	61.2	Low	59.9	Low	133 Å²	133	147.2 Å²	147.2	82%	0.816	80%	0.801	S	S	*	*			trans	-82.1	118.6	169.3	12.4	0	0	0	0	108.5	R29 M33	R29-T31 PolarHBondContact O-N 3.33Å; T31-M33 PolarHBondContact O-N 3.42Å
32	P	59.7	Low	60.6	Low	118 Å²	118	144.4 Å²	144.4	77%	0.766	80%	0.797	S	S	*	*			trans	-60.5	138	171.5	24.9	-31.7	0	0	0	109.2	E30 A34	E30-P32 WeakPolarHBondContact O-CD 3.48Å; P32-A34 PolarHBondContact O-N 3.34Å
33	M	55.6	Low	60.9	Low	189 Å²	189	145.9 Å²	145.9	93%	0.931	81%	0.808	S	S	*	*			trans	-44.4	103	-176.2	-71.3	-179	70.4	0	0	111.6	T31 K35	T31-M33 PolarHBondContact O-N 3.42Å; M33-K35 PolarHBondContact O-N 3.21Å
34	A	63	Low	61	Low	96 Å²	96	147 Å²	147	79%	0.793	81%	0.812	S	S	*	*	P	Polyproline II helix	trans	-66.6	125.2	172	0	0	0	0	0	108.2	P32 R36	P32-A34 PolarHBondContact O-N 3.34Å; A34-R36 PolarHBondContact O-N 3.39Å
35	K	61.9	Low	61.1	Low	202 Å²	202	147.9 Å²	147.9	88%	0.878	81%	0.81	S	S	*	*	P	Polyproline II helix	trans	-46.1	128.9	176.7	-68	174.9	178.9	177.9	0	109.5	M33	M33-K35 PolarHBondContact O-N 3.21Å
36	R	63	Low	61.2	Low	235 Å²	235	144.2 Å²	144.2	89%	0.887	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-47.9	124.4	177.6	-143.6	175.9	175.4	-173.5	-3.1	108.5	A34 H38	A34-R36 PolarHBondContact O-N 3.39Å; R36-H38 PolarHBondContact O-N 3.23Å
37	P	65.5	Low	61.2	Low	118 Å²	118	144.9 Å²	144.9	77%	0.766	79%	0.794	S	S	*	*	P	Polyproline II helix	trans	-58.3	128.6	176.9	21.8	-30.3	0	0	0	108.5	Q39	P37-Q39 PolarHBondContact O-N 3.09Å
38	H	62.3	Low	61.3	Low	186 Å²	186	148.4 Å²	148.4	86%	0.861	79%	0.792	S	S	*	*			trans	-52.1	115.5	176.1	-138.8	-60.5	0	0	0	107.7	R36 P40	R36-H38 PolarHBondContact O-N 3.23Å; H38-P40 WeakPolarHBondContact O-CD 3.35Å
39	Q	67.2	Low	61.4	Low	169 Å²	169	144.1 Å²	144.1	79%	0.79	78%	0.778	S	S	*	*	P	Polyproline II helix	trans	-64.1	121.9	174.6	-167.6	176	10.8	0	0	106.8	P37 T41	P37-Q39 PolarHBondContact O-N 3.09Å; Q39-T41 PolarHBondContact O-N 2.95Å
40	P	64.1	Low	61.4	Low	112 Å²	112	135.9 Å²	135.9	73%	0.727	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-64	129.3	174.6	23.8	-29.7	0	0	0	108.5	H38	H38-P40 WeakPolarHBondContact O-CD 3.35Å
41	T	68.8	Low	61.3	Low	127 Å²	127	130.2 Å²	130.2	78%	0.779	74%	0.744	S	S	*	*	P	Polyproline II helix	trans	-53.6	131	173.3	-40.7	0	0	0	0	108.7	Q39	Q39-T41 PolarHBondContact O-N 2.95Å
42	P	69.4	Low	61	Low	102 Å²	102	132.2 Å²	132.2	66%	0.662	74%	0.742	S	S	*	*	P	Polyproline II helix	trans	-58.3	138.9	177.2	23.9	-32.7	0	0	0	109.6	T44	P42-T44 PolarHBondContact O-N 2.72Å
43	P	67.2	Low	60.7	Low	128 Å²	128	134.5 Å²	134.5	83%	0.831	74%	0.742	S	S	*	*	P	Polyproline II helix	trans	-59.2	124	176.9	23.9	-31.4	0	0	0	108.9
44	T	61.6	Low	60.8	Low	114 Å²	114	130.2 Å²	130.2	70%	0.699	73%	0.727	S	S	*	*	P	Polyproline II helix	trans	-60.3	142.6	171.6	-43.9	0	0	0	0	108.4	P42 V46	P42-T44 PolarHBondContact O-N 2.72Å; T44-V46 HydrophobicContact CG2-CG2 3.87Å; T44-V46 PolarHBondContact O-N 3.23Å
45	D	61.6	Low	60.6	Low	130 Å²	130	132.1 Å²	132.1	70%	0.695	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.5	36.8	-167.7	-157	9	0	0	0	115.2	Q48	D45-Q48 PolarHBondContact OD1-NE2 3.4Å
46	V	59.3	Low	60.6	Low	124 Å²	124	126.5 Å²	126.5	75%	0.752	72%	0.72	S	S	*	*	T	Hydrogen-bonded Turn	trans	-115.4	5	-171.7	-110.5	0	0	0	0	113.7	T44	T44-V46 HydrophobicContact CG2-CG2 3.87Å; T44-V46 PolarHBondContact O-N 3.23Å
47	D	56.2	Low	60.2	Low	123 Å²	123	123 Å²	123	66%	0.658	71%	0.713	S	S	*	*			trans	-138.8	43.2	-177.2	-117.6	-15.6	0	0	0	113.2	G49 A50	D47-G49 PolarHBondContact O-N 3.18Å; D47-A50 PolarHBondContact O-N 2.73Å; D47-A50 VanDerWaalsContact O-N 3.09Å
48	Q	55.1	Low	59.7	Low	142 Å²	142	128.5 Å²	128.5	66%	0.664	72%	0.718	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.1	-8.8	175.8	-66.6	-166.9	8.3	0	0	113.7	D45	D45-Q48 PolarHBondContact OD1-NE2 3.4Å
49	G	54.7	Low	59.7	Low	63 Å²	63	131 Å²	131	65%	0.649	72%	0.72	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.9	-20.4	174.6	0	0	0	0	0	115.5	D47	D47-G49 PolarHBondContact O-N 3.18Å
50	A	54.2	Low	59.3	Low	55 Å²	55	131.5 Å²	131.5	46%	0.455	72%	0.722	S	S	.	*	T	Hydrogen-bonded Turn	trans	-93.4	-13.3	-174.7	0	0	0	0	0	113.9	D47 F52	D47-A50 PolarHBondContact O-N 2.73Å; D47-A50 VanDerWaalsContact O-N 3.09Å; A50-F52 PolarHBondContact O-N 3.37Å
51	A	55.5	Low	59.1	Low	68 Å²	68	130.1 Å²	130.1	56%	0.562	71%	0.713	S	S	*	*	G	3₁₀ helix	trans	-72.6	-10.4	-174.2	0	0	0	0	0	114.8	H53	A51-H53 VanDerWaalsContact C-N 3.27Å; A51-H53 PolarHBondContact O-N 2.83Å
52	F	56.1	Low	58.8	Low	176 Å²	176	128 Å²	128	77%	0.772	70%	0.704	S	S	*	*	G	3₁₀ helix	trans	-79.1	-5.4	-179.7	-70.2	-75.9	0	0	0	114.4	A50	A50-F52 PolarHBondContact O-N 3.37Å
53	H	53.3	Low	58.3	Low	165 Å²	165	131.5 Å²	131.5	76%	0.764	71%	0.711	S	S	*	*	G	3₁₀ helix	trans	-116.2	6.5	-176.6	-65.4	-59.3	0	0	0	115.3	A51 T55	A51-H53 VanDerWaalsContact C-N 3.27Å; A51-H53 PolarHBondContact O-N 2.83Å; H53-T55 PolarHBondContact O-N 2.97Å
54	T	55.8	Low	57.7	Low	100 Å²	100	136.1 Å²	136.1	61%	0.613	71%	0.712	S	S	*	*			trans	-92.3	97.8	174.5	63.7	0	0	0	0	111.2	A56	T54-A56 PolarHBondContact O-N 2.79Å
55	T	60	Low	57.5	Low	136 Å²	136	132 Å²	132	83%	0.834	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.7	9.2	-177.4	38.2	0	0	0	0	115.4	H53	H53-T55 PolarHBondContact O-N 2.97Å
56	A	60.7	Low	57.3	Low	84 Å²	84	127.2 Å²	127.2	69%	0.694	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.3	-4.9	-166.6	0	0	0	0	0	116	T54	T54-A56 PolarHBondContact O-N 2.79Å
57	H	55.5	Low	57.2	Low	160 Å²	160	130 Å²	130	74%	0.741	67%	0.666	S	S	*	*			trans	-118.2	47.4	-178.1	-61.1	-36.8	0	0	0	112.9	R59	H57-R59 VanDerWaalsContact C-N 3.26Å; H57-R59 PolarHBondContact O-N 3.33Å
58	R	55.7	Low	57.3	Low	234 Å²	234	129.2 Å²	129.2	88%	0.883	66%	0.658	S	S	*	*			trans	-61.4	96.5	162.4	-81.4	-171.1	172.9	-178.4	-0.6	108.1	H60	R58-H60 PolarHBondContact O-N 2.83Å
59	R	61.5	Low	57.2	Low	239 Å²	239	128.4 Å²	128.4	90%	0.902	65%	0.649	S	S	*	*			trans	-48	109.2	171.5	-65.5	179.4	177.7	-179.5	-0.5	107.4	H57	H57-R59 VanDerWaalsContact C-N 3.26Å; H57-R59 PolarHBondContact O-N 3.33Å
60	H	58.5	Low	57.4	Low	180 Å²	180	130.5 Å²	130.5	83%	0.833	64%	0.643	S	S	*	*	P	Polyproline II helix	trans	-54.1	125.8	172	-95.2	-89.4	0	0	0	107.7	R58 S62	R58-H60 PolarHBondContact O-N 2.83Å; H60-S62 PolarHBondContact O-N 3.32Å
61	P	60.5	Low	57.6	Low	83 Å²	83	132.8 Å²	132.8	54%	0.539	65%	0.647	S	S	.	*	P	Polyproline II helix	trans	-56.8	133.8	171.1	22.8	-30.2	0	0	0	107.4	Q63 W69	P61-Q63 PolarHBondContact O-N 3.27Å; P61-W69 HydrophobicContact CB-CZ2 4.41Å
62	S	61.8	Low	57.8	Low	83 Å²	83	135.7 Å²	135.7	58%	0.58	65%	0.647	S	S	*	*	P	Polyproline II helix	trans	-50.5	136.8	178.7	64.8	0	0	0	0	109.1	H60 R64 G65 S66	H60-S62 PolarHBondContact O-N 3.32Å; S62-R64 PolarHBondContact O-N 3.46Å; S62-G65 PolarHBondContact O-N 3.06Å; S62-G65 PolarHBondContact OG-N 3.47Å; S62-S66 PolarHBondContact O-N 2.9Å
63	Q	59	Low	57.9	Low	174 Å²	174	131.6 Å²	131.6	81%	0.813	64%	0.637	S	S	*	*	H	α-helix	trans	-55.1	-17.5	179.7	-71.6	-168.4	-7.7	0	0	112.8	P61 S66 R67	P61-Q63 PolarHBondContact O-N 3.27Å; Q63-S66 WeakPolarHBondContact O-CA 2.88Å; Q63-R67 PolarHBondContact O-N 2.87Å
64	R	55.5	Low	58.2	Low	226 Å²	226	132.8 Å²	132.8	85%	0.853	63%	0.634	S	S	*	*	H	α-helix	trans	-75.9	-41	174.6	-143.5	176	-171.8	-118.2	2.1	112.8	S62	S62-R64 PolarHBondContact O-N 3.46Å
65	G	58.3	Low	58.4	Low	27 Å²	27	132.2 Å²	132.2	28%	0.278	63%	0.627	S	S	.	*	H	α-helix	trans	-64.9	-50.6	171	0	0	0	0	0	110.4	S62 R67 H68 W69	S62-G65 PolarHBondContact O-N 3.06Å; S62-G65 PolarHBondContact OG-N 3.47Å; G65-R67 PolarHBondContact O-N 2.98Å; G65-R67 VanDerWaalsContact O-N 3.13Å; G65-H68 WeakPolarHBondContact O-CB 2.92Å; G65-H68 PolarHBondContact O-N 3.06Å; G65-W69 VanDerWaalsContact C-CZ2 3.42Å; G65-W69 PolarHBondContact O-NE1 2.97Å
66	S	55.7	Low	58.3	Low	30 Å²	30	129 Å²	129	21%	0.21	61%	0.61	C	S	.	*	H	α-helix	trans	9.9	-81.8	142.8	-145.2	0	0	0	0	119.2	S62 Q63 W69 M70	S62-S66 PolarHBondContact O-N 2.9Å; Q63-S66 WeakPolarHBondContact O-CA 2.88Å; S66-W69 VanDerWaalsContact CB-CZ3 3.46Å; S66-W69 WeakPolarHBondContact O-CH2 3.5Å; S66-W69 WeakPolarHBondContact O-CZ3 3.28Å; S66-W69 WeakPolarHBondContact OG-CH2 3.37Å; S66-W69 WeakPolarHBondContact OG-CZ3 3.26Å; S66-M70 WeakPolarHBondContact O-CE 3.47Å
67	R	58.8	Low	58.3	Low	183 Å²	183	128.2 Å²	128.2	69%	0.691	60%	0.599	S	S	*	*	H	α-helix	trans	-82.7	-23.4	-167.9	-71.8	172.4	150.2	-151.3	-5.1	112.4	Q63 G65 W69 M70 L71	Q63-R67 PolarHBondContact O-N 2.87Å; G65-R67 PolarHBondContact O-N 2.98Å; G65-R67 VanDerWaalsContact O-N 3.13Å; R67-W69 PolarHBondContact O-N 3.04Å; R67-M70 PolarHBondContact O-N 3.44Å; R67-L71 VanDerWaalsContact O-CG 3.26Å; R67-L71 WeakPolarHBondContact O-CG 3.5Å; R67-L71 PolarHBondContact O-N 3.13Å
68	H	57.2	Low	58.4	Low	106 Å²	106	126.4 Å²	126.4	49%	0.491	59%	0.591	S	S	.	*	H	α-helix	trans	-63.8	-42.7	-174.5	-175.9	71.2	0	0	0	112.2	G65 K72	G65-H68 WeakPolarHBondContact O-CB 2.92Å; G65-H68 PolarHBondContact O-N 3.06Å; H68-K72 WeakPolarHBondContact NE2-CE 2.86Å; H68-K72 PolarHBondContact NE2-NZ 3.4Å; H68-K72 PolarHBondContact O-N 3.34Å
69	W	52.2	Low	58.6	Low	125 Å²	125	122.4 Å²	122.4	47%	0.473	58%	0.58	S	S	.	*	H	α-helix	trans	-74.9	-37.3	179.7	5.2	-90.5	0	0	0	112.2	P61 G65 S66 R67 L71 K72 V73	P61-W69 HydrophobicContact CB-CZ2 4.41Å; G65-W69 VanDerWaalsContact C-CZ2 3.42Å; G65-W69 PolarHBondContact O-NE1 2.97Å; S66-W69 VanDerWaalsContact CB-CZ3 3.46Å; S66-W69 WeakPolarHBondContact O-CH2 3.5Å; S66-W69 WeakPolarHBondContact O-CZ3 3.28Å; S66-W69 WeakPolarHBondContact OG-CH2 3.37Å; S66-W69 WeakPolarHBondContact OG-CZ3 3.26Å; R67-W69 PolarHBondContact O-N 3.04Å; W69-L71 VanDerWaalsContact C-N 3.3Å; W69-L71 PolarHBondContact O-N 3.34Å; W69-K72 PolarHBondContact O-N 3.42Å; W69-V73 VanDerWaalsContact O-CG2 3.28Å; W69-V73 WeakPolarHBondContact O-CG2 3.46Å; W69-V73 PolarHBondContact O-N 3.31Å
70	M	60	Low	58.5	Low	106 Å²	106	116.8 Å²	116.8	52%	0.522	57%	0.567	S	S	.	*	H	α-helix	trans	-61.8	-37.4	174.6	-82.1	-171	-77.2	0	0	112.6	S66 R67 R74	S66-M70 WeakPolarHBondContact O-CE 3.47Å; R67-M70 PolarHBondContact O-N 3.44Å; M70-R74 PolarHBondContact O-N 3.04Å
71	L	58.9	Low	58.4	Low	104 Å²	104	114.7 Å²	114.7	55%	0.545	56%	0.558	S	S	.	*	H	α-helix	trans	-67.7	-45.1	176.1	-69.1	170.1	0	0	0	111.6	R67 W69 V73 R74 D75	R67-L71 VanDerWaalsContact O-CG 3.26Å; R67-L71 WeakPolarHBondContact O-CG 3.5Å; R67-L71 PolarHBondContact O-N 3.13Å; W69-L71 VanDerWaalsContact C-N 3.3Å; W69-L71 PolarHBondContact O-N 3.34Å; L71-V73 VanDerWaalsContact C-N 3.33Å; L71-V73 PolarHBondContact O-N 2.99Å; L71-R74 PolarHBondContact O-N 3.3Å; L71-D75 PolarHBondContact O-N 3.48Å
72	K	58.2	Low	58.5	Low	128 Å²	128	114.6 Å²	114.6	56%	0.557	56%	0.556	S	S	*	*	H	α-helix	trans	-62.8	-36.8	176.5	-80.5	-174	170.7	170.8	0	113.6	H68 W69 S76	H68-K72 WeakPolarHBondContact NE2-CE 2.86Å; H68-K72 PolarHBondContact NE2-NZ 3.4Å; H68-K72 PolarHBondContact O-N 3.34Å; W69-K72 PolarHBondContact O-N 3.42Å; K72-S76 WeakPolarHBondContact O-CB 3.4Å; K72-S76 PolarHBondContact O-N 3.25Å; K72-S76 VanDerWaalsContact O-N 3.12Å; K72-S76 PolarHBondContact O-OG 3.34Å
73	V	59.4	Low	58.4	Low	91 Å²	91	115.1 Å²	115.1	55%	0.552	56%	0.556	S	S	*	*	H	α-helix	trans	-67.7	-44.2	176	173.5	0	0	0	0	110.4	W69 L71 S76 C77	W69-V73 VanDerWaalsContact O-CG2 3.28Å; W69-V73 WeakPolarHBondContact O-CG2 3.46Å; W69-V73 PolarHBondContact O-N 3.31Å; L71-V73 VanDerWaalsContact C-N 3.33Å; L71-V73 PolarHBondContact O-N 2.99Å; V73-S76 PolarHBondContact O-N 2.97Å; V73-C77 PolarHBondContact O-N 3.26Å; V73-C77 PolarHBondContact O-SG 3.4Å; V73-C77 VanDerWaalsContact O-SG 3.34Å
74	R	60	Low	58.7	Low	189 Å²	189	110.9 Å²	110.9	71%	0.713	54%	0.538	S	S	*	.	H	α-helix	trans	-60.7	-45.8	175.5	-83.4	-175.2	169	-175.6	-3.3	112.7	M70 L71 S76 C77 Q78	M70-R74 PolarHBondContact O-N 3.04Å; L71-R74 PolarHBondContact O-N 3.3Å; R74-S76 VanDerWaalsContact C-N 3.26Å; R74-S76 PolarHBondContact O-N 2.92Å; R74-C77 PolarHBondContact O-N 3.12Å; R74-Q78 PolarHBondContact O-N 3.22Å
75	D	59.8	Low	59.1	Low	88 Å²	88	105.8 Å²	105.8	47%	0.471	52%	0.524	S	S	.	.	H	α-helix	trans	-61.1	-36.6	177.6	-74.8	-7.7	0	0	0	111.9	L71 K79	L71-D75 PolarHBondContact O-N 3.48Å; D75-K79 VanDerWaalsContact O-CG 3.3Å; D75-K79 WeakPolarHBondContact O-CG 3.32Å; D75-K79 PolarHBondContact O-N 2.78Å; D75-K79 VanDerWaalsContact O-N 3.09Å
76	S	58.2	Low	59.3	Low	68 Å²	68	108.3 Å²	108.3	48%	0.476	53%	0.534	S	S	.	.	H	α-helix	trans	-69.7	-43.7	177.4	-56.9	0	0	0	0	111.4	K72 V73 R74 Q78 K79 L80	K72-S76 WeakPolarHBondContact O-CB 3.4Å; K72-S76 PolarHBondContact O-N 3.25Å; K72-S76 VanDerWaalsContact O-N 3.12Å; K72-S76 PolarHBondContact O-OG 3.34Å; V73-S76 PolarHBondContact O-N 2.97Å; R74-S76 VanDerWaalsContact C-N 3.26Å; R74-S76 PolarHBondContact O-N 2.92Å; S76-Q78 PolarHBondContact O-N 3.09Å; S76-K79 PolarHBondContact O-N 2.95Å; S76-L80 WeakPolarHBondContact O-CG 3.26Å; S76-L80 PolarHBondContact O-N 3.45Å
77	C	59.6	Low	59.7	Low	68 Å²	68	109 Å²	109	46%	0.459	54%	0.541	S	S	.	.	H	α-helix	trans	-63	-40.4	175.6	-68.1	0	0	0	0	112.3	V73 R74 L80 Q81	V73-C77 PolarHBondContact O-N 3.26Å; V73-C77 PolarHBondContact O-SG 3.4Å; V73-C77 VanDerWaalsContact O-SG 3.34Å; R74-C77 PolarHBondContact O-N 3.12Å; C77-L80 PolarHBondContact O-N 2.95Å; C77-Q81 WeakPolarHBondContact O-CG 3.41Å; C77-Q81 PolarHBondContact O-N 3.26Å
78	Q	57.8	Low	59.8	Low	123 Å²	123	108.5 Å²	108.5	58%	0.575	54%	0.54	S	S	*	.	H	α-helix	trans	-65.7	-41.1	178.1	-167	170.8	9.9	0	0	111.6	R74 S76 L80 Q81 T82	R74-Q78 PolarHBondContact O-N 3.22Å; S76-Q78 PolarHBondContact O-N 3.09Å; Q78-L80 VanDerWaalsContact C-N 3.35Å; Q78-L80 PolarHBondContact O-N 3.33Å; Q78-Q81 PolarHBondContact O-N 2.86Å; Q78-T82 PolarHBondContact O-N 3Å; Q78-T82 VanDerWaalsContact O-N 3.09Å; Q78-T82 PolarHBondContact O-OG1 3.39Å; Q78-T82 VanDerWaalsContact O-OG1 3.07Å
79	K	59.2	Low	60	Low	150 Å²	150	109.4 Å²	109.4	65%	0.652	54%	0.544	S	S	*	.	H	α-helix	trans	-62	-40.4	173.5	-74.1	174.9	-177.1	-179.6	0	112.4	D75 S76 T82 V83	D75-K79 VanDerWaalsContact O-CG 3.3Å; D75-K79 WeakPolarHBondContact O-CG 3.32Å; D75-K79 PolarHBondContact O-N 2.78Å; D75-K79 VanDerWaalsContact O-N 3.09Å; S76-K79 PolarHBondContact O-N 2.95Å; K79-T82 PolarHBondContact O-N 3.45Å; K79-V83 WeakPolarHBondContact O-CG2 3.25Å; K79-V83 PolarHBondContact O-N 3.09Å
80	L	59.1	Low	60.5	Low	121 Å²	121	106 Å²	106	63%	0.634	54%	0.543	S	S	*	.	H	α-helix	trans	-67.3	-37	177.6	-69.5	173.3	0	0	0	112.3	S76 C77 Q78 V83 D84	S76-L80 WeakPolarHBondContact O-CG 3.26Å; S76-L80 PolarHBondContact O-N 3.45Å; C77-L80 PolarHBondContact O-N 2.95Å; Q78-L80 VanDerWaalsContact C-N 3.35Å; Q78-L80 PolarHBondContact O-N 3.33Å; L80-V83 PolarHBondContact O-N 3.33Å; L80-D84 PolarHBondContact O-N 3.03Å
81	Q	58.2	Low	60.4	Low	135 Å²	135	106.7 Å²	106.7	63%	0.631	55%	0.548	S	S	*	.	H	α-helix	trans	-62.5	-44.2	173.5	-74.9	176.1	-25.8	0	0	111.7	C77 Q78 V83 D84 E85	C77-Q81 WeakPolarHBondContact O-CG 3.41Å; C77-Q81 PolarHBondContact O-N 3.26Å; Q78-Q81 PolarHBondContact O-N 2.86Å; Q81-V83 VanDerWaalsContact C-N 3.34Å; Q81-V83 PolarHBondContact O-N 3.36Å; Q81-D84 PolarHBondContact O-N 3.38Å; Q81-E85 WeakPolarHBondContact O-CB 3.41Å; Q81-E85 PolarHBondContact O-N 2.64Å
82	T	61.4	Low	60.3	Low	81 Å²	81	103.8 Å²	103.8	50%	0.497	54%	0.543	S	S	.	.	H	α-helix	trans	-63.5	-39.3	176.8	-49.4	0	0	0	0	111.8	Q78 K79 E85 T86	Q78-T82 PolarHBondContact O-N 3Å; Q78-T82 VanDerWaalsContact O-N 3.09Å; Q78-T82 PolarHBondContact O-OG1 3.39Å; Q78-T82 VanDerWaalsContact O-OG1 3.07Å; K79-T82 PolarHBondContact O-N 3.45Å; T82-E85 PolarHBondContact O-N 2.89Å; T82-T86 WeakPolarHBondContact O-CB 3.36Å; T82-T86 PolarHBondContact O-N 3.35Å; T82-T86 PolarHBondContact O-OG1 3.05Å
83	V	60.9	Low	60.2	Low	95 Å²	95	101.6 Å²	101.6	58%	0.576	54%	0.544	S	S	*	.	H	α-helix	trans	-65.9	-43.2	177.1	173.1	0	0	0	0	111.5	K79 L80 Q81 E85 T86 A87	K79-V83 WeakPolarHBondContact O-CG2 3.25Å; K79-V83 PolarHBondContact O-N 3.09Å; L80-V83 PolarHBondContact O-N 3.33Å; Q81-V83 VanDerWaalsContact C-N 3.34Å; Q81-V83 PolarHBondContact O-N 3.36Å; V83-E85 VanDerWaalsContact C-N 3.35Å; V83-T86 PolarHBondContact O-N 3.47Å; V83-A87 VanDerWaalsContact O-CB 3.32Å; V83-A87 WeakPolarHBondContact O-CB 3.38Å; V83-A87 PolarHBondContact O-N 2.78Å
84	D	63.3	Low	59.8	Low	84 Å²	84	107.1 Å²	107.1	45%	0.449	56%	0.555	S	S	.	*	H	α-helix	trans	-63.2	-42.1	176.4	-171	57.4	0	0	0	111.3	L80 Q81 A87 R88	L80-D84 PolarHBondContact O-N 3.03Å; Q81-D84 PolarHBondContact O-N 3.38Å; D84-A87 PolarHBondContact O-N 3.09Å; D84-R88 WeakPolarHBondContact O-CB 3.31Å; D84-R88 VanDerWaalsContact O-CG 3.26Å; D84-R88 WeakPolarHBondContact O-CG 3.48Å; D84-R88 PolarHBondContact O-N 2.87Å; D84-R88 IonicContact OD2-NH1 3.34Å; D84-R88 PolarHBondContact OD2-NH1 2.91Å
85	E	65.1	Low	59.5	Low	120 Å²	120	108.8 Å²	108.8	56%	0.561	56%	0.561	S	S	*	*	H	α-helix	trans	-65.1	-41.9	177	-173.5	156.9	-162	0	0	112.1	Q81 T82 V83 R88 Q89	Q81-E85 WeakPolarHBondContact O-CB 3.41Å; Q81-E85 PolarHBondContact O-N 2.64Å; T82-E85 PolarHBondContact O-N 2.89Å; V83-E85 VanDerWaalsContact C-N 3.35Å; E85-R88 PolarHBondContact O-N 3.42Å; E85-Q89 WeakPolarHBondContact O-CB 3.3Å; E85-Q89 WeakPolarHBondContact O-CG 3.33Å; E85-Q89 PolarHBondContact O-N 3.07Å
86	T	61.4	Low	59.2	Low	79 Å²	79	114.3 Å²	114.3	49%	0.485	58%	0.581	S	S	.	*	H	α-helix	trans	-65.6	-40.4	176.1	-47	0	0	0	0	111.1	T82 V83 Q89 A90	T82-T86 WeakPolarHBondContact O-CB 3.36Å; T82-T86 PolarHBondContact O-N 3.35Å; T82-T86 PolarHBondContact O-OG1 3.05Å; V83-T86 PolarHBondContact O-N 3.47Å; T86-Q89 PolarHBondContact O-N 3.46Å; T86-A90 WeakPolarHBondContact O-CB 3.46Å; T86-A90 PolarHBondContact O-N 2.92Å
87	A	65	Low	58.7	Low	44 Å²	44	114.4 Å²	114.4	36%	0.364	59%	0.592	S	S	.	*	H	α-helix	trans	-64.9	-40.9	175.6	0	0	0	0	0	111.8	V83 D84 A90 L91	V83-A87 VanDerWaalsContact O-CB 3.32Å; V83-A87 WeakPolarHBondContact O-CB 3.38Å; V83-A87 PolarHBondContact O-N 2.78Å; D84-A87 PolarHBondContact O-N 3.09Å; A87-A90 PolarHBondContact O-N 3.32Å; A87-L91 WeakPolarHBondContact O-CB 3.35Å; A87-L91 VanDerWaalsContact O-CG 3.31Å; A87-L91 WeakPolarHBondContact O-CG 3.32Å; A87-L91 PolarHBondContact O-N 2.86Å
88	R	60.1	Low	58.2	Low	174 Å²	174	114.5 Å²	114.5	66%	0.657	60%	0.598	S	S	*	*	H	α-helix	trans	-66.7	-39.8	175.1	-73.6	173.7	104.2	141	1.8	112.4	D84 E85 L91 G92	D84-R88 WeakPolarHBondContact O-CB 3.31Å; D84-R88 VanDerWaalsContact O-CG 3.26Å; D84-R88 WeakPolarHBondContact O-CG 3.48Å; D84-R88 PolarHBondContact O-N 2.87Å; D84-R88 IonicContact OD2-NH1 3.34Å; D84-R88 PolarHBondContact OD2-NH1 2.91Å; E85-R88 PolarHBondContact O-N 3.42Å; R88-L91 PolarHBondContact O-N 3.36Å; R88-G92 WeakPolarHBondContact O-CA 3.38Å; R88-G92 PolarHBondContact O-N 3Å
89	Q	61.3	Low	57.8	Low	125 Å²	125	112.2 Å²	112.2	58%	0.584	61%	0.607	S	S	*	*	H	α-helix	trans	-65.1	-41.3	174.1	-74.2	179	4.7	0	0	111.5	E85 T86 G92 S93	E85-Q89 WeakPolarHBondContact O-CB 3.3Å; E85-Q89 WeakPolarHBondContact O-CG 3.33Å; E85-Q89 PolarHBondContact O-N 3.07Å; T86-Q89 PolarHBondContact O-N 3.46Å; Q89-G92 PolarHBondContact O-N 2.71Å; Q89-S93 WeakPolarHBondContact O-CB 3.38Å; Q89-S93 PolarHBondContact O-N 2.86Å; Q89-S93 PolarHBondContact O-OG 3.39Å
90	A	62.7	Low	57.6	Low	53 Å²	53	112.1 Å²	112.1	44%	0.438	61%	0.613	S	S	.	*	H	α-helix	trans	-66.2	-36.1	175.7	0	0	0	0	0	112.9	T86 A87 S93	T86-A90 WeakPolarHBondContact O-CB 3.46Å; T86-A90 PolarHBondContact O-N 2.92Å; A87-A90 PolarHBondContact O-N 3.32Å; A90-S93 PolarHBondContact O-OG 3.41Å; A90-S93 VanDerWaalsContact O-OG 3.14Å
91	L	58.8	Low	57.2	Low	120 Å²	120	111.5 Å²	111.5	63%	0.628	62%	0.617	S	S	*	*	H	α-helix	trans	-78.1	-34.4	175.9	-73.4	166.5	0	0	0	112.7	A87 R88	A87-L91 WeakPolarHBondContact O-CB 3.35Å; A87-L91 VanDerWaalsContact O-CG 3.31Å; A87-L91 WeakPolarHBondContact O-CG 3.32Å; A87-L91 PolarHBondContact O-N 2.86Å; R88-L91 PolarHBondContact O-N 3.36Å
92	G	57.2	Low	57	Low	44 Å²	44	117.4 Å²	117.4	45%	0.454	63%	0.633	S	S	.	*	H	α-helix	trans	-73.6	-29.6	179	0	0	0	0	0	113.6	R88 Q89 R95	R88-G92 WeakPolarHBondContact O-CA 3.38Å; R88-G92 PolarHBondContact O-N 3Å; Q89-G92 PolarHBondContact O-N 2.71Å; G92-R95 PolarHBondContact O-N 2.97Å
93	S	54.7	Low	56.5	Low	81 Å²	81	124.8 Å²	124.8	57%	0.566	65%	0.652	S	S	*	*	H	α-helix	trans	-75.5	-23.5	175	46.9	0	0	0	0	113.3	Q89 A90 R95	Q89-S93 WeakPolarHBondContact O-CB 3.38Å; Q89-S93 PolarHBondContact O-N 2.86Å; Q89-S93 PolarHBondContact O-OG 3.39Å; A90-S93 PolarHBondContact O-OG 3.41Å; A90-S93 VanDerWaalsContact O-OG 3.14Å; S93-R95 VanDerWaalsContact C-N 3.34Å
94	R	52.5	Low	55.8	Low	208 Å²	208	123.7 Å²	123.7	79%	0.785	66%	0.66	S	S	*	*	G	3₁₀ helix	trans	-76.4	-16.8	172.8	-72.4	-172.2	178.9	-131.3	0.9	114.2
95	R	53.3	Low	55.2	Low	224 Å²	224	125.2 Å²	125.2	85%	0.845	68%	0.677	S	S	*	*	G	3₁₀ helix	trans	-91	-1.8	-179	-69.1	-170.6	174.5	-164.7	-0.9	114.7	G92 S93	G92-R95 PolarHBondContact O-N 2.97Å; S93-R95 VanDerWaalsContact C-N 3.34Å
96	K	52.4	Low	54.4	Low	204 Å²	204	131.6 Å²	131.6	89%	0.887	70%	0.696	S	S	*	*	G	3₁₀ helix	trans	-100.1	8.7	174.2	-90.2	-167.5	175.5	-175.6	0	115.3
97	G	48.7	Very low	53.7	Low	69 Å²	69	131.2 Å²	131.2	71%	0.711	71%	0.707	S	S	*	*	S	Bend	trans	-139.1	1.4	-179.6	0	0	0	0	0	116.2	G99	G97-G99 VanDerWaalsContact C-N 3.26Å; G97-G99 PolarHBondContact O-N 3.46Å
98	A	50	Low	53	Low	70 Å²	70	134.9 Å²	134.9	58%	0.579	73%	0.728	S	S	*	*			trans	-81.3	76.2	175.1	0	0	0	0	0	110	L100	A98-L100 PolarHBondContact O-N 3.14Å
99	G	47.6	Very low	52.1	Low	75 Å²	75	130.4 Å²	130.4	77%	0.773	74%	0.736	S	S	*	*			trans	-59.9	88.7	155.9	0	0	0	0	0	108.5	G97	G97-G99 VanDerWaalsContact C-N 3.26Å; G97-G99 PolarHBondContact O-N 3.46Å
100	L	56.8	Low	51.5	Low	149 Å²	149	129 Å²	129	78%	0.78	75%	0.745	S	S	*	*			trans	-60.1	141.3	171.1	-75.8	157.6	0	0	0	108.7	A98 R102	A98-L100 PolarHBondContact O-N 3.14Å; L100-R102 PolarHBondContact O-N 3.46Å
101	P	50.4	Low	50.8	Low	108 Å²	108	138.4 Å²	138.4	70%	0.701	79%	0.788	S	S	*	*			trans	-65.3	127.8	-160.5	26.7	-34.1	0	0	0	110.5	R103	P101-R103 PolarHBondContact O-N 2.76Å
102	R	54.3	Low	50.4	Low	258 Å²	258	139.3 Å²	139.3	97%	0.974	80%	0.796	S	S	*	*			trans	-68.3	79.3	163.3	-84.9	-170.1	169.4	179.7	-2.5	108.7	L100 G104	L100-R102 PolarHBondContact O-N 3.46Å; R102-G104 PolarHBondContact O-N 3.32Å
103	R	49.6	Very low	50	Low	236 Å²	236	144.3 Å²	144.3	89%	0.891	81%	0.814	S	S	*	*			trans	-70.5	116.9	157.5	-112	-176.1	176.4	-104.2	0.8	106.7	P101	P101-R103 PolarHBondContact O-N 2.76Å
104	G	45.9	Very low	49.7	Very low	72 Å²	72	147.8 Å²	147.8	74%	0.742	83%	0.828	S	S	*	*			trans	115.8	95.3	158.4	0	0	0	0	0	115	R102	R102-G104 PolarHBondContact O-N 3.32Å
105	S	51.7	Low	49.6	Very low	117 Å²	117	144.3 Å²	144.3	82%	0.818	83%	0.831	S	S	*	*				-174	111.9	124.4	47.9	0	0	0	0	109.2	G107	S105-G107 PolarHBondContact O-N 3.48Å
106	R	47.5	Very low	49.3	Very low	254 Å²	254	139.3 Å²	139.3	96%	0.958	83%	0.83	S	S	*	*			trans	-51.3	125.8	160.2	-86.7	171.3	172	175	-2.7	109.9
107	G	47.9	Very low	49.1	Very low	70 Å²	70	135 Å²	135	72%	0.722	83%	0.826	S	S	*	*			trans	55.8	-180	148.3	0	0	0	0	0	118.3	S105	S105-G107 PolarHBondContact O-N 3.48Å
108	P	49.4	Very low	49.2	Very low	122 Å²	122	139.7 Å²	139.7	79%	0.792	83%	0.834	S	S	*	*			cis	-120.7	162.6	10.1	36.7	-21.1	0	0	0	113.3
109	G	40.9	Very low	49.1	Very low	80 Å²	80	145.1 Å²	145.1	83%	0.825	85%	0.854	S	S	*	*			trans	-59.9	143.5	157	0	0	0	0	0	110.2
110	A	49.8	Very low	49.2	Very low	95 Å²	95	150.9 Å²	150.9	79%	0.785	86%	0.86	S	S	*	*			trans	-150.5	114.8	161.5	0	0	0	0	0	106.4
111	D	46.4	Very low	48.5	Very low	250 Å²	250	151.1 Å²	151.1	100%	1.337	87%	0.868	S	S	*	*			trans	73.6	0	177.5	-116.3	27.8	0	0	0	119.4

Retrieved 111 of 111 residues in 259.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).