A0A077Z1X7_TRITR Loading...

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

AlphaFold DB , UniProt , Accession A0A077Z1X7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 119 aa.

						>A0A077Z1X7_TRITR|A0A077Z1X7
MLYNDGYDDCLRFPEEMSTRNPPLPNLPGGVYHKISDNYYYERDARRTVEPPVVTYDATAKMALPGPHVKVMILTLTSRFSSVAPLPGAGYQWKRNSVDELSQTKDDQSLKYLERYDSM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.1	Very low	67	Low	237 Å²	237	140.9 Å²	140.9	100%	1.167	74%	0.744	S	S	*	*				0	113.4	0	-84.7	174.2	172.8	0	0	107
2	L	52.4	Low	68.8	Low	177 Å²	177	144.5 Å²	144.5	93%	0.927	74%	0.74	S	S	*	*			trans	-90.4	98.9	178.2	-67.5	168.6	0	0	0	107.4
3	Y	51.5	Low	70.5	Confident	174 Å²	174	140.7 Å²	140.7	68%	0.682	72%	0.715	S	S	*	*			trans	-141.5	65.2	176.6	-117.7	-81.9	0	0	0	107.7	Y7	Y3-Y7 HydrophobicContact CE1-CD1 4.37Å
4	N	58	Low	72	Confident	156 Å²	156	138.6 Å²	138.6	83%	0.834	72%	0.715	S	S	*	*			trans	-126.2	6.7	-176.5	-83.8	-10.1	0	0	0	114.8
5	D	66.4	Low	73.3	Confident	159 Å²	159	141.8 Å²	141.8	85%	0.85	73%	0.726	S	S	*	*	S	Bend	trans	-105.6	8.8	-176.6	-61.5	1.3	0	0	0	113.1
6	G	66.3	Low	74.4	Confident	62 Å²	62	141.9 Å²	141.9	64%	0.639	72%	0.723	S	S	*	*			trans	61.7	51.8	-175	0	0	0	0	0	111.2	D8	G6-D8 PolarHBondContact O-N 2.98Å
7	Y	71.1	Confident	75.6	Confident	139 Å²	139	136.8 Å²	136.8	55%	0.545	70%	0.696	S	S	.	*			trans	-62.7	100.3	177	179.5	-98.2	0	0	0	109.6	Y3 D9	Y3-Y7 HydrophobicContact CE1-CD1 4.37Å; Y7-D9 HydrophobicContact CE1-CB 4.16Å
8	D	71.2	Confident	76.6	Confident	146 Å²	146	134.9 Å²	134.9	78%	0.781	70%	0.698	S	S	*	*			trans	-81.6	120.4	162.6	-78.1	-27.6	0	0	0	107.7	G6 C10	G6-D8 PolarHBondContact O-N 2.98Å; D8-C10 PolarHBondContact O-N 2.87Å
9	D	78.4	Confident	77.4	Confident	69 Å²	69	132.6 Å²	132.6	37%	0.369	69%	0.69	S	S	.	*			trans	-60.8	126.3	178.1	-170.5	-10	0	0	0	109.6	Y7 L11 F13	Y7-D9 HydrophobicContact CE1-CB 4.16Å; D9-L11 PolarHBondContact O-N 2.83Å; D9-L11 WeakPolarHBondContact OD1-CB 3.09Å; D9-L11 VanDerWaalsContact OD1-CG 3.23Å; D9-L11 WeakPolarHBondContact OD1-CG 3.41Å; D9-L11 PolarHBondContact OD1-N 2.69Å; D9-F13 HydrophobicContact CB-CE2 4.32Å; D9-F13 WeakPolarHBondContact OD2-CZ 3.2Å
10	C	84.6	Confident	78.3	Confident	118 Å²	118	136.3 Å²	136.3	80%	0.797	69%	0.694	S	S	*	*	S	Bend	trans	-71	-8.6	-179.9	-51.6	0	0	0	0	112.8	D8	D8-C10 PolarHBondContact O-N 2.87Å
11	L	90	Very high	79.1	Confident	113 Å²	113	136.6 Å²	136.6	59%	0.592	70%	0.698	S	S	*	*	S	Bend	trans	-74.1	139.1	177.5	-62.8	176.9	0	0	0	110.6	D9 F13	D9-L11 PolarHBondContact O-N 2.83Å; D9-L11 WeakPolarHBondContact OD1-CB 3.09Å; D9-L11 VanDerWaalsContact OD1-CG 3.23Å; D9-L11 WeakPolarHBondContact OD1-CG 3.41Å; D9-L11 PolarHBondContact OD1-N 2.69Å; L11-F13 HydrophobicContact CB-CE2 4.39Å; L11-F13 HydrophobicContact CB-CZ 4.22Å; L11-F13 WeakPolarHBondContact O-CE2 3.47Å
12	R	88.9	Confident	81.3	Confident	184 Å²	184	129.3 Å²	129.3	69%	0.694	67%	0.668	S	S	*	*	P	Polyproline II helix	trans	-93.2	121.4	176.2	-69.4	178.4	-72.4	168.4	-4.6	109.6	M17	R12-M17 HydrophobicContact CB-CE 4.4Å; R12-M17 HydrophobicContact CB-CG 3.82Å; R12-M17 HydrophobicContact CB-SD 3.55Å; R12-M17 VanDerWaalsContact CB-SD 3.55Å
13	F	91.4	Very high	83.4	Confident	95 Å²	95	126.4 Å²	126.4	42%	0.417	66%	0.66	S	S	.	*	P	Polyproline II helix	trans	-89.6	150.1	179.5	-63.1	-79.7	0	0	0	111.3	D9 L11 E15 E16 M17	D9-F13 HydrophobicContact CB-CE2 4.32Å; D9-F13 WeakPolarHBondContact OD2-CZ 3.2Å; L11-F13 HydrophobicContact CB-CE2 4.39Å; L11-F13 HydrophobicContact CB-CZ 4.22Å; L11-F13 WeakPolarHBondContact O-CE2 3.47Å; F13-E15 PolarHBondContact O-N 3.21Å; F13-E16 PolarHBondContact O-N 2.8Å; F13-M17 WeakPolarHBondContact O-CG 3.32Å; F13-M17 PolarHBondContact O-N 3.38Å
14	P	91.3	Very high	85.5	Confident	111 Å²	111	126.3 Å²	126.3	72%	0.721	67%	0.67	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.1	-28.5	-175	-28	35.7	0	0	0	115.1
15	E	90.7	Very high	87.3	Confident	187 Å²	187	123.8 Å²	123.8	87%	0.874	66%	0.662	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.2	-25.2	-179.2	-67.5	148	-157.1	0	0	113.2	F13	F13-E15 PolarHBondContact O-N 3.21Å
16	E	91.9	Very high	88.7	Confident	144 Å²	144	124 Å²	124	67%	0.673	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.1	-12.1	179.4	-58	176.4	156.6	0	0	112	F13	F13-E16 PolarHBondContact O-N 2.8Å
17	M	93.6	Very high	90.1	Very high	54 Å²	54	127.5 Å²	127.5	27%	0.266	67%	0.667	S	S	.	*	S	Bend	trans	-98	141.6	-178.5	-63.3	-166.6	77.1	0	0	111.5	R12 F13 R20	R12-M17 HydrophobicContact CB-CE 4.4Å; R12-M17 HydrophobicContact CB-CG 3.82Å; R12-M17 HydrophobicContact CB-SD 3.55Å; R12-M17 VanDerWaalsContact CB-SD 3.55Å; F13-M17 WeakPolarHBondContact O-CG 3.32Å; F13-M17 PolarHBondContact O-N 3.38Å; M17-R20 VanDerWaalsContact CE-NH2 3.28Å
18	S	93.6	Very high	91.3	Very high	104 Å²	104	126.6 Å²	126.6	73%	0.727	68%	0.678	S	S	*	*	P	Polyproline II helix	trans	-62.9	149.7	168	62.5	0	0	0	0	111.6
19	T	93.3	Very high	92.5	Very high	90 Å²	90	121.8 Å²	121.8	55%	0.552	66%	0.663	S	S	*	*	P	Polyproline II helix	trans	-53.8	146.5	174.4	-179.6	0	0	0	0	112.7	N21 P22	T19-N21 VanDerWaalsContact C-N 3.28Å; T19-N21 PolarHBondContact OG1-N 2.86Å; T19-P22 HydrophobicContact CG2-CB 4.19Å
20	R	94.4	Very high	93.3	Very high	206 Å²	206	121.4 Å²	121.4	78%	0.777	68%	0.675	S	S	*	*	S	Bend	trans	-77.6	-14.6	174.6	-61.1	-64.2	173.8	146	0.9	113.4	M17	M17-R20 VanDerWaalsContact CE-NH2 3.28Å
21	N	95.5	Very high	93.8	Very high	143 Å²	143	121.3 Å²	121.3	77%	0.765	67%	0.671	S	S	*	*	S	Bend	trans	-125.4	73.6	177.3	-168.7	37.7	0	0	0	109.7	T19	T19-N21 VanDerWaalsContact C-N 3.28Å; T19-N21 PolarHBondContact OG1-N 2.86Å
22	P	93.4	Very high	94.1	Very high	84 Å²	84	122.5 Å²	122.5	55%	0.545	67%	0.668	S	S	.	*	P	Polyproline II helix	trans	-68.6	153.5	178.2	30	-34.8	0	0	0	110.9	T19	T19-P22 HydrophobicContact CG2-CB 4.19Å
23	P	96.1	Very high	94.4	Very high	116 Å²	116	121.2 Å²	121.2	75%	0.753	67%	0.67	S	S	*	*	P	Polyproline II helix	trans	-61.6	153.6	171.8	28	-34.6	0	0	0	110.9
24	L	96.4	Very high	94.6	Very high	172 Å²	172	122.8 Å²	122.8	90%	0.901	68%	0.677	S	S	*	*	P	Polyproline II helix	trans	-58.1	129.5	175.3	-75.4	155.6	0	0	0	110.1
25	P	95.1	Very high	94.8	Very high	103 Å²	103	126.2 Å²	126.2	67%	0.669	69%	0.687	S	S	*	*	P	Polyproline II helix	trans	-73.7	142.1	-179.5	29.6	-34.2	0	0	0	111.3	L27	P25-L27 HydrophobicContact CB-CD2 4.23Å; P25-L27 HydrophobicContact CB-CG 4.39Å
26	N	96.2	Very high	95	Very high	164 Å²	164	121 Å²	121	88%	0.877	67%	0.672	S	S	*	*			trans	-103.6	92.1	167.2	-176.1	18.2	0	0	0	109.1
27	L	95.1	Very high	95.2	Very high	135 Å²	135	120.5 Å²	120.5	71%	0.707	67%	0.673	S	S	*	*	P	Polyproline II helix	trans	-78.4	139.6	-175.4	-61.6	177.1	0	0	0	111.1	P25	P25-L27 HydrophobicContact CB-CD2 4.23Å; P25-L27 HydrophobicContact CB-CG 4.39Å
28	P	96.7	Very high	95.3	Very high	120 Å²	120	119.9 Å²	119.9	78%	0.779	67%	0.671	S	S	*	*	P	Polyproline II helix	trans	-65.1	147.8	172.7	29	-34.2	0	0	0	110.5
29	G	95.7	Very high	95.4	Very high	46 Å²	46	121.9 Å²	121.9	47%	0.474	66%	0.664	S	S	.	*	P	Polyproline II helix	trans	-65.2	160.3	171.9	0	0	0	0	0	112.4
30	G	96.2	Very high	95.5	Very high	60 Å²	60	122.8 Å²	122.8	62%	0.619	66%	0.658	S	S	*	*	P	Polyproline II helix	trans	-70.6	171.6	172	0	0	0	0	0	112.9	Y32 H33	G30-Y32 PolarHBondContact O-N 3.5Å; G30-H33 WeakPolarHBondContact O-CB 3.23Å; G30-H33 PolarHBondContact O-N 2.86Å
31	V	95.1	Very high	95.4	Very high	117 Å²	117	120.9 Å²	120.9	71%	0.709	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59	-21.9	-176.4	-61.4	0	0	0	0	114.8	K34	V31-K34 WeakPolarHBondContact O-CE 3.21Å
32	Y	95	Very high	95.4	Very high	137 Å²	137	120 Å²	120	54%	0.537	64%	0.643	S	S	.	*	T	Hydrogen-bonded Turn	trans	-102.7	16.9	177.3	-61	-68.2	0	0	0	113.3	G30 K34 N38 R43	G30-Y32 PolarHBondContact O-N 3.5Å; Y32-K34 PolarHBondContact O-N 2.78Å; Y32-N38 PolarHBondContact O-ND2 2.71Å; Y32-R43 HydrophobicContact CE1-CB 4.13Å
33	H	95.2	Very high	95.3	Very high	158 Å²	158	120.6 Å²	120.6	73%	0.731	64%	0.635	S	S	*	*			trans	-79.4	63.4	170.7	-166	-168.8	0	0	0	110.3	G30	G30-H33 WeakPolarHBondContact O-CB 3.23Å; G30-H33 PolarHBondContact O-N 2.86Å
34	K	95.9	Very high	95.2	Very high	127 Å²	127	115.5 Å²	115.5	55%	0.552	60%	0.601	S	S	*	*			trans	-121.1	146.5	-176	-61.8	178.5	-177.6	177.3	0	110.8	V31 Y32 N38	V31-K34 WeakPolarHBondContact O-CE 3.21Å; Y32-K34 PolarHBondContact O-N 2.78Å; K34-N38 HydrophobicContact CB-CB 4.07Å; K34-N38 PolarHBondContact O-ND2 3.4Å
35	I	95.4	Very high	95.1	Very high	184 Å²	184	110.7 Å²	110.7	94%	0.944	59%	0.586	S	S	*	*	S	Bend	trans	-92.3	-26.1	-173.9	-38.7	166.3	0	0	0	111.8
36	S	96.5	Very high	95	Very high	78 Å²	78	114 Å²	114	55%	0.545	59%	0.585	S	S	.	*	S	Bend	trans	-129.1	164.2	176.3	65.9	0	0	0	0	110.8	N38	S36-N38 VanDerWaalsContact C-N 3.29Å; S36-N38 PolarHBondContact O-N 3.19Å
37	D	95.6	Very high	94.9	Very high	132 Å²	132	115.6 Å²	115.6	71%	0.706	58%	0.579	S	S	*	*	S	Bend	trans	50.4	46.6	174.9	-51.5	-44.2	0	0	0	113.5
38	N	95.1	Very high	94.7	Very high	42 Å²	42	114.1 Å²	114.1	23%	0.225	58%	0.575	C	S	.	*			trans	-138.8	48	-172.7	-170.7	23.6	0	0	0	111.6	Y32 K34 S36	Y32-N38 PolarHBondContact O-ND2 2.71Å; K34-N38 HydrophobicContact CB-CB 4.07Å; K34-N38 PolarHBondContact O-ND2 3.4Å; S36-N38 VanDerWaalsContact C-N 3.29Å; S36-N38 PolarHBondContact O-N 3.19Å
39	Y	96.2	Very high	94.5	Very high	145 Å²	145	113.9 Å²	113.9	57%	0.569	57%	0.572	S	S	*	*			trans	-69.1	138.5	-178.3	-69.4	-81.2	0	0	0	111.6	Y41 E42	Y39-Y41 VanDerWaalsContact C-N 3.25Å; Y39-Y41 HydrophobicContact CD1-CE1 4.3Å; Y39-Y41 HydrophobicContact CD2-CE1 4.31Å; Y39-Y41 HydrophobicContact CG-CD1 4.25Å; Y39-Y41 AromaticContact CG-CE1 3.76Å; Y39-Y41 HydrophobicContact CG-CE1 3.76Å; Y39-Y41 PolarHBondContact O-N 3.32Å; Y39-E42 PolarHBondContact O-N 3.44Å
40	Y	94.4	Very high	94.4	Very high	110 Å²	110	118.9 Å²	118.9	43%	0.431	58%	0.583	S	S	.	*	H	α-helix	trans	-59.9	-34.6	-179.1	-171.2	-84.2	0	0	0	113	E42 R43 D44 R46	Y40-E42 VanDerWaalsContact C-N 3.28Å; Y40-E42 PolarHBondContact O-N 2.76Å; Y40-R43 WeakPolarHBondContact O-CG 3.47Å; Y40-R43 PolarHBondContact O-N 2.86Å; Y40-D44 HydrophobicContact CD1-CB 3.94Å; Y40-D44 HydrophobicContact CE1-CB 3.53Å; Y40-D44 WeakPolarHBondContact CE1-OD2 3.32Å; Y40-D44 PolarHBondContact O-N 3.11Å; Y40-D44 VanDerWaalsContact O-N 3.15Å; Y40-R46 PolarHBondContact OH-NH2 3.39Å
41	Y	93.8	Very high	94.3	Very high	165 Å²	165	120.6 Å²	120.6	65%	0.647	58%	0.583	S	S	*	*	H	α-helix	trans	-67.7	-27.1	-175.1	78.4	-93.5	0	0	0	113.2	Y39 R43	Y39-Y41 VanDerWaalsContact C-N 3.25Å; Y39-Y41 HydrophobicContact CD1-CE1 4.3Å; Y39-Y41 HydrophobicContact CD2-CE1 4.31Å; Y39-Y41 HydrophobicContact CG-CD1 4.25Å; Y39-Y41 AromaticContact CG-CE1 3.76Å; Y39-Y41 HydrophobicContact CG-CE1 3.76Å; Y39-Y41 PolarHBondContact O-N 3.32Å; Y41-R43 VanDerWaalsContact C-N 3.33Å
42	E	93.6	Very high	94	Very high	125 Å²	125	120.9 Å²	120.9	58%	0.584	59%	0.587	S	S	*	*	H	α-helix	trans	-78.5	-20.2	-179.8	-61.7	-176.7	163.1	0	0	112.7	Y39 Y40	Y39-E42 PolarHBondContact O-N 3.44Å; Y40-E42 VanDerWaalsContact C-N 3.28Å; Y40-E42 PolarHBondContact O-N 2.76Å
43	R	92.7	Very high	93.7	Very high	97 Å²	97	120.7 Å²	120.7	37%	0.366	60%	0.6	S	S	.	*	H	α-helix	trans	-108.7	-12.2	-175.3	58.6	-179.9	169.4	89.9	-9	114.5	Y32 Y40 Y41 A45	Y32-R43 HydrophobicContact CE1-CB 4.13Å; Y40-R43 WeakPolarHBondContact O-CG 3.47Å; Y40-R43 PolarHBondContact O-N 2.86Å; Y41-R43 VanDerWaalsContact C-N 3.33Å; R43-A45 VanDerWaalsContact C-N 3.32Å; R43-A45 PolarHBondContact O-N 2.94Å
44	D	94.2	Very high	93.1	Very high	9 Å²	9	118.2 Å²	118.2	5%	0.048	60%	0.596	C	S	.	*			trans	-79.8	79.7	-176.4	-167.8	12.3	0	0	0	112	Y40 R46 R47	Y40-D44 HydrophobicContact CD1-CB 3.94Å; Y40-D44 HydrophobicContact CE1-CB 3.53Å; Y40-D44 WeakPolarHBondContact CE1-OD2 3.32Å; Y40-D44 PolarHBondContact O-N 3.11Å; Y40-D44 VanDerWaalsContact O-N 3.15Å; D44-R46 PolarHBondContact O-N 3.11Å; D44-R46 VanDerWaalsContact OD1-CB 3.28Å; D44-R46 WeakPolarHBondContact OD1-CB 3.28Å; D44-R46 WeakPolarHBondContact OD1-CG 3.37Å; D44-R46 IonicContact OD1-CZ 3.54Å; D44-R46 PolarHBondContact OD1-N 3.36Å; D44-R46 IonicContact OD1-NE 2.84Å; D44-R46 PolarHBondContact OD1-NE 3.47Å; D44-R46 IonicContact OD1-NH2 3.35Å; D44-R46 PolarHBondContact OD1-NH2 3.34Å; D44-R46 IonicContact OD2-CZ 3.81Å; D44-R46 IonicContact OD2-NE 3.85Å; D44-R46 IonicContact OD2-NH2 2.95Å; D44-R46 PolarHBondContact OD2-NH2 3.35Å; D44-R47 PolarHBondContact O-N 3.05Å; D44-R47 VanDerWaalsContact OD2-CD 3.23Å; D44-R47 WeakPolarHBondContact OD2-CD 3.36Å; D44-R47 VanDerWaalsContact OD2-CG 3.32Å; D44-R47 WeakPolarHBondContact OD2-CG 3.45Å; D44-R47 IonicContact OD2-NE 3.25Å; D44-R47 PolarHBondContact OD2-NE 3.27Å
45	A	93	Very high	92.2	Very high	71 Å²	71	117 Å²	117	59%	0.587	60%	0.599	S	S	*	*	G	3₁₀ helix	trans	-57.8	-20.6	175.8	0	0	0	0	0	113.3	R43 R47 T48	R43-A45 VanDerWaalsContact C-N 3.32Å; R43-A45 PolarHBondContact O-N 2.94Å; A45-R47 PolarHBondContact O-N 3.13Å; A45-T48 PolarHBondContact O-N 3.21Å; A45-T48 VanDerWaalsContact O-N 3.16Å
46	R	94.1	Very high	91.6	Very high	173 Å²	173	117.2 Å²	117.2	65%	0.653	59%	0.589	S	S	*	*	G	3₁₀ helix	trans	-66.5	-26.6	177.1	-53.8	174	-59.6	143	14.8	112	Y40 D44	Y40-R46 PolarHBondContact OH-NH2 3.39Å; D44-R46 PolarHBondContact O-N 3.11Å; D44-R46 VanDerWaalsContact OD1-CB 3.28Å; D44-R46 WeakPolarHBondContact OD1-CB 3.28Å; D44-R46 WeakPolarHBondContact OD1-CG 3.37Å; D44-R46 IonicContact OD1-CZ 3.54Å; D44-R46 PolarHBondContact OD1-N 3.36Å; D44-R46 IonicContact OD1-NE 2.84Å; D44-R46 PolarHBondContact OD1-NE 3.47Å; D44-R46 IonicContact OD1-NH2 3.35Å; D44-R46 PolarHBondContact OD1-NH2 3.34Å; D44-R46 IonicContact OD2-CZ 3.81Å; D44-R46 IonicContact OD2-NE 3.85Å; D44-R46 IonicContact OD2-NH2 2.95Å; D44-R46 PolarHBondContact OD2-NH2 3.35Å
47	R	93.1	Very high	90.9	Very high	197 Å²	197	117 Å²	117	74%	0.743	58%	0.582	S	S	*	*	G	3₁₀ helix	trans	-90.1	-9.1	176.2	-70.2	176	-179.8	-98.4	1.1	113.2	D44 A45 V49	D44-R47 PolarHBondContact O-N 3.05Å; D44-R47 VanDerWaalsContact OD2-CD 3.23Å; D44-R47 WeakPolarHBondContact OD2-CD 3.36Å; D44-R47 VanDerWaalsContact OD2-CG 3.32Å; D44-R47 WeakPolarHBondContact OD2-CG 3.45Å; D44-R47 IonicContact OD2-NE 3.25Å; D44-R47 PolarHBondContact OD2-NE 3.27Å; A45-R47 PolarHBondContact O-N 3.13Å; R47-V49 VanDerWaalsContact C-N 3.35Å
48	T	92.2	Very high	90.1	Very high	103 Å²	103	114.6 Å²	114.6	63%	0.632	58%	0.581	S	S	*	*	S	Bend	trans	-87	-8.1	175.6	-43.2	0	0	0	0	112.2	A45 E50	A45-T48 PolarHBondContact O-N 3.21Å; A45-T48 VanDerWaalsContact O-N 3.16Å; T48-E50 PolarHBondContact O-N 3.34Å; T48-E50 VanDerWaalsContact O-N 3.11Å
49	V	92	Very high	89.5	Confident	116 Å²	116	118.5 Å²	118.5	70%	0.703	61%	0.606	S	S	*	*			trans	-71.4	107.4	178.2	-178.7	0	0	0	0	109.4	R47	R47-V49 VanDerWaalsContact C-N 3.35Å
50	E	93.5	Very high	88.3	Confident	151 Å²	151	113.6 Å²	113.6	71%	0.706	60%	0.595	S	S	*	*	P	Polyproline II helix	trans	-81.1	155.1	173.3	-68.5	-63.7	154.2	0	0	111.3	T48	T48-E50 PolarHBondContact O-N 3.34Å; T48-E50 VanDerWaalsContact O-N 3.11Å
51	P	93	Very high	87	Confident	96 Å²	96	118.7 Å²	118.7	62%	0.623	62%	0.62	S	S	*	*	P	Polyproline II helix	trans	-56.6	152.2	169.6	-22.6	33.8	0	0	0	112	V53	P51-V53 PolarHBondContact O-N 3.24Å
52	P	90.7	Very high	85.2	Confident	123 Å²	123	118.7 Å²	118.7	80%	0.799	63%	0.628	S	S	*	*	P	Polyproline II helix	trans	-56.5	139.4	176.4	-23.8	33.4	0	0	0	112.4	V54	P52-V54 PolarHBondContact O-N 2.95Å
53	V	86.6	Confident	83.5	Confident	133 Å²	133	117.2 Å²	117.2	81%	0.806	64%	0.636	S	S	*	*	P	Polyproline II helix	trans	-74.5	120.4	173.9	-179.8	0	0	0	0	109.3	P51 T55	P51-V53 PolarHBondContact O-N 3.24Å; V53-T55 PolarHBondContact O-N 3.28Å
54	V	84.3	Confident	81.8	Confident	106 Å²	106	118.1 Å²	118.1	64%	0.642	65%	0.648	S	S	*	*			trans	-78.4	114.5	177.4	-178.8	0	0	0	0	109.5	P52 D57	P52-V54 PolarHBondContact O-N 2.95Å; V54-D57 HydrophobicContact CG1-CB 4.09Å
55	T	77.3	Confident	80	Confident	102 Å²	102	123.9 Å²	123.9	63%	0.626	69%	0.686	S	S	*	*	S	Bend	trans	-89	-20.9	-179.7	55.4	0	0	0	0	113.6	V53 L64	V53-T55 PolarHBondContact O-N 3.28Å; T55-L64 WeakPolarHBondContact O-CD2 3.28Å; T55-L64 WeakPolarHBondContact O-CG 3.44Å
56	Y	80.8	Confident	78.1	Confident	188 Å²	188	122.7 Å²	122.7	74%	0.737	68%	0.681	S	S	*	*			trans	-154.7	131.3	177.4	174.7	-99.8	0	0	0	109.5	A58	Y56-A58 HydrophobicContact CE1-CB 4.3Å
57	D	82.1	Confident	75.9	Confident	74 Å²	74	119.8 Å²	119.8	40%	0.396	68%	0.684	S	S	.	*			trans	-140.1	124	170.8	177.6	-9	0	0	0	107.4	V54 T59 A60	V54-D57 HydrophobicContact CG1-CB 4.09Å; D57-T59 PolarHBondContact O-N 3.16Å; D57-T59 PolarHBondContact OD1-N 3.33Å; D57-T59 PolarHBondContact OD1-OG1 3.15Å; D57-T59 PolarHBondContact OD2-OG1 3.01Å; D57-A60 HydrophobicContact CB-CB 3.84Å; D57-A60 PolarHBondContact OD1-N 3.29Å
58	A	80	Confident	73.7	Confident	81 Å²	81	119.7 Å²	119.7	67%	0.669	69%	0.692	S	S	*	*	S	Bend	trans	-68.8	-20.7	-177.1	0	0	0	0	0	113	Y56	Y56-A58 HydrophobicContact CE1-CB 4.3Å
59	T	81.8	Confident	71.5	Confident	124 Å²	124	120.1 Å²	120.1	76%	0.761	69%	0.694	S	S	*	*	S	Bend	trans	-96.5	-26.2	-178.2	64.7	0	0	0	0	112.8	D57	D57-T59 PolarHBondContact O-N 3.16Å; D57-T59 PolarHBondContact OD1-N 3.33Å; D57-T59 PolarHBondContact OD1-OG1 3.15Å; D57-T59 PolarHBondContact OD2-OG1 3.01Å
60	A	72	Confident	69.3	Low	41 Å²	41	123.6 Å²	123.6	34%	0.339	70%	0.7	S	S	.	*			trans	-84.9	121.7	178.6	0	0	0	0	0	110.8	D57 M62	D57-A60 HydrophobicContact CB-CB 3.84Å; D57-A60 PolarHBondContact OD1-N 3.29Å; A60-M62 HydrophobicContact CB-CG 4.29Å; A60-M62 PolarHBondContact O-N 3.05Å
61	K	65.4	Low	67.1	Low	218 Å²	218	122.1 Å²	122.1	95%	0.948	70%	0.701	S	S	*	*			trans	-74.3	41.4	170	-59.2	-165.3	-176.2	-171.2	0	112.3
62	M	57.9	Low	64.7	Low	165 Å²	165	125.1 Å²	125.1	81%	0.813	71%	0.708	S	S	*	*			trans	-95.8	108.4	178.6	-64.8	-149.1	81.1	0	0	109	A60 L64	A60-M62 HydrophobicContact CB-CG 4.29Å; A60-M62 PolarHBondContact O-N 3.05Å; M62-L64 PolarHBondContact O-N 2.95Å
63	A	56.7	Low	62.5	Low	93 Å²	93	126 Å²	126	77%	0.769	71%	0.705	S	S	*	*			trans	-62.6	126.6	162.5	0	0	0	0	0	107.7
64	L	58.2	Low	60.3	Low	116 Å²	116	125.8 Å²	125.8	61%	0.607	70%	0.698	S	S	*	*			trans	-48.3	128.7	173.1	-80.2	163.2	0	0	0	109.7	T55 M62 G66	T55-L64 WeakPolarHBondContact O-CD2 3.28Å; T55-L64 WeakPolarHBondContact O-CG 3.44Å; M62-L64 PolarHBondContact O-N 2.95Å; L64-G66 PolarHBondContact O-N 3.25Å
65	P	55.6	Low	58.3	Low	130 Å²	130	126.4 Å²	126.4	84%	0.844	70%	0.703	S	S	*	*			trans	-71.9	64.9	158.1	31.2	-31	0	0	0	107.6
66	G	51.9	Low	56.8	Low	47 Å²	47	127.5 Å²	127.5	49%	0.485	70%	0.704	S	S	.	*			trans	-72.1	133.8	170.4	0	0	0	0	0	107.9	L64 H68	L64-G66 PolarHBondContact O-N 3.25Å; G66-H68 PolarHBondContact O-N 2.84Å
67	P	49.8	Very low	55.1	Low	111 Å²	111	125.3 Å²	125.3	72%	0.721	71%	0.711	S	S	*	*			trans	-57.3	129.9	160.8	17	-13.8	0	0	0	106.3	V69	P67-V69 HydrophobicContact CG-CG2 4.4Å; P67-V69 PolarHBondContact O-N 3.35Å
68	H	45.2	Very low	53.6	Low	196 Å²	196	126.1 Å²	126.1	91%	0.907	72%	0.722	S	S	*	*			trans	-58.8	86.9	163.3	-115.4	-78.7	0	0	0	106.3	G66 K70	G66-H68 PolarHBondContact O-N 2.84Å; H68-K70 PolarHBondContact O-N 2.75Å
69	V	47.4	Very low	52.3	Low	112 Å²	112	131 Å²	131	68%	0.679	72%	0.723	S	S	*	*			trans	-67.4	95.4	171.5	-175.8	0	0	0	0	104	P67 V71	P67-V69 HydrophobicContact CG-CG2 4.4Å; P67-V69 PolarHBondContact O-N 3.35Å; V69-V71 VanDerWaalsContact C-N 3.25Å; V69-V71 PolarHBondContact O-N 3.26Å
70	K	46	Very low	50.8	Low	189 Å²	189	131.8 Å²	131.8	82%	0.822	72%	0.716	S	S	*	*			trans	-53.8	105.7	157.4	-88.4	-178.7	175.6	178	0	104	H68 M72	H68-K70 PolarHBondContact O-N 2.75Å; K70-M72 PolarHBondContact O-N 2.93Å
71	V	45.7	Very low	49.7	Very low	120 Å²	120	135.3 Å²	135.3	73%	0.727	74%	0.738	S	S	*	*			trans	-62.1	86.6	169.3	-179	0	0	0	0	105.1	V69 I73	V69-V71 VanDerWaalsContact C-N 3.25Å; V69-V71 PolarHBondContact O-N 3.26Å; V71-I73 HydrophobicContact CG1-CG1 4.09Å; V71-I73 PolarHBondContact O-N 2.94Å
72	M	42.6	Very low	49	Very low	158 Å²	158	127.6 Å²	127.6	78%	0.778	71%	0.712	S	S	*	*			trans	-66.3	100.3	160.6	-92.8	-174.3	91.3	0	0	104.2	K70 L74	K70-M72 PolarHBondContact O-N 2.93Å; M72-L74 PolarHBondContact O-N 2.82Å
73	I	44.8	Very low	49.3	Very low	141 Å²	141	127.4 Å²	127.4	72%	0.723	72%	0.719	S	S	*	*			trans	-62.5	81.6	160.5	-57.1	174.7	0	0	0	105.1	V71 T75	V71-I73 HydrophobicContact CG1-CG1 4.09Å; V71-I73 PolarHBondContact O-N 2.94Å; I73-T75 HydrophobicContact CG2-CG2 4.21Å; I73-T75 PolarHBondContact O-N 3.03Å
74	L	41.6	Very low	49.8	Very low	129 Å²	129	125.9 Å²	125.9	68%	0.675	71%	0.707	S	S	*	*			trans	-79.8	97.8	169.8	-172	68	0	0	0	106.4	M72 L76	M72-L74 PolarHBondContact O-N 2.82Å; L74-L76 PolarHBondContact O-N 2.72Å
75	T	42.1	Very low	50.7	Low	119 Å²	119	126.5 Å²	126.5	73%	0.73	72%	0.718	S	S	*	*			trans	-64.4	69.2	171.8	39.2	0	0	0	0	111.4	I73	I73-T75 HydrophobicContact CG2-CG2 4.21Å; I73-T75 PolarHBondContact O-N 3.03Å
76	L	44.4	Very low	51.6	Low	126 Å²	126	124.9 Å²	124.9	66%	0.66	70%	0.702	S	S	*	*	S	Bend	trans	-144.4	94.6	162	-86.7	107.4	0	0	0	110.5	L74 S78	L74-L76 PolarHBondContact O-N 2.72Å; L76-S78 PolarHBondContact O-N 3.27Å; L76-S78 VanDerWaalsContact O-N 3.13Å
77	T	46.4	Very low	53.2	Low	142 Å²	142	128.8 Å²	128.8	87%	0.871	72%	0.718	S	S	*	*			trans	57.8	31.4	147.2	64.5	0	0	0	0	119.5
78	S	50.8	Low	54.9	Low	90 Å²	90	126.9 Å²	126.9	63%	0.629	72%	0.719	S	S	*	*			trans	-90.2	113.5	165.6	-175.8	0	0	0	0	110.8	L76 F80	L76-S78 PolarHBondContact O-N 3.27Å; L76-S78 VanDerWaalsContact O-N 3.13Å; S78-F80 PolarHBondContact O-N 3.33Å
79	R	52.9	Low	56.7	Low	183 Å²	183	121.2 Å²	121.2	69%	0.691	71%	0.706	S	S	*	*	S	Bend	trans	-71.9	-0.6	178.7	-65.2	-163.8	-169.1	-163.6	2.7	114.3	M119	R79-M119 PolarHBondContact NH1-OXT 2.82Å
80	F	49.9	Very low	58.2	Low	142 Å²	142	119.1 Å²	119.1	62%	0.623	71%	0.707	S	S	*	*			trans	-101.1	65.2	170.7	-73.4	-85.1	0	0	0	110.1	S78 S82 L86	S78-F80 PolarHBondContact O-N 3.33Å; F80-S82 PolarHBondContact O-N 3.02Å; F80-S82 VanDerWaalsContact O-N 3.11Å; F80-L86 HydrophobicContact CB-CD1 3.8Å; F80-L86 HydrophobicContact CD1-CD1 3.48Å; F80-L86 VanDerWaalsContact CD1-CD1 3.48Å; F80-L86 HydrophobicContact CE1-CD1 4.34Å; F80-L86 HydrophobicContact CG-CD1 3.9Å
81	S	48.9	Very low	59.9	Low	115 Å²	115	120.1 Å²	120.1	80%	0.804	71%	0.707	S	S	*	*			trans	-82.2	56	164.9	69.9	0	0	0	0	109.8
82	S	50.5	Low	61.6	Low	56 Å²	56	119.1 Å²	119.1	39%	0.392	70%	0.695	S	S	.	*			trans	-80.7	125.6	160.9	52.3	0	0	0	0	107	F80 A84 L86	F80-S82 PolarHBondContact O-N 3.02Å; F80-S82 VanDerWaalsContact O-N 3.11Å; S82-A84 PolarHBondContact O-N 2.77Å; S82-A84 VanDerWaalsContact O-O 3.06Å; S82-A84 PolarHBondContact OG-O 2.91Å; S82-A84 VanDerWaalsContact OG-O 3.05Å; S82-L86 WeakPolarHBondContact OG-CD1 3.37Å
83	V	63.9	Low	63.4	Low	160 Å²	160	122.6 Å²	122.6	97%	0.97	70%	0.699	S	S	*	*	S	Bend	trans	-53.8	-16.2	172.7	176	0	0	0	0	112.1
84	A	67.5	Low	65.3	Low	62 Å²	62	124.1 Å²	124.1	51%	0.512	70%	0.701	S	S	.	*	S	Bend	trans	-93.9	137.5	173.2	0	0	0	0	0	112.3	S82 L86	S82-A84 PolarHBondContact O-N 2.77Å; S82-A84 VanDerWaalsContact O-O 3.06Å; S82-A84 PolarHBondContact OG-O 2.91Å; S82-A84 VanDerWaalsContact OG-O 3.05Å; A84-L86 PolarHBondContact O-N 3.02Å
85	P	76.4	Confident	67.3	Low	129 Å²	129	120.6 Å²	120.6	84%	0.838	68%	0.678	S	S	*	*	P	Polyproline II helix	trans	-63.6	126.7	173.4	27	-33	0	0	0	110.3
86	L	75	Confident	69.4	Low	95 Å²	95	119.2 Å²	119.2	50%	0.497	67%	0.667	S	S	.	*	P	Polyproline II helix	trans	-89.9	136.5	173.2	-71.2	160.3	0	0	0	109.6	F80 S82 A84 G88	F80-L86 HydrophobicContact CB-CD1 3.8Å; F80-L86 HydrophobicContact CD1-CD1 3.48Å; F80-L86 VanDerWaalsContact CD1-CD1 3.48Å; F80-L86 HydrophobicContact CE1-CD1 4.34Å; F80-L86 HydrophobicContact CG-CD1 3.9Å; S82-L86 WeakPolarHBondContact OG-CD1 3.37Å; A84-L86 PolarHBondContact O-N 3.02Å; L86-G88 PolarHBondContact O-N 3.26Å
87	P	86.6	Confident	71.3	Confident	129 Å²	129	115.9 Å²	115.9	84%	0.838	65%	0.654	S	S	*	*	S	Bend	trans	-70.1	121.7	174.2	28.1	-32.5	0	0	0	110.4
88	G	84	Confident	73.3	Confident	71 Å²	71	113.8 Å²	113.8	73%	0.732	64%	0.64	S	S	*	*	S	Bend	trans	77.6	-179.5	177.7	0	0	0	0	0	114.7	L86	L86-G88 PolarHBondContact O-N 3.26Å
89	A	83.4	Confident	75	Confident	77 Å²	77	116.1 Å²	116.1	64%	0.636	65%	0.646	S	S	*	*			trans	-93.1	143.1	172.1	0	0	0	0	0	110	Y91	A89-Y91 WeakPolarHBondContact O-CD2 3.4Å
90	G	78.4	Confident	76.7	Confident	68 Å²	68	110 Å²	110	70%	0.701	63%	0.625	S	S	*	*			trans	-66.8	136.1	169.9	0	0	0	0	0	110.6
91	Y	81.6	Confident	78.5	Confident	211 Å²	211	109.3 Å²	109.3	83%	0.827	63%	0.627	S	S	*	*			trans	-109.1	134.8	174.5	-77.5	-87.8	0	0	0	110.3	A89	A89-Y91 WeakPolarHBondContact O-CD2 3.4Å
92	Q	81.8	Confident	80.3	Confident	99 Å²	99	107.8 Å²	107.8	46%	0.463	62%	0.616	S	S	.	*			trans	-111	122.5	174.2	-171	-167	-27.4	0	0	108.8	D117	Q92-D117 PolarHBondContact NE2-O 3.32Å
93	W	80.7	Confident	82.1	Confident	230 Å²	230	112.9 Å²	112.9	87%	0.871	63%	0.634	S	S	*	*			trans	-69.5	139.2	171.9	-64.4	86.5	0	0	0	109.3
94	K	84.1	Confident	83.2	Confident	173 Å²	173	108 Å²	108	75%	0.752	61%	0.605	S	S	*	*			trans	-118.8	137.6	173.8	-66.4	-171.1	178.7	-175.3	0	108.9
95	R	85	Confident	84.2	Confident	55 Å²	55	109.1 Å²	109.1	21%	0.208	60%	0.598	C	S	.	*			trans	-63.3	139.7	174.6	-170	-179.7	-179	-167.7	4.9	110.3	E100 T104	R95-E100 WeakPolarHBondContact CG-OE1 3.17Å; R95-E100 IonicContact CZ-OE1 3.68Å; R95-E100 IonicContact CZ-OE2 3.11Å; R95-E100 VanDerWaalsContact NE-CD 3.29Å; R95-E100 IonicContact NE-OE1 2.79Å; R95-E100 PolarHBondContact NE-OE1 3Å; R95-E100 IonicContact NE-OE2 2.99Å; R95-E100 PolarHBondContact NE-OE2 3.34Å; R95-E100 IonicContact NH2-OE1 3.74Å; R95-E100 IonicContact NH2-OE2 2.61Å; R95-E100 PolarHBondContact NH2-OE2 2.93Å; R95-T104 VanDerWaalsContact NH2-C 3.31Å; R95-T104 PolarHBondContact NH2-O 3.45Å
96	N	84.8	Confident	84.8	Confident	91 Å²	91	108.5 Å²	108.5	49%	0.487	59%	0.588	S	S	.	*			trans	-119.5	100.6	169.4	-178.6	15.5	0	0	0	109.2	V98	N96-V98 PolarHBondContact O-N 3.38Å; N96-V98 VanDerWaalsContact OD1-CG2 3.28Å; N96-V98 WeakPolarHBondContact OD1-CG2 3.13Å; N96-V98 PolarHBondContact OD1-N 3.39Å
97	S	85.1	Confident	85.6	Confident	55 Å²	55	106.9 Å²	106.9	39%	0.385	58%	0.58	S	S	.	*	T	Hydrogen-bonded Turn	trans	-76.4	-1.1	-174.7	62.6	0	0	0	0	114.6	K105	S97-K105 VanDerWaalsContact O-CD 3.27Å; S97-K105 WeakPolarHBondContact O-CD 3.39Å; S97-K105 WeakPolarHBondContact O-CE 3.36Å; S97-K105 PolarHBondContact O-NZ 3.23Å
98	V	88.3	Confident	85.9	Confident	98 Å²	98	107.5 Å²	107.5	59%	0.594	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.8	-42.4	-177.5	179.8	0	0	0	0	111.3	N96	N96-V98 PolarHBondContact O-N 3.38Å; N96-V98 VanDerWaalsContact OD1-CG2 3.28Å; N96-V98 WeakPolarHBondContact OD1-CG2 3.13Å; N96-V98 PolarHBondContact OD1-N 3.39Å
99	D	86.8	Confident	86.2	Confident	139 Å²	139	106.9 Å²	106.9	74%	0.743	56%	0.556	S	S	*	*	S	Bend	trans	-98.9	4.7	-172.7	-56.4	-42.1	0	0	0	113.6
100	E	87.3	Confident	86.5	Confident	54 Å²	54	106 Å²	106	25%	0.252	54%	0.54	S	S	.	.	S	Bend	trans	-81.7	148.6	-178.1	-65.6	179	172.9	0	0	111.9	R95 K105	R95-E100 WeakPolarHBondContact CG-OE1 3.17Å; R95-E100 IonicContact CZ-OE1 3.68Å; R95-E100 IonicContact CZ-OE2 3.11Å; R95-E100 VanDerWaalsContact NE-CD 3.29Å; R95-E100 IonicContact NE-OE1 2.79Å; R95-E100 PolarHBondContact NE-OE1 3Å; R95-E100 IonicContact NE-OE2 2.99Å; R95-E100 PolarHBondContact NE-OE2 3.34Å; R95-E100 IonicContact NH2-OE1 3.74Å; R95-E100 IonicContact NH2-OE2 2.61Å; R95-E100 PolarHBondContact NH2-OE2 2.93Å; E100-K105 HydrophobicContact CB-CB 4.16Å
101	L	88.1	Confident	86.9	Confident	129 Å²	129	109 Å²	109	68%	0.675	53%	0.534	S	S	*	.			trans	-55.4	146.1	170.4	-65.3	170.2	0	0	0	110.1	Q103 T104 K105	L101-Q103 PolarHBondContact O-N 3.47Å; L101-Q103 VanDerWaalsContact O-N 3.12Å; L101-T104 PolarHBondContact O-N 3.28Å; L101-T104 PolarHBondContact O-OG1 2.91Å; L101-T104 VanDerWaalsContact O-OG1 3.11Å; L101-K105 VanDerWaalsContact O-CB 3.25Å; L101-K105 WeakPolarHBondContact O-CB 3.25Å; L101-K105 PolarHBondContact O-N 3.42Å
102	S	87.9	Confident	87.2	Confident	82 Å²	82	105 Å²	105	57%	0.573	52%	0.518	S	S	*	.	H	α-helix	trans	-51.3	-40.6	-179.6	52.4	0	0	0	0	112.7	T104 K105 D106	S102-T104 PolarHBondContact O-N 3.19Å; S102-K105 PolarHBondContact O-N 3.2Å; S102-D106 WeakPolarHBondContact O-CB 3.35Å; S102-D106 PolarHBondContact O-N 2.61Å
103	Q	86.7	Confident	87.5	Confident	164 Å²	164	104.6 Å²	104.6	77%	0.766	52%	0.519	S	S	*	.	H	α-helix	trans	-57.6	-47.3	178.8	-65.8	-178.1	-56.3	0	0	112.8	L101 D107	L101-Q103 PolarHBondContact O-N 3.47Å; L101-Q103 VanDerWaalsContact O-N 3.12Å; Q103-D107 WeakPolarHBondContact O-CB 3.48Å; Q103-D107 PolarHBondContact O-N 3.22Å
104	T	88.8	Confident	87.7	Confident	56 Å²	56	97.6 Å²	97.6	34%	0.344	50%	0.496	S	S	.	.	H	α-helix	trans	-77.3	-43.3	179.3	18.9	0	0	0	0	111.1	R95 L101 S102 D106 D107 L110	R95-T104 VanDerWaalsContact NH2-C 3.31Å; R95-T104 PolarHBondContact NH2-O 3.45Å; L101-T104 PolarHBondContact O-N 3.28Å; L101-T104 PolarHBondContact O-OG1 2.91Å; L101-T104 VanDerWaalsContact O-OG1 3.11Å; S102-T104 PolarHBondContact O-N 3.19Å; T104-D106 VanDerWaalsContact C-N 3.28Å; T104-D106 PolarHBondContact O-N 2.99Å; T104-D107 WeakPolarHBondContact O-CB 3.27Å; T104-D107 PolarHBondContact O-N 3.39Å; T104-D107 VanDerWaalsContact O-N 3.13Å; T104-L110 HydrophobicContact CG2-CD1 3.75Å
105	K	88.6	Confident	87.7	Confident	87 Å²	87	98 Å²	98	38%	0.378	49%	0.492	S	S	.	.	H	α-helix	trans	-55.4	-43.7	-178.7	-178	172.8	-171.4	161.7	0	112.3	S97 E100 L101 S102	S97-K105 VanDerWaalsContact O-CD 3.27Å; S97-K105 WeakPolarHBondContact O-CD 3.39Å; S97-K105 WeakPolarHBondContact O-CE 3.36Å; S97-K105 PolarHBondContact O-NZ 3.23Å; E100-K105 HydrophobicContact CB-CB 4.16Å; L101-K105 VanDerWaalsContact O-CB 3.25Å; L101-K105 WeakPolarHBondContact O-CB 3.25Å; L101-K105 PolarHBondContact O-N 3.42Å; S102-K105 PolarHBondContact O-N 3.2Å
106	D	88.5	Confident	87.7	Confident	116 Å²	116	100.6 Å²	100.6	62%	0.62	50%	0.503	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.9	0.9	-177	-60.3	-36.8	0	0	0	113.1	S102 T104 Q108	S102-D106 WeakPolarHBondContact O-CB 3.35Å; S102-D106 PolarHBondContact O-N 2.61Å; T104-D106 VanDerWaalsContact C-N 3.28Å; T104-D106 PolarHBondContact O-N 2.99Å; D106-Q108 PolarHBondContact O-N 2.79Å
107	D	92	Very high	87.4	Confident	61 Å²	61	100.2 Å²	100.2	33%	0.326	50%	0.501	S	S	.	.			trans	-67.8	116.4	178.9	-171.4	-4.6	0	0	0	111.5	Q103 T104 S109 L110 K111	Q103-D107 WeakPolarHBondContact O-CB 3.48Å; Q103-D107 PolarHBondContact O-N 3.22Å; T104-D107 WeakPolarHBondContact O-CB 3.27Å; T104-D107 PolarHBondContact O-N 3.39Å; T104-D107 VanDerWaalsContact O-N 3.13Å; D107-S109 PolarHBondContact O-N 3.32Å; D107-S109 WeakPolarHBondContact OD1-CB 3.44Å; D107-S109 PolarHBondContact OD1-N 2.99Å; D107-S109 PolarHBondContact OD1-OG 2.7Å; D107-S109 PolarHBondContact OD2-OG 2.78Å; D107-L110 HydrophobicContact CB-CB 4.47Å; D107-L110 HydrophobicContact CB-CD1 4.31Å; D107-L110 HydrophobicContact CB-CG 4.46Å; D107-L110 PolarHBondContact O-N 2.99Å; D107-K111 PolarHBondContact O-N 2.84Å
108	Q	91.7	Very high	86.7	Confident	141 Å²	141	100.8 Å²	100.8	66%	0.659	51%	0.505	S	S	*	.	H	α-helix	trans	-62.7	-30.8	177.1	-65.5	-63.1	-36.7	0	0	112.4	D106 K111 Y112	D106-Q108 PolarHBondContact O-N 2.79Å; Q108-K111 PolarHBondContact O-N 3.13Å; Q108-Y112 WeakPolarHBondContact O-CB 3.5Å; Q108-Y112 PolarHBondContact O-N 3.44Å
109	S	91.7	Very high	85.2	Confident	59 Å²	59	104.2 Å²	104.2	41%	0.413	52%	0.517	S	S	.	.	H	α-helix	trans	-66.8	-46	-178.7	80.7	0	0	0	0	111.3	D107 Y112 L113	D107-S109 PolarHBondContact O-N 3.32Å; D107-S109 WeakPolarHBondContact OD1-CB 3.44Å; D107-S109 PolarHBondContact OD1-N 2.99Å; D107-S109 PolarHBondContact OD1-OG 2.7Å; D107-S109 PolarHBondContact OD2-OG 2.78Å; S109-Y112 WeakPolarHBondContact O-CB 3.48Å; S109-Y112 PolarHBondContact O-N 3.33Å; S109-L113 PolarHBondContact O-N 2.85Å
110	L	88.8	Confident	85.1	Confident	57 Å²	57	102.5 Å²	102.5	30%	0.298	51%	0.505	S	S	.	.	H	α-helix	trans	-68.5	-36.9	177.8	-70.6	173.7	0	0	0	111.6	T104 D107 Y112 L113 E114	T104-L110 HydrophobicContact CG2-CD1 3.75Å; D107-L110 HydrophobicContact CB-CB 4.47Å; D107-L110 HydrophobicContact CB-CD1 4.31Å; D107-L110 HydrophobicContact CB-CG 4.46Å; D107-L110 PolarHBondContact O-N 2.99Å; L110-Y112 VanDerWaalsContact C-N 3.27Å; L110-Y112 PolarHBondContact O-N 3.06Å; L110-L113 HydrophobicContact CD2-CD1 4.5Å; L110-L113 PolarHBondContact O-N 3.11Å; L110-E114 PolarHBondContact O-N 3.43Å
111	K	85.7	Confident	85	Confident	132 Å²	132	105 Å²	105	57%	0.574	52%	0.519	S	S	*	.	H	α-helix	trans	-64.9	-32.1	173.5	-164.7	173.3	-172.5	172.4	0	112.5	D107 Q108	D107-K111 PolarHBondContact O-N 2.84Å; Q108-K111 PolarHBondContact O-N 3.13Å
112	Y	89.6	Confident	84.8	Confident	126 Å²	126	103.7 Å²	103.7	49%	0.494	51%	0.51	S	S	.	.	H	α-helix	trans	-71.4	-43.6	172.9	178.8	-97.4	0	0	0	111.6	Q108 S109 L110 E114 R115 Y116	Q108-Y112 WeakPolarHBondContact O-CB 3.5Å; Q108-Y112 PolarHBondContact O-N 3.44Å; S109-Y112 WeakPolarHBondContact O-CB 3.48Å; S109-Y112 PolarHBondContact O-N 3.33Å; L110-Y112 VanDerWaalsContact C-N 3.27Å; L110-Y112 PolarHBondContact O-N 3.06Å; Y112-E114 VanDerWaalsContact C-N 3.28Å; Y112-E114 PolarHBondContact O-N 3.44Å; Y112-R115 WeakPolarHBondContact O-CB 3.23Å; Y112-R115 PolarHBondContact O-N 3.35Å; Y112-Y116 HydrophobicContact CD1-CE2 4.08Å; Y112-Y116 AromaticContact CE1-CE2 3.53Å; Y112-Y116 HydrophobicContact CE1-CE2 3.53Å; Y112-Y116 AromaticContact CZ-CE2 3.93Å; Y112-Y116 PolarHBondContact OH-OH 3.12Å
113	L	87.3	Confident	84.6	Confident	91 Å²	91	104.9 Å²	104.9	48%	0.476	51%	0.506	S	S	.	.	H	α-helix	trans	-61.3	-34.1	177.7	-90.3	157.3	0	0	0	113.1	S109 L110 R115 Y116	S109-L113 PolarHBondContact O-N 2.85Å; L110-L113 HydrophobicContact CD2-CD1 4.5Å; L110-L113 PolarHBondContact O-N 3.11Å; L113-R115 PolarHBondContact O-N 3.21Å; L113-Y116 WeakPolarHBondContact O-CB 3.39Å; L113-Y116 PolarHBondContact O-N 2.91Å
114	E	85.2	Confident	84.5	Confident	84 Å²	84	101.3 Å²	101.3	39%	0.393	49%	0.49	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.8	-24.4	178.2	-165.5	173.3	-163.9	0	0	113.2	L110 Y112 Y116 D117	L110-E114 PolarHBondContact O-N 3.43Å; Y112-E114 VanDerWaalsContact C-N 3.28Å; Y112-E114 PolarHBondContact O-N 3.44Å; E114-Y116 PolarHBondContact O-N 3.2Å; E114-D117 PolarHBondContact O-N 3.03Å
115	R	84.4	Confident	84.2	Confident	181 Å²	181	104.3 Å²	104.3	68%	0.683	50%	0.5	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67	-22.8	173.7	-61.8	-173.6	-170	-172.9	4.4	113.6	Y112 L113	Y112-R115 WeakPolarHBondContact O-CB 3.23Å; Y112-R115 PolarHBondContact O-N 3.35Å; L113-R115 PolarHBondContact O-N 3.21Å
116	Y	84.1	Confident	83.9	Confident	109 Å²	109	105.5 Å²	105.5	43%	0.427	51%	0.508	S	S	.	.	T	Hydrogen-bonded Turn	trans	-95	-11.9	-179.4	-61.5	-80	0	0	0	113.2	Y112 L113 E114 S118 M119	Y112-Y116 HydrophobicContact CD1-CE2 4.08Å; Y112-Y116 AromaticContact CE1-CE2 3.53Å; Y112-Y116 HydrophobicContact CE1-CE2 3.53Å; Y112-Y116 AromaticContact CZ-CE2 3.93Å; Y112-Y116 PolarHBondContact OH-OH 3.12Å; L113-Y116 WeakPolarHBondContact O-CB 3.39Å; L113-Y116 PolarHBondContact O-N 2.91Å; E114-Y116 PolarHBondContact O-N 3.2Å; Y116-S118 PolarHBondContact O-N 3.04Å; Y116-M119 HydrophobicContact CD1-CE 3.91Å; Y116-M119 HydrophobicContact CD1-SD 4.09Å; Y116-M119 HydrophobicContact CE1-CE 4.17Å; Y116-M119 PolarHBondContact O-N 3.05Å
117	D	79	Confident	83.5	Confident	83 Å²	83	104.7 Å²	104.7	44%	0.444	50%	0.5	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.1	-22.3	179.2	-73.9	-13	0	0	0	112	Q92 E114	Q92-D117 PolarHBondContact NE2-O 3.32Å; E114-D117 PolarHBondContact O-N 3.03Å
118	S	70	Confident	82.8	Confident	68 Å²	68	108.3 Å²	108.3	48%	0.476	51%	0.514	S	S	.	.	T	Hydrogen-bonded Turn	trans	-103.9	20.6	-177	72.1	0	0	0	0	116.1	Y116	Y116-S118 PolarHBondContact O-N 3.04Å
119	M	55.9	Low	82	Confident	169 Å²	169	105.4 Å²	105.4	83%	0.833	50%	0.501	S	S	*	.			trans	-92.7	0	179.7	-68.8	-156.4	-175.6	0	0	114.4	R79 Y116	R79-M119 PolarHBondContact NH1-OXT 2.82Å; Y116-M119 HydrophobicContact CD1-CE 3.91Å; Y116-M119 HydrophobicContact CD1-SD 4.09Å; Y116-M119 HydrophobicContact CE1-CE 4.17Å; Y116-M119 PolarHBondContact O-N 3.05Å

Retrieved 119 of 119 residues in 62.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).